easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

unprayerful

boren

araguato

paroler

accidia

climatic

roachback

ichthyopsidan

overstrains

wonton

aphony

readds

acariciando

unflashing

iconoclasms

gessissentque

cedella

reconciler


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: verger
cipher variations:
wfshfs xgtigt yhujhu zivkiv ajwljw
bkxmkx clynly dmzomz enapna fobqob
gpcrpc hqdsqd iretre jsfusf ktgvtg
luhwuh mvixvi nwjywj oxkzxk pylayl
qzmbzm rancan sbodbo tcpecp udqfdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: verger
Cipher: evitvi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: verger
Cipher: BBBAB AABAA BAAAA AABBA AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: verger
cipher variations:
wfshfsmnatnacvifvisdqrdqilydlyytgptgejwnjwurezre
kzmlzmahuxhuqpcjpcgxkvxkxgtigtnobuobdwjgwjterser
jmzemzzuhquhfkxokxvsfasflanmanbivyivrqdkqdhylwyl
yhujhuopcvpcexkhxkufstfsknafnaavirviglyplywtgbtg
mbonbocjwzjwsrelreizmxzmzivkivpqdwqdfyliylvgtugt
lobgobbwjswjhmzqmzxuhcuhncpocpdkxakxtsfmsfjanyan
ajwljwqrexregzmjzmwhuvhumpchpccxktxkinarnayvidvi
odqpdqelyblyutgntgkbozbobkxmkxrsfysfhankanxivwiv
nqdiqddyluyljobsobzwjewjperqerfmzcmzvuhouhlcpacp
clynlystgztgibolboyjwxjworejreezmvzmkpctpcaxkfxk
qfsrfsgnadnawvipvimdqbdqdmzomztuhauhjcpmcpzkxykx
psfksffanwanlqduqdbylgylrgtsgthobeobxwjqwjnercer
enapnauvibvikdqndqalyzlyqtgltggboxbomrevreczmhzm
shuthuipcfpcyxkrxkofsdfsfobqobvwjcwjleroerbmzamz
ruhmuhhcpycpnsfwsfdaniantivuivjqdgqdzylsylpgtegt
gpcrpcwxkdxkmfspfscnabnasvinviidqzdqotgxtgebojbo
ujwvjwkrehreazmtzmqhufhuhqdsqdxyleylngtqgtdobcob
twjowjjeraerpuhyuhfcpkcpvkxwkxlsfisfbanuanrivgiv
iretreyzmfzmohurhuepcdpcuxkpxkkfsbfsqvizvigdqldq
wlyxlymtgjtgcbovbosjwhjwjsfusfzanganpivsivfqdeqd
vylqyllgtcgtrwjawjhermerxmzymznuhkuhdcpwcptkxikx
ktgvtgabohboqjwtjwgrefrewzmrzmmhudhusxkbxkifsnfs
ynaznaovilviedqxdqulyjlyluhwuhbcpicprkxukxhsfgsf
xansanniveivtylcyljgtogtzobaobpwjmwjferyervmzkmz
mvixvicdqjdqslyvlyitghtgybotboojwfjwuzmdzmkhuphu
apcbpcqxknxkgfszfswnalnanwjywjderkertmzwmzjuhiuh
zcpucppkxgkxvaneanlivqivbqdcqdryloylhgtagtxobmob
oxkzxkefslfsunaxnakvijviadqvdqqlyhlywbofbomjwrjw
credreszmpzmihubhuypcnpcpylaylfgtmgtvobyoblwjkwj
berwerrmzimzxcpgcpnkxskxdsfesftanqanjivcivzqdoqd
qzmbzmghunhuwpczpcmxklxkcfsxfssnajnaydqhdqolytly
etgftguborbokjwdjwareprerancanhivoivxqdaqdnylmyl
dgtygttobkobzerierpmzumzfuhguhvcpscplkxekxbsfqsf
sbodboijwpjwyrebreozmnzmehuzhuupclpcafsjfsqnavna
gvihviwdqtdqmlyflyctgrtgtcpecpjkxqkxzsfcsfpanoan
fivaivvqdmqdbgtkgtrobwobhwjiwjxeruernmzgmzduhsuh
udqfdqklyrlyatgdtgqbopbogjwbjwwrenrechulhuspcxpc
ixkjxkyfsvfsonahnaevitvivergerlmzsmzbuheuhrcpqcp
hkxckxxsfosfdivmivtqdyqdjylkylzgtwgtpobiobfwjuwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: verger
Cipher: iretre

