easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

divos

erinpc

obscenam

ferdiad

diffugisque

schenley

chisholm

duvetyns

rhomboid

cassine

lyttas

umbonulate

golgothas

roundeleer

tyrannosaurus

declararemus

lyman

escalations


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: zamias
cipher variations:
abnjbt bcokcu cdpldv deqmew efrnfx
fgsogy ghtphz hiuqia ijvrjb jkwskc
klxtld lmyume mnzvnf noawog opbxph
pqcyqi qrdzrj rseask stfbtl tugcum
uvhdvn vwiewo wxjfxp xykgyq yzlhzr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: zamias
Cipher: aznrzh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: zamias
Cipher: BABBB AAAAA ABABB ABAAA AAAAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: zamias
cipher variations:
abnjbtyblzbdwbjpbnubhfbxsbfvbhqbdlbrmbzrblkbxhbv
ibvxbfgbtnbpebrdbzcbptbjbcokcuzcmacexckqcovcigcy
tcgwcircemcsncascmlcyicwjcwycghcuocqfcsecadcquck
cdpldvadnbdfydlrdpwdjhdzudhxdjsdfndtodbtdnmdzjdx
kdxzdhidvpdrgdtfdbedrvdldeqmewbeocegzemseqxekiea
veiyektegoeupecueoneakeyleyaeijewqesheugecfeswem
efrnfxcfpdfhafntfryfljfbwfjzflufhpfvqfdvfpofblfz
mfzbfjkfxrftifvhfdgftxfnfgsogydgqegibgougszgmkgc
xgkagmvgiqgwrgewgqpgcmgangacgklgysgujgwigehguygo
ghtphzehrfhjchpvhtahnlhdyhlbhnwhjrhxshfxhrqhdnhb
ohbdhlmhzthvkhxjhfihvzhphiuqiafisgikdiqwiubiomie
zimcioxiksiytigyisrieoicpiceimniauiwliykigjiwaiq
ijvrjbgjthjlejrxjvcjpnjfajndjpyjltjzujhzjtsjfpjd
qjdfjnojbvjxmjzljhkjxbjrjkwskchkuikmfksykwdkqokg
bkoekqzkmukavkiakutkgqkerkegkopkcwkynkamkilkycks
klxtldilvjlngltzlxelrplhclpflralnvlbwljblvulhrlf
slfhlpqldxlzolbnljmlzdltlmyumejmwkmohmuamyfmsqmi
dmqgmsbmowmcxmkcmwvmismgtmgimqrmeymapmcomknmaemu
mnzvnfknxlnpinvbnzgntrnjenrhntcnpxndynldnxwnjtnh
unhjnrsnfznbqndpnlonbfnvnoawogloymoqjowcoahousok
fosioudoqyoezomeoyxokuoivoikostogaocroeqompocgow
opbxphmpznprkpxdpbipvtplgptjpveprzpfapnfpzyplvpj
wpjlptuphbpdspfrpnqpdhpxpqcyqinqaoqslqyeqcjqwuqm
hqukqwfqsaqgbqogqazqmwqkxqkmquvqicqetqgsqorqeiqy
qrdzrjorbprtmrzfrdkrxvrnirvlrxgrtbrhcrphrbarnxrl
yrlnrvwrjdrfurhtrpsrfjrzrseaskpscqsunsagselsywso
jswmsyhsucsidsqiscbsoysmzsmoswxskesgvsiusqtsgksa
stfbtlqtdrtvotbhtfmtzxtpktxntzitvdtjetrjtdctpztn
atnptxytlfthwtjvtruthltbtugcumruesuwpuciugnuayuq
luyouajuweukfuskueduqauobuoquyzumguixukwusvuimuc
uvhdvnsvftvxqvdjvhovbzvrmvzpvbkvxfvlgvtlvfevrbvp
cvprvzavnhvjyvlxvtwvjnvdvwiewotwguwyrwekwipwcaws
nwaqwclwygwmhwumwgfwscwqdwqswabwoiwkzwmywuxwkowe
wxjfxpuxhvxzsxflxjqxdbxtoxbrxdmxzhxnixvnxhgxtdxr
exrtxbcxpjxlaxnzxvyxlpxfxykgyqvyiwyatygmykryecyu
pycsyenyaiyojywoyihyueysfysuycdyqkymbyoaywzymqyg
yzlhzrwzjxzbuzhnzlszfdzvqzdtzfozbjzpkzxpzjizvfzt
gztvzdezrlznczpbzxaznrzhzamiasxakyacvaioamtageaw
raeuagpackaqlayqakjawgauhauwaefasmaodaqcaybaosai

