easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

fidgetiness

lactol

guerra

imperturbability

pregeniculatum

intermixedly

mordancies

trepidavissetisque

levitt

withal

derxia

chondrectomy

saffronwood

benightment

tetrasaccharide

xurel

yokels

laciniato


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: zimmer
cipher variations:
ajnnfs bkoogt clpphu dmqqiv enrrjw
fosskx gpttly hquumz irvvna jswwob
ktxxpc luyyqd mvzzre nwaasf oxbbtg
pyccuh qzddvi raeewj sbffxk tcggyl
udhhzm veiian wfjjbo xgkkcp yhlldq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: zimmer
Cipher: arnnvi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: zimmer
Cipher: BABBB ABAAA ABABB ABABB AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: zimmer
cipher variations:
ajnnfsyzllnawpjjviufhhdqsvfflyqlddtgmrzzjwkhxxre
ixvvzmgntthuedrrpcctppxkbkoogtzammobxqkkwjvgiier
twggmzrmeeuhnsaakxliyysfjywwanhouuivfessqdduqqyl
clpphuabnnpcyrllxkwhjjfsuxhhnasnffviotbblymjzztg
kzxxboipvvjwgfttreevrrzmdmqqivbcooqdzsmmylxikkgt
vyiiobtoggwjpuccmznkaauhlayycpjqwwkxhguusffwssan
enrrjwcdppreatnnzmyjllhuwzjjpcuphhxkqvddnaolbbvi
mbzzdqkrxxlyihvvtggxttbofosskxdeqqsfbuooanzkmmiv
xakkqdvqiiylrweeobpmccwjncaaerlsyymzjiwwuhhyuucp
gpttlyefrrtgcvppboalnnjwybllrewrjjzmsxffpcqnddxk
odbbfsmtzznakjxxviizvvdqhquumzfgssuhdwqqcpbmookx
zcmmsfxskkantyggqdroeeylpeccgtnuaaoblkyywjjawwer
irvvnaghttviexrrdqcnpplyadnntgytllbouzhhrespffzm
qfddhuovbbpcmlzzxkkbxxfsjswwobhiuuwjfysserdoqqmz
beoouhzummcpvaiisftqgganrgeeivpwccqdnmaayllcyygt
ktxxpcijvvxkgzttfseprrnacfppviavnndqwbjjtgurhhbo
shffjwqxddreonbbzmmdzzhuluyyqdjkwwylhauugtfqssob
dgqqwjbwooerxckkuhvsiicptiggkxryeesfpoccanneaaiv
mvzzreklxxzmibvvhugrttpcehrrxkcxppfsydllviwtjjdq
ujhhlyszfftgqpddboofbbjwnwaasflmyyanjcwwivhsuuqd
fissyldyqqgtzemmwjxukkervkiimztagguhrqeecppgcckx
oxbbtgmnzzbokdxxjwitvvregjttzmezrrhuafnnxkyvllfs
wljjnaubhhvisrffdqqhddlypyccuhnoaacpleyykxjuwwsf
hkuuanfassivbgooylzwmmgtxmkkobvciiwjtsggerrieemz
qzddviopbbdqmfzzlykvxxtgilvvbogbttjwchppzmaxnnhu
ynllpcwdjjxkuthhfssjffnaraeewjpqccerngaamzlwyyuh
jmwwcphcuukxdiqqanbyooivzommqdxekkylvuiigttkggob
sbffxkqrddfsohbbnamxzzviknxxdqidvvlyejrrboczppjw
apnnreyfllzmwvjjhuulhhpctcggylrseegtpiccobnyaawj
loyyerjewwmzfksscpdaqqkxbqoosfzgmmanxwkkivvmiiqd
udhhzmstffhuqjddpcozbbxkmpzzfskfxxnaglttdqebrrly
crpptgahnnboyxlljwwnjjreveiiantuggivrkeeqdpaccyl
nqaagtlgyyobhmuuerfcssmzdsqquhbioocpzymmkxxokksf
wfjjbouvhhjwslffreqbddzmorbbhumhzzpcinvvfsgdttna
etrrvicjppdqaznnlyyplltgxgkkcpvwiikxtmggsfrceean
psccivniaaqdjowwgtheuuobfusswjdkqqerbaoomzzqmmuh
yhlldqwxjjlyunhhtgsdffboqtddjwojbbrekpxxhuifvvpc
gvttxkelrrfscbppnaarnnvizimmerxykkmzvoiiuhteggcp
rueekxpkccsflqyyivjgwwqdhwuuylfmssgtdcqqobbsoowj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: zimmer
Cipher: mvzzre

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: zimmer
Cipher: 554223235124

Extended Methods:
Method #1

Plaintext: zimmer
method variations:
eorrkwktwwpbpybbugudggzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
z i m m e r 
5 4 2 2 5 2 
5 2 3 3 1 4 
They are then read out in rows:
542252523314
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: zimmer
Cipher: ugkknq

Read more ...
Method #3

Plaintext: zimmer
method variations:
ughxfy ghxfyu hxfyug
xfyugh fyughx yughxf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: zimmer

all 720 cipher variations:
zimmer zimmre zimemr zimerm zimrem zimrme zimmer zimmre zimemr zimerm zimrem
zimrme ziemmr ziemrm ziemmr ziemrm ziermm ziermm zirmem zirmme ziremm ziremm
zirmem zirmme zmimer zmimre zmiemr zmierm zmirem zmirme zmmier zmmire zmmeir
zmmeri zmmrei zmmrie zmemir zmemri zmeimr zmeirm zmerim zmermi zmrmei zmrmie
zmremi zmreim zmriem zmrime zmmier zmmire zmmeir zmmeri zmmrei zmmrie zmimer
zmimre zmiemr zmierm zmirem zmirme zmeimr zmeirm zmemir zmemri zmermi zmerim
zmriem zmrime zmreim zmremi zmrmei zmrmie zemmir zemmri zemimr zemirm zemrim
zemrmi zemmir zemmri zemimr zemirm zemrim zemrmi zeimmr zeimrm zeimmr zeimrm
zeirmm zeirmm zermim zermmi zerimm zerimm zermim zermmi zrmmei zrmmie zrmemi
zrmeim zrmiem zrmime zrmmei zrmmie zrmemi zrmeim zrmiem zrmime zremmi zremim
zremmi zremim zreimm zreimm zrimem zrimme zriemm zriemm zrimem zrimme izmmer
izmmre izmemr izmerm izmrem izmrme izmmer izmmre izmemr izmerm izmrem izmrme
izemmr izemrm izemmr izemrm izermm izermm izrmem izrmme izremm izremm izrmem
izrmme imzmer imzmre imzemr imzerm imzrem imzrme immzer immzre immezr immerz
immrez immrze imemzr imemrz imezmr imezrm imerzm imermz imrmez imrmze imremz
imrezm imrzem imrzme immzer immzre immezr immerz immrez immrze imzmer imzmre
imzemr imzerm imzrem imzrme imezmr imezrm imemzr imemrz imermz imerzm imrzem
imrzme imrezm imremz imrmez imrmze iemmzr iemmrz iemzmr iemzrm iemrzm iemrmz
iemmzr iemmrz iemzmr iemzrm iemrzm iemrmz iezmmr iezmrm iezmmr iezmrm iezrmm
iezrmm iermzm iermmz ierzmm ierzmm iermzm iermmz irmmez irmmze irmemz irmezm
irmzem irmzme irmmez irmmze irmemz irmezm irmzem irmzme iremmz iremzm iremmz
iremzm irezmm irezmm irzmem irzmme irzemm irzemm irzmem irzmme mizmer mizmre
mizemr mizerm mizrem mizrme mimzer mimzre mimezr mimerz mimrez mimrze miemzr
miemrz miezmr miezrm mierzm miermz mirmez mirmze miremz mirezm mirzem mirzme
mzimer mzimre mziemr mzierm mzirem mzirme mzmier mzmire mzmeir mzmeri mzmrei
mzmrie mzemir mzemri mzeimr mzeirm mzerim mzermi mzrmei mzrmie mzremi mzreim
mzriem mzrime mmzier mmzire mmzeir mmzeri mmzrei mmzrie mmizer mmizre mmiezr
mmierz mmirez mmirze mmeizr mmeirz mmezir mmezri mmerzi mmeriz mmriez mmrize
mmreiz mmrezi mmrzei mmrzie mezmir mezmri mezimr mezirm mezrim mezrmi memzir