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: verger
Cipher: 155124225124

Extended Methods:
Method #1

Plaintext: verger
method variations:
akwmkwfpbrpblugwugqzmbzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
v e r g e r 
1 5 2 2 5 2 
5 1 4 2 1 4 
They are then read out in rows:
152252514214
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: verger
Cipher: vgkeiq

Read more ...
Method #3

Plaintext: verger
method variations:
zfiwfd fiwfdz iwfdzf
wfdzfi fdzfiw dzfiwf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: verger

all 720 cipher variations:
verger vergre veregr vererg verreg verrge vegrer vegrre vegerr vegerr vegrer
vegrre veegrr veegrr veergr veerrg veerrg veergr verger vergre veregr vererg
verreg verrge vreger vregre vreegr vreerg vrereg vrerge vrgeer vrgere vrgeer
vrgere vrgree vrgree vreger vregre vreegr vreerg vrereg vrerge vrrgee vrrgee
vrrege vrreeg vrreeg vrrege vgreer vgrere vgreer vgrere vgrree vgrree vgerer
vgerre vgeerr vgeerr vgerer vgerre vgeerr vgeerr vgerer vgerre vgerre vgerer
vgreer vgrere vgreer vgrere vgrree vgrree verger vergre veregr vererg verreg
verrge vegrer vegrre vegerr vegerr vegrer vegrre veegrr veegrr veergr veerrg
veerrg veergr verger vergre veregr vererg verreg verrge vrrgee vrrgee vrrege
vrreeg vrreeg vrrege vrgree vrgree vrgere vrgeer vrgeer vrgere vregre vreger
vrerge vrereg vreerg vreegr vreger vregre vreegr vreerg vrereg vrerge evrger
evrgre evregr evrerg evrreg evrrge evgrer evgrre evgerr evgerr evgrer evgrre
evegrr evegrr evergr everrg everrg evergr evrger evrgre evregr evrerg evrreg
evrrge ervger ervgre ervegr erverg ervreg ervrge ergver ergvre ergevr ergerv
ergrev ergrve eregvr eregrv erevgr erevrg erervg erergv errgev errgve erregv
errevg errveg errvge egrver egrvre egrevr egrerv egrrev egrrve egvrer egvrre
egverr egverr egvrer egvrre egevrr egevrr egervr egerrv egerrv egervr egrver
egrvre egrevr egrerv egrrev egrrve eergvr eergrv eervgr eervrg eerrvg eerrgv
eegrvr eegrrv eegvrr eegvrr eegrvr eegrrv eevgrr eevgrr eevrgr eevrrg eevrrg
eevrgr eergvr eergrv eervgr eervrg eerrvg eerrgv errgev errgve erregv errevg
errveg errvge ergrev ergrve ergerv ergevr ergver ergvre eregrv eregvr erergv
erervg erevrg erevgr ervger ervgre ervegr erverg ervreg ervrge revger revgre
revegr reverg revreg revrge regver regvre regevr regerv regrev regrve reegvr
reegrv reevgr reevrg reervg reergv rergev rergve reregv rerevg rerveg rervge
rveger rvegre rveegr rveerg rvereg rverge rvgeer rvgere rvgeer rvgere rvgree
rvgree rveger rvegre rveegr rveerg rvereg rverge rvrgee rvrgee rvrege rvreeg
rvreeg rvrege rgveer rgvere rgveer rgvere rgvree rgvree rgever rgevre rgeevr
rgeerv rgerev rgerve rgeevr rgeerv rgever rgevre rgerve rgerev rgreev rgreve
rgreev rgreve rgrvee rgrvee revger revgre revegr reverg revreg revrge regver
regvre regevr regerv regrev regrve reegvr reegrv reevgr reevrg reervg reergv
rergev rergve reregv rerevg rerveg rervge rrvgee rrvgee rrvege rrveeg rrveeg
rrvege rrgvee rrgvee rrgeve rrgeev rrgeev rrgeve rregve rregev rrevge rreveg
rreevg rreegv rregev rregve rreegv rreevg rreveg rrevge gerver gervre gerevr
gererv gerrev gerrve gevrer gevrre geverr geverr gevrer gevrre geevrr geevrr
geervr geerrv geerrv geervr gerver gervre gerevr gererv gerrev gerrve grever
grevre greevr greerv grerev grerve grveer grvere grveer grvere grvree grvree
grever grevre greevr greerv grerev grerve grrvee grrvee grreve grreev grreev
grreve gvreer gvrere gvreer gvrere gvrree gvrree gverer gverre gveerr gveerr
gverer gverre gveerr gveerr gverer gverre gverre gverer gvreer gvrere gvreer
gvrere gvrree gvrree gerver gervre gerevr gererv gerrev gerrve gevrer gevrre
geverr geverr gevrer gevrre geevrr geevrr geervr geerrv geerrv geervr gerver
gervre gerevr gererv gerrev gerrve grrvee grrvee grreve grreev grreev grreve
grvree grvree grvere grveer grveer grvere grevre grever grerve grerev greerv
greevr grever grevre greevr greerv grerev grerve eergvr eergrv eervgr eervrg
eerrvg eerrgv eegrvr eegrrv eegvrr eegvrr eegrvr eegrrv eevgrr eevgrr eevrgr
eevrrg eevrrg eevrgr eergvr eergrv eervgr eervrg eerrvg eerrgv eregvr eregrv
erevgr erevrg erervg erergv ergevr ergerv ergver ergvre ergrve ergrev ervger
ervgre ervegr erverg ervreg ervrge errgve errgev errvge errveg errevg erregv
egrevr egrerv egrver egrvre egrrve egrrev egervr egerrv egevrr egevrr egervr
egerrv egverr egverr egvrer egvrre egvrre egvrer egrevr egrerv egrver egrvre
egrrve egrrev evrger evrgre evregr evrerg evrreg evrrge evgrer evgrre evgerr
evgerr evgrer evgrre evegrr evegrr evergr everrg everrg evergr evrger evrgre
evregr evrerg evrreg evrrge errgve errgev errvge errveg errevg erregv ergrve
ergrev ergvre ergver ergevr ergerv ervgre ervger ervrge ervreg erverg ervegr
eregvr eregrv erevgr erevrg erervg erergv rergev rergve reregv rerevg rerveg
rervge regrev regrve regerv regevr regver regvre reegrv reegvr reergv reervg
reevrg reevgr revger revgre revegr reverg revreg revrge rregev rregve rreegv
rreevg rreveg rrevge rrgeev rrgeve rrgeev rrgeve rrgvee rrgvee rregev rregve
rreegv rreevg rreveg rrevge rrvgee rrvgee rrvege rrveeg rrveeg rrvege rgreev
rgreve rgreev rgreve rgrvee rgrvee rgerev rgerve rgeerv rgeevr rgever rgevre
rgeerv rgeevr rgerev rgerve rgevre rgever rgveer rgvere rgveer rgvere rgvree
rgvree rergev rergve reregv rerevg rerveg rervge regrev regrve regerv regevr
regver regvre reegrv reegvr reergv reervg reevrg reevgr revger revgre revegr
reverg revreg revrge rvrgee rvrgee rvrege rvreeg rvreeg rvrege rvgree rvgree
rvgere rvgeer rvgeer rvgere rvegre rveger rverge rvereg rveerg rveegr rveger
rvegre rveegr rveerg rvereg rverge

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us