easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

womanlier

fibromas

rebrandish

ungladdened

unvictorious

yarthen

werewolfish

woodskin

fosteringly

paetrick

scobie

curavistique

modularizing

bosler

duplici

mistbow

foldout

colao


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: veniverasque
cipher variations:
wfojwfsbtrvf xgpkxgtcuswg yhqlyhudvtxh zirmzivewuyi ajsnajwfxvzj
bktobkxgywak clupclyhzxbl dmvqdmziaycm enwrenajbzdn foxsfobkcaeo
gpytgpcldbfp hqzuhqdmecgq iravirenfdhr jsbwjsfogeis ktcxktgphfjt
ludyluhqigku mvezmvirjhlv nwfanwjskimw oxgboxktljnx pyhcpylumkoy
qzidqzmvnlpz rajeranwomqa sbkfsboxpnrb tclgtcpyqosc udmhudqzrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: veniverasque
Cipher: evmrevizhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: veniverasque
Cipher: BBBAB AABAA ABBAA ABAAA BBBAB AABAA BAAAA AAAAA BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: veniverasque
cipher variations:
wfojwfsbtrvfmnozmnabdxjncvopcvibndxvsdofsdqbxjldilovilybhpzlytolytgbrvntejorejwblhpjurohurebvndr
kzoxkzmbftrzahonahubpzfhqpodqpcbzftpgxotgxkbjlhxxgpkxgtcuswgnopanobceykodwpqdwjcoeywtepgtercykme
jmpwjmzciqamzupmzuhcswoufkpsfkxcmiqkvspivsfcwoeslapylancgusabipobivcqagirqperqdcaguqhypuhylckmiy
yhqlyhudvtxhopqbopcdfzlpexqrexkdpfzxufqhufsdzlnfknqxknadjrbnavqnavidtxpvglqtglydnjrlwtqjwtgdxpft
mbqzmbodhvtbcjqpcjwdrbhjsrqfsredbhvrizqvizmdlnjzzirmzivewuyipqrcpqdegamqfyrsfyleqgayvgrivgteamog
lorylobekscobwrobwjeuyqwhmruhmzeoksmxurkxuheyqguncrancpeiwucdkrqdkxesciktsrgtsfeciwsjarwjanemoka
ajsnajwfxvzjqrsdqrefhbnrgzstgzmfrhbzwhsjwhufbnphmpszmpcfltdpcxspcxkfvzrxinsvinafpltnyvslyvifzrhv
odsbodqfjxvdelsrelyftdjlutshutgfdjxtkbsxkbofnplbbktobkxgywakrstersfgicoshatuhangsicaxitkxivgcoqi
nqtanqdgmueqdytqdylgwasyjotwjobgqmuozwtmzwjgasiwpetcpergkywefmtsfmzguekmvutivuhgekyulctylcpgoqmc
clupclyhzxblstufstghjdptibuvibohtjdbyjulyjwhdprjoruborehnvfrezurezmhxbtzkpuxkpchrnvpaxunaxkhbtjx
qfudqfshlzxfgnutgnahvflnwvujwvihflzvmduzmdqhprnddmvqdmziaycmtuvgtuhikequjcvwjcpiukeczkvmzkxieqsk
psvcpsfiowgsfavsfaniycualqvylqdisowqbyvobylicukyrgvergtimayghovuhobiwgmoxwvkxwjigmawnevaneriqsoe
enwrenajbzdnuvwhuvijlfrvkdwxkdqjvlfdalwnalyjfrtlqtwdqtgjpxhtgbwtgbojzdvbmrwzmrejtpxrczwpczmjdvlz
shwfshujnbzhipwvipcjxhnpyxwlyxkjhnbxofwbofsjrtpffoxsfobkcaeovwxivwjkmgswlexylerkwmgebmxobmzkgsum
ruxeruhkqyiuhcxuhcpkaewcnsxansfkuqysdaxqdankewmatixgtivkocaijqxwjqdkyioqzyxmzylkiocypgxcpgtksuqg
gpytgpcldbfpwxyjwxklnhtxmfyzmfslxnhfcnypcnalhtvnsvyfsvilrzjvidyvidqlbfxdotybotglvrztebyrebolfxnb
ujyhujwlpdbjkryxkrelzjprazynazmljpdzqhydqhultvrhhqzuhqdmecgqxyzkxylmoiuyngzangtmyoigdozqdobmiuwo
twzgtwjmsakwjezwjermcgyepuzcpuhmwsaufczsfcpmgyocvkzivkxmqecklszylsfmakqsbazobanmkqearizerivmuwsi
iravirenfdhryzalyzmnpjvzohabohunzpjheparepcnjvxpuxahuxkntblxkfaxkfsndhzfqvadqvinxtbvgdatgdqnhzpd
wlajwlynrfdlmtazmtgnblrtcbapcbonlrfbsjafsjwnvxtjjsbwjsfogeiszabmzanoqkwapibcpivoaqkifqbsfqdokwyq
vybivyloucmylgbylgtoeiagrwberwjoyucwhebuheroiaqexmbkxmzosgemnubanuhocmsudcbqdcpomsgctkbgtkxowyuk
ktcxktgphfjtabcnaboprlxbqjcdqjwpbrljgrctgreplxzrwzcjwzmpvdnzmhczmhupfjbhsxcfsxkpzvdxifcvifspjbrf
ynclynapthfnovcbovipdntvedcredqpnthdulchulypxzvlludyluhqigkubcdobcpqsmycrkderkxqcsmkhsduhsfqmyas
xadkxanqweoanidanivqgkcitydgtylqaweyjgdwjgtqkcsgzodmzobquigopwdcpwjqeouwfedsferqouievmdivmzqyawm
mvezmvirjhlvcdepcdqrtnzdslefslyrdtnlitevitgrnzbtybelyborxfpbojebojwrhldjuzehuzmrbxfzkhexkhurldth
apenapcrvjhpqxedqxkrfpvxgfetgfsrpvjfwnejwnarzbxnnwfanwjskimwdefqdersuoaetmfgtmzseuomjufwjuhsoacu
zcfmzcpsygqcpkfcpkxsimekvafivanscygalifylivsmeuibqfobqdswkiqryferylsgqwyhgfuhgtsqwkgxofkxobsacyo
oxgboxktljnxefgrefstvpbfunghunatfvpnkvgxkvitpbdvadgnadqtzhrdqlgdqlytjnflwbgjwbotdzhbmjgzmjwtnfvj
crgpcretxljrszgfszmthrxzihgvihutrxlhypglypctbdzppyhcpylumkoyfghsfgtuwqcgvohivobugwqolwhylwjuqcew
behoberuaisermhermzukogmxchkxcpueaicnkhankxuogwkdshqdsfuymkstahgtanuisyajihwjivusymizqhmzqduceaq
qzidqzmvnlpzghitghuvxrdhwpijwpcvhxrpmxizmxkvrdfxcfipcfsvbjtfsnifsnavlphnydilydqvfbjdolibolyvphxl
etiretgvznltubihubovjtzbkjixkjwvtznjarinarevdfbrrajeranwomqahijuhivwyseixqjkxqdwiysqnyjanylwsegy
dgjqdgtwckugtojgtobwmqiozejmzerwgckepmjcpmzwqiymfujsfuhwaomuvcjivcpwkuaclkjylkxwuaokbsjobsfwegcs
sbkfsboxpnrbijkvijwxztfjyrklyrexjztrozkbozmxtfhzehkrehuxdlvhupkhupcxnrjpafknafsxhdlfqnkdqnaxrjzn
gvktgvixbpnvwdkjwdqxlvbdmlkzmlyxvbplctkpctgxfhdttclgtcpyqoscjklwjkxyaugkzslmzsfykauspalcpanyugia
filsfivyemwivqlivqdyoskqbglobgtyiemgrolerobyskaohwluhwjycqowxelkxerymwcenmlanmzywcqmdulqduhygieu
udmhudqzrptdklmxklyzbvhlatmnatgzlbvtqbmdqbozvhjbgjmtgjwzfnxjwrmjwrezptlrchmpchuzjfnhspmfspcztlbp
ixmvixkzdrpxyfmlyfsznxdfonmbonazxdrnevmrevizhjfvveniverasquelmnylmzacwimbunobuhamcwurcnercpawikc
hknuhkxagoykxsnkxsfaqumsdinqdivakgoitqngtqdaumcqjynwjylaesqyzgnmzgtaoyegponcpobayesofwnsfwjaikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: veniverasque
Cipher: iravirenfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: veniverasque
Cipher: 155133421551241134145451

Extended Methods:
Method #1

Plaintext: veniverasque
method variations:
aksoakwfxvzkfpxtfpblcaeplucylugqhfkuqzhdqzmvnlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
v e n i v e r a s q u e 
1 5 3 4 1 5 2 1 3 1 5 5 
5 1 3 2 5 1 4 1 4 4 4 1 
They are then read out in rows:
153415213155513251414441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: veniverasque
Cipher: vsvbczehedtd

Read more ...
Method #3

Plaintext: veniverasque
method variations:
zlsbzfdldyya lsbzfdldyyaz sbzfdldyyazl
bzfdldyyazls zfdldyyazlsb fdldyyazlsbz
dldyyazlsbzf ldyyazlsbzfd dyyazlsbzfdl
yyazlsbzfdld yazlsbzfdldy azlsbzfdldyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: veniverasque

first 5040 cipher variations(475687488 total)
veniverasque veniverasqeu veniverasuqe veniverasueq veniveraseuq veniverasequ veniveraqsue veniveraqseu veniveraquse
veniveraques veniveraqeus veniveraqesu veniverauqse veniverauqes veniverausqe veniverauseq veniverauesq veniveraueqs
veniveraequs veniveraeqsu veniveraeuqs veniveraeusq veniveraesuq veniveraesqu veniversaque veniversaqeu veniversauqe
veniversaueq veniversaeuq veniversaequ veniversqaue veniversqaeu veniversquae veniversquea veniversqeua veniversqeau
veniversuqae veniversuqea veniversuaqe veniversuaeq veniversueaq veniversueqa veniversequa veniverseqau veniverseuqa
veniverseuaq veniverseauq veniverseaqu veniverqsaue veniverqsaeu veniverqsuae veniverqsuea veniverqseua veniverqseau
veniverqasue veniverqaseu veniverqause veniverqaues veniverqaeus veniverqaesu veniverquase veniverquaes veniverqusae
veniverqusea veniverquesa veniverqueas veniverqeaus veniverqeasu veniverqeuas veniverqeusa veniverqesua veniverqesau
veniverusqae veniverusqea veniverusaqe veniverusaeq veniveruseaq veniveruseqa veniveruqsae veniveruqsea veniveruqase
veniveruqaes veniveruqeas veniveruqesa veniveruaqse veniveruaqes veniveruasqe veniveruaseq veniveruaesq veniveruaeqs
veniverueqas veniverueqsa veniverueaqs veniverueasq veniveruesaq veniveruesqa veniveresqua veniveresqau veniveresuqa
veniveresuaq veniveresauq veniveresaqu venivereqsua venivereqsau veniverequsa veniverequas venivereqaus venivereqasu
venivereuqsa venivereuqas venivereusqa venivereusaq venivereuasq venivereuaqs venivereaqus venivereaqsu venivereauqs
venivereausq venivereasuq venivereasqu venivearsque venivearsqeu venivearsuqe venivearsueq venivearseuq venivearsequ
venivearqsue venivearqseu venivearquse venivearques venivearqeus venivearqesu venivearuqse venivearuqes venivearusqe
venivearuseq venivearuesq venivearueqs venivearequs veniveareqsu veniveareuqs veniveareusq venivearesuq venivearesqu
veniveasrque veniveasrqeu veniveasruqe veniveasrueq veniveasreuq veniveasrequ veniveasqrue veniveasqreu veniveasqure
veniveasquer veniveasqeur veniveasqeru veniveasuqre veniveasuqer veniveasurqe veniveasureq veniveasuerq veniveasueqr
veniveasequr veniveaseqru veniveaseuqr veniveaseurq veniveaseruq veniveaserqu veniveaqsrue veniveaqsreu veniveaqsure
veniveaqsuer veniveaqseur veniveaqseru veniveaqrsue veniveaqrseu veniveaqruse veniveaqrues veniveaqreus veniveaqresu
veniveaqurse veniveaqures veniveaqusre veniveaquser veniveaquesr veniveaquers veniveaqerus veniveaqersu veniveaqeurs
veniveaqeusr veniveaqesur veniveaqesru veniveausqre veniveausqer veniveausrqe veniveausreq veniveauserq veniveauseqr
veniveauqsre veniveauqser veniveauqrse veniveauqres veniveauqers veniveauqesr veniveaurqse veniