easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

feriatis

formenic

glomeramusque

conciliar

creampuff

hepatogenic

touchhole

shopgirlish

niemiec

coluber

declaraverim

oceanographies

octogamy

poinding

tolerans

lignitious

teletyping

banilad


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: vicino
cipher variations:
wjdjop xkekpq ylflqr zmgmrs anhnst
boiotu cpjpuv dqkqvw erlrwx fsmsxy
gtntyz huouza ivpvab jwqwbc kxrxcd
lysyde mztzef nauafg obvbgh pcwchi
qdxdij reyejk sfzfkl tgaglm uhbhmn

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: vicino
Cipher: erxrml

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: vicino
Cipher: BBBAB ABAAA AAABA ABAAA ABBAA ABBAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: vicino
cipher variations:
wjdjopmzhzorcplpotsfpfovivtvoxylxlozerfroduhjhof
kxnxohanrnojqdvdolgtztonxkekpqnaiapsdqmqputgqgpw
jwuwpyzmympafsgspevikipglyoypibosopkrewepmhuaupo
ylflqrobjbqternrqvuhrhqxkxvxqzanznqbgthtqfwjljqh
mzpzqjcptpqlsfxfqnivbvqpzmgmrspckcrufsosrwvisiry
lywyraboaorchuiurgxkmkrinaqarkdquqrmtgygrojwcwrq
anhnstqdldsvgtptsxwjtjszmzxzsbcpbpsdivjvshylnlsj
obrbslervrsnuhzhspkxdxsrboioturemetwhuqutyxkukta
nayatcdqcqtejwkwtizmomtkpcsctmfswstoviaitqlyeyts
cpjpuvsfnfuxivrvuzylvlubobzbuderdrufkxlxujanpnul
qdtdungtxtupwjbjurmzfzutdqkqvwtgogvyjwswvazmwmvc
pcacvefsesvglymyvkboqovmreuevohuyuvqxkckvsnagavu
erlrwxuhphwzkxtxwbanxnwdqdbdwfgtftwhmznzwlcprpwn
sfvfwpivzvwryldlwtobhbwvfsmsxyviqixalyuyxcboyoxe
recexghuguxinaoaxmdqsqxotgwgxqjwawxszmemxupcicxw
gtntyzwjrjybmzvzydcpzpyfsfdfyhivhvyjobpbynertryp
uhxhyrkxbxytanfnyvqdjdyxhuouzaxkskzcnawazedqaqzg
tgegzijwiwzkpcqczofsuszqviyizslycyzubogozwrekezy
ivpvabyltladobxbaferbrahuhfhajkxjxalqdrdapgtvtar
wjzjatmzdzavcphpaxsflfazjwqwbczmumbepcycbgfscsbi
vigibklykybmresebqhuwubsxkakbunaeabwdqiqbytgmgba
kxrxcdanvncfqdzdchgtdtcjwjhjclmzlzcnsftfcrivxvct
ylblcvobfbcxerjrczuhnhcblysydebowodgreaedihueudk
xkikdmnamadotgugdsjwywduzmcmdwpcgcdyfsksdavioidc
mztzefcpxpehsfbfejivfvelyljlenobnbepuhvhetkxzxev
andnexqdhdezgtltebwjpjednauafgdqyqfitgcgfkjwgwfm
zmkmfopcocfqviwifulyayfwboeofyreiefahumufcxkqkfe
obvbgherzrgjuhdhglkxhxgnanlngpqdpdgrwjxjgvmzbzgx
cpfpgzsfjfgbivnvgdylrlgfpcwchifsashkvieihmlyiyho
bomohqreqehsxkykhwnacahydqgqhatgkghcjwowhezmsmhg
qdxdijgtbtilwjfjinmzjzipcpnpirsfrfitylzlixobdbiz
erhribuhlhidkxpxifantnihreyejkhucujmxkgkjonakajq
dqoqjstgsgjuzmamjypcecjafsisjcvimijelyqyjgbouoji
sfzfklivdvknylhlkpoblbkrerprktuhthkvanbnkzqdfdkb
gtjtkdwjnjkfmzrzkhcpvpkjtgaglmjwewlozmimlqpcmcls
fsqsluviuilwbocolaregelchukulexkoklgnasalidqwqlk
uhbhmnkxfxmpanjnmrqdndmtgtrtmvwjvjmxcpdpmbsfhfmd
ivlvmfylplmhobtbmjerxrmlvicinolygynqbokonsreoenu
husunwxkwknydqeqnctgignejwmwngzmqmnipcucnkfsysnm

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: vicino
Cipher: ivpvab

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: vicino
Cipher: 154231423343

Extended Methods:
Method #1

Plaintext: vicino
method variations:
aohostftntxylysycdqdxdhi

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
v i c i n o 
1 4 3 4 3 4 
5 2 1 2 3 3 
They are then read out in rows:
143434521233
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: vicino
Cipher: qsskfn

Read more ...
Method #3

Plaintext: vicino
method variations:
umqmsc mqmscu qmscum
mscumq scumqm cumqms

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: vicino

all 720 cipher variations:
vicino vicion vicnio vicnoi viconi vicoin viicno viicon viinco viinoc viionc
viiocn vinico vinioc vincio vincoi vinoci vinoic vioinc vioicn vionic vionci
viocni viocin vciino vciion vcinio vcinoi vcioni vcioin vciino vciion vcinio
vcinoi vcioni vcioin vcniio vcnioi vcniio vcnioi vcnoii vcnoii vcoini vcoiin
vconii vconii vcoini vcoiin vicino vicion vicnio vicnoi viconi vicoin viicno
viicon viinco viinoc viionc viiocn vinico vinioc vincio vincoi vinoci vinoic
vioinc vioicn vionic vionci viocni viocin vnciio vncioi vnciio vncioi vncoii
vncoii vnicio vnicoi vniico vniioc vnioic vnioci vniico vniioc vnicio vnicoi
vnioci vnioic vnoiic vnoici vnoiic vnoici vnocii vnocii vocini vociin vocnii
vocnii vocini vociin voicni voicin voinci voinic voiinc voiicn vonici voniic
voncii voncii vonici voniic voiinc voiicn voinic voinci voicni voicin ivcino
ivcion ivcnio ivcnoi ivconi ivcoin ivicno ivicon ivinco ivinoc ivionc iviocn
ivnico ivnioc ivncio ivncoi ivnoci ivnoic ivoinc ivoicn ivonic ivonci ivocni
ivocin icvino icvion icvnio icvnoi icvoni icvoin icivno icivon icinvo icinov
icionv iciovn icnivo icniov icnvio icnvoi icnovi icnoiv icoinv icoivn iconiv
iconvi icovni icovin iicvno iicvon iicnvo iicnov iiconv iicovn iivcno iivcon
iivnco iivnoc iivonc iivocn iinvco iinvoc iincvo iincov iinocv iinovc iiovnc
iiovcn iionvc iioncv iiocnv iiocvn incivo inciov incvio incvoi incovi incoiv
inicvo inicov inivco inivoc iniovc iniocv invico invioc invcio invcoi invoci
invoic inoivc inoicv inovic inovci inocvi inociv iocinv iocivn iocniv iocnvi
iocvni iocvin ioicnv ioicvn ioincv ioinvc ioivnc ioivcn ionicv ionivc ionciv
ioncvi ionvci ionvic iovinc iovicn iovnic iovnci iovcni iovcin civino civion
civnio civnoi civoni civoin ciivno ciivon ciinvo ciinov ciionv ciiovn cinivo
ciniov cinvio cinvoi cinovi cinoiv cioinv cioivn cioniv cionvi ciovni ciovin
cviino cviion cvinio cvinoi cvioni cvioin cviino cviion cvinio cvinoi cvioni
cvioin cvniio cvnioi cvniio cvnioi cvnoii cvnoii cvoini cvoiin cvonii cvonii
cvoini cvoiin civino civion civnio civnoi civoni civoin ciivno ciivon ciinvo
ciinov ciionv ciiovn cinivo ciniov cinvio cinvoi cinovi cinoiv cioinv cioivn
cioniv cionvi ciovni ciovin cnviio cnvioi cnviio cnvioi cnvoii cnvoii cnivio
cnivoi cniivo cniiov cnioiv cniovi cniivo cniiov cnivio cnivoi cniovi cnioiv
cnoiiv cnoivi cnoiiv cnoivi cnovii cnovii covini coviin covnii covnii covini
coviin coivni coivin coinvi coiniv coiinv coiivn conivi coniiv convii convii
conivi coniiv coiinv coiivn coiniv coinvi coivni coivin iicvno iicvon iicnvo
iicnov iiconv iicovn iivcno iivcon iivnco iivnoc iivonc iivocn iinvco iinvoc
iincvo iincov iinocv iinovc iiovnc iiovcn iionvc iioncv iiocnv iiocvn icivno
icivon icinvo icinov icionv iciovn icvino icvion icvnio icvnoi icvoni icvoin
icnvio icnvoi icnivo icniov icnoiv icnovi icovni icovin iconvi iconiv icoinv
icoivn ivcino ivcion ivcnio ivcnoi ivconi ivcoin ivicno ivicon ivinco ivinoc
ivionc iviocn ivnico ivnioc ivncio ivncoi ivnoci ivnoic ivoinc ivoicn ivonic
ivonci ivocni ivocin incvio incvoi incivo inciov incoiv incovi invcio invcoi
invico invioc invoic invoci inivco inivoc inicvo inicov iniocv iniovc inovic
inovci inoivc inoicv inociv inocvi iocvni iocvin iocnvi iocniv iocinv iocivn
iovcni iovcin iovnci iovnic iovinc iovicn ionvci ionvic ioncvi ionciv ionicv
ionivc ioivnc ioivcn ioinvc ioincv ioicnv ioicvn nicivo niciov nicvio nicvoi
nicovi nicoiv niicvo niicov niivco niivoc niiovc niiocv nivico nivioc nivcio
nivcoi nivoci nivoic nioivc nioicv niovic niovci niocvi niociv nciivo nciiov
ncivio ncivoi nciovi ncioiv nciivo nciiov ncivio ncivoi nciovi ncioiv ncviio
ncvioi ncviio ncvioi ncvoii ncvoii ncoivi ncoiiv ncovii ncovii ncoivi ncoiiv
nicivo niciov nicvio nicvoi nicovi nicoiv niicvo niicov niivco niivoc niiovc
niiocv nivico nivioc nivcio nivcoi nivoci nivoic nioivc nioicv niovic niovci
niocvi niociv nvciio nvcioi nvciio nvcioi nvcoii nvcoii nvicio nvicoi nviico
nviioc nvioic nvioci nviico nviioc nvicio nvicoi nvioci nvioic nvoiic nvoici
nvoiic nvoici nvocii nvocii nocivi nociiv nocvii nocvii nocivi nociiv noicvi
noiciv noivci noivic noiivc noiicv novici noviic novcii novcii novici noviic
noiivc noiicv noivic noivci noicvi noiciv oicinv oicivn oicniv oicnvi oicvni
oicvin oiicnv oiicvn oiincv oiinvc oiivnc oiivcn oinicv oinivc oinciv oincvi
oinvci oinvic oivinc oivicn oivnic oivnci oivcni oivcin ociinv ociivn ociniv
ocinvi ocivni ocivin ociinv ociivn ociniv ocinvi ocivni ocivin ocniiv ocnivi
ocniiv ocnivi ocnvii ocnvii ocvini ocviin ocvnii ocvnii ocvini ocviin oicinv
oicivn oicniv oicnvi oicvni oicvin oiicnv oiicvn oiincv oiinvc oiivnc oiivcn
oinicv oinivc oinciv oincvi oinvci oinvic oivinc oivicn oivnic oivnci oivcni
oivcin onciiv oncivi onciiv oncivi oncvii oncvii oniciv onicvi oniicv oniivc
onivic onivci oniicv oniivc oniciv onicvi onivci onivic onviic onvici onviic
onvici onvcii onvcii ovcini ovciin ovcnii ovcnii ovcini ovciin ovicni ovicin
ovinci ovinic oviinc oviicn ovnici ovniic ovncii ovncii ovnici ovniic oviinc
oviicn ovinic ovinci ovicni ovicin

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us