memzri memizr memirz memriz memrzi meimzr meimrz meizmr meizrm meirzm meirmz
mermiz mermzi merimz merizm merzim merzmi mrzmei mrzmie mrzemi mrzeim mrziem
mrzime mrmzei mrmzie mrmezi mrmeiz mrmiez mrmize mremzi mremiz mrezmi mrezim
mreizm mreimz mrimez mrimze mriemz mriezm mrizem mrizme mimzer mimzre mimezr
mimerz mimrez mimrze mizmer mizmre mizemr mizerm mizrem mizrme miezmr miezrm
miemzr miemrz miermz mierzm mirzem mirzme mirezm miremz mirmez mirmze mmizer
mmizre mmiezr mmierz mmirez mmirze mmzier mmzire mmzeir mmzeri mmzrei mmzrie
mmezir mmezri mmeizr mmeirz mmeriz mmerzi mmrzei mmrzie mmrezi mmreiz mmriez
mmrize mzmier mzmire mzmeir mzmeri mzmrei mzmrie mzimer mzimre mziemr mzierm
mzirem mzirme mzeimr mzeirm mzemir mzemri mzermi mzerim mzriem mzrime mzreim
mzremi mzrmei mzrmie memzir memzri memizr memirz memriz memrzi mezmir mezmri
mezimr mezirm mezrim mezrmi meizmr meizrm meimzr meimrz meirmz meirzm merzim
merzmi merizm merimz mermiz mermzi mrmzei mrmzie mrmezi mrmeiz mrmiez mrmize
mrzmei mrzmie mrzemi mrzeim mrziem mrzime mrezmi mrezim mremzi mremiz mreimz
mreizm mrizem mrizme mriezm mriemz mrimez mrimze eimmzr eimmrz eimzmr eimzrm
eimrzm eimrmz eimmzr eimmrz eimzmr eimzrm eimrzm eimrmz eizmmr eizmrm eizmmr
eizmrm eizrmm eizrmm eirmzm eirmmz eirzmm eirzmm eirmzm eirmmz emimzr emimrz
emizmr emizrm emirzm emirmz emmizr emmirz emmzir emmzri emmrzi emmriz emzmir
emzmri emzimr emzirm emzrim emzrmi emrmzi emrmiz emrzmi emrzim emrizm emrimz
emmizr emmirz emmzir emmzri emmrzi emmriz emimzr emimrz emizmr emizrm emirzm
emirmz emzimr emzirm emzmir emzmri emzrmi emzrim emrizm emrimz emrzim emrzmi
emrmzi emrmiz ezmmir ezmmri ezmimr ezmirm ezmrim ezmrmi ezmmir ezmmri ezmimr
ezmirm ezmrim ezmrmi ezimmr ezimrm ezimmr ezimrm ezirmm ezirmm ezrmim ezrmmi
ezrimm ezrimm ezrmim ezrmmi ermmzi ermmiz ermzmi ermzim ermizm ermimz ermmzi
ermmiz ermzmi ermzim ermizm ermimz erzmmi erzmim erzmmi erzmim erzimm erzimm
erimzm erimmz erizmm erizmm erimzm erimmz rimmez rimmze rimemz rimezm rimzem
rimzme rimmez rimmze rimemz rimezm rimzem rimzme riemmz riemzm riemmz riemzm
riezmm riezmm rizmem rizmme rizemm rizemm rizmem rizmme rmimez rmimze rmiemz
rmiezm rmizem rmizme rmmiez rmmize rmmeiz rmmezi rmmzei rmmzie rmemiz rmemzi
rmeimz rmeizm rmezim rmezmi rmzmei rmzmie rmzemi rmzeim rmziem rmzime rmmiez
rmmize rmmeiz rmmezi rmmzei rmmzie rmimez rmimze rmiemz rmiezm rmizem rmizme
rmeimz rmeizm rmemiz rmemzi rmezmi rmezim rmziem rmzime rmzeim rmzemi rmzmei
rmzmie remmiz remmzi remimz remizm remzim remzmi remmiz remmzi remimz remizm
remzim remzmi reimmz reimzm reimmz reimzm reizmm reizmm rezmim rezmmi rezimm
rezimm rezmim rezmmi rzmmei rzmmie rzmemi rzmeim rzmiem rzmime rzmmei rzmmie
rzmemi rzmeim rzmiem rzmime rzemmi rzemim rzemmi rzemim rzeimm rzeimm rzimem
rzimme rziemm rziemm rzimem rzimme

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us