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: zamias
Cipher: mnzvnf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: zamias
Cipher: 551123421134

Extended Methods:
Method #1

Plaintext: zamias
method variations:
efrofxklwtlcpqbyqhuvgdvn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
z a m i a s 
5 1 2 4 1 3 
5 1 3 2 1 4 
They are then read out in rows:
512413513214
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: zamias
Cipher: erlehq

Read more ...
Method #3

Plaintext: zamias
method variations:
efsbly fsblye sblyef
blyefs lyefsb yefsbl

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: zamias

all 720 cipher variations:
zamias zamisa zamais zamasi zamsai zamsia zaimas zaimsa zaiams zaiasm zaisam
zaisma zaaims zaaism zaamis zaamsi zaasmi zaasim zasiam zasima zasaim zasami
zasmai zasmia zmaias zmaisa zmaais zmaasi zmasai zmasia zmiaas zmiasa zmiaas
zmiasa zmisaa zmisaa zmaias zmaisa zmaais zmaasi zmasai zmasia zmsiaa zmsiaa
zmsaia zmsaai zmsaai zmsaia zimaas zimasa zimaas zimasa zimsaa zimsaa ziamas
ziamsa ziaams ziaasm ziasam ziasma ziaams ziaasm ziamas ziamsa ziasma ziasam
zisaam zisama zisaam zisama zismaa zismaa zamias zamisa zamais zamasi zamsai
zamsia zaimas zaimsa zaiams zaiasm zaisam zaisma zaaims zaaism zaamis zaamsi
zaasmi zaasim zasiam zasima zasaim zasami zasmai zasmia zsmiaa zsmiaa zsmaia
zsmaai zsmaai zsmaia zsimaa zsimaa zsiama zsiaam zsiaam zsiama zsaima zsaiam
zsamia zsamai zsaami zsaaim zsaiam zsaima zsaaim zsaami zsamai zsamia azmias
azmisa azmais azmasi azmsai azmsia azimas azimsa aziams aziasm azisam azisma
azaims azaism azamis azamsi azasmi azasim azsiam azsima azsaim azsami azsmai
azsmia amzias amzisa amzais amzasi amzsai amzsia amizas amizsa amiazs amiasz
amisaz amisza amaizs amaisz amazis amazsi amaszi amasiz amsiaz amsiza amsaiz
amsazi amszai amszia aimzas aimzsa aimazs aimasz aimsaz aimsza aizmas aizmsa
aizams aizasm aizsam aizsma aiazms aiazsm aiamzs aiamsz aiasmz aiaszm aiszam
aiszma aisazm aisamz aismaz aismza aamizs aamisz aamzis aamzsi aamszi aamsiz
aaimzs aaimsz aaizms aaizsm aaiszm aaismz aazims aazism aazmis aazmsi aazsmi
aazsim aasizm aasimz aaszim aaszmi aasmzi aasmiz asmiaz asmiza asmaiz asmazi
asmzai asmzia asimaz asimza asiamz asiazm asizam asizma asaimz asaizm asamiz
asamzi asazmi asazim asziam aszima aszaim aszami aszmai aszmia mazias mazisa
mazais mazasi mazsai mazsia maizas maizsa maiazs maiasz maisaz maisza maaizs
maaisz maazis maazsi maaszi maasiz masiaz masiza masaiz masazi maszai maszia
mzaias mzaisa mzaais mzaasi mzasai mzasia mziaas mziasa mziaas mziasa mzisaa
mzisaa mzaias mzaisa mzaais mzaasi mzasai mzasia mzsiaa mzsiaa mzsaia mzsaai
mzsaai mzsaia mizaas mizasa mizaas mizasa mizsaa mizsaa miazas miazsa miaazs
miaasz miasaz miasza miaazs miaasz miazas miazsa miasza miasaz misaaz misaza
misaaz misaza miszaa miszaa mazias mazisa mazais mazasi mazsai mazsia maizas
maizsa maiazs maiasz maisaz maisza maaizs maaisz maazis maazsi maaszi maasiz
masiaz masiza masaiz masazi maszai maszia msziaa msziaa mszaia mszaai mszaai
mszaia msizaa msizaa msiaza msiaaz msiaaz msiaza msaiza msaiaz msazia msazai
msaazi msaaiz msaiaz msaiza msaaiz msaazi msazai msazia iamzas iamzsa iamazs
iamasz iamsaz iamsza iazmas iazmsa iazams iazasm iazsam iazsma iaazms iaazsm
iaamzs iaamsz iaasmz iaaszm iaszam iaszma iasazm iasamz iasmaz iasmza imazas
imazsa imaazs imaasz imasaz imasza imzaas imzasa imzaas imzasa imzsaa imzsaa
imazas imazsa imaazs imaasz imasaz imasza imszaa imszaa imsaza imsaaz imsaaz
imsaza izmaas izmasa izmaas izmasa izmsaa izmsaa izamas izamsa izaams izaasm
izasam izasma izaams izaasm izamas izamsa izasma izasam izsaam izsama izsaam
izsama izsmaa izsmaa iamzas iamzsa iamazs iamasz iamsaz iamsza iazmas iazmsa
iazams iazasm iazsam iazsma iaazms iaazsm iaamzs iaamsz iaasmz iaaszm iaszam
iaszma iasazm iasamz iasmaz iasmza ismzaa ismzaa ismaza ismaaz ismaaz ismaza
iszmaa iszmaa iszama iszaam iszaam iszama isazma isazam isamza isamaz isaamz
isaazm isazam isazma isaazm isaamz isamaz isamza aamizs aamisz aamzis aamzsi
aamszi aamsiz aaimzs aaimsz aaizms aaizsm aaiszm aaismz aazims aazism aazmis
aazmsi aazsmi aazsim aasizm aasimz aaszim aaszmi aasmzi aasmiz amaizs amaisz
amazis amazsi amaszi amasiz amiazs amiasz amizas amizsa amisza amisaz amzias
amzisa amzais amzasi amzsai amzsia amsiza amsiaz amszia amszai amsazi amsaiz
aimazs aimasz aimzas aimzsa aimsza aimsaz aiamzs aiamsz aiazms aiazsm aiaszm
aiasmz aizams aizasm aizmas aizmsa aizsma aizsam aisazm aisamz aiszam aiszma
aismza aismaz azmias azmisa azmais azmasi azmsai azmsia azimas azimsa aziams
aziasm azisam azisma azaims azaism azamis azamsi azasmi azasim azsiam azsima
azsaim azsami azsmai azsmia asmiza asmiaz asmzia asmzai asmazi asmaiz asimza
asimaz asizma asizam asiazm asiamz aszima asziam aszmia aszmai aszami aszaim
asaizm asaimz asazim asazmi asamzi asamiz samiaz samiza samaiz samazi samzai
samzia saimaz saimza saiamz saiazm saizam saizma saaimz saaizm saamiz saamzi
saazmi saazim saziam sazima sazaim sazami sazmai sazmia smaiaz smaiza smaaiz
smaazi smazai smazia smiaaz smiaza smiaaz smiaza smizaa smizaa smaiaz smaiza
smaaiz smaazi smazai smazia smziaa smziaa smzaia smzaai smzaai smzaia simaaz
simaza simaaz simaza simzaa simzaa siamaz siamza siaamz siaazm siazam siazma
siaamz siaazm siamaz siamza siazma siazam sizaam sizama sizaam sizama sizmaa
sizmaa samiaz samiza samaiz samazi samzai samzia saimaz saimza saiamz saiazm
saizam saizma saaimz saaizm saamiz saamzi saazmi saazim saziam sazima sazaim
sazami sazmai sazmia szmiaa szmiaa szmaia szmaai szmaai szmaia szimaa szimaa
sziama sziaam sziaam sziama szaima szaiam szamia szamai szaami szaaim szaiam
szaima szaaim szaami szamai szamia

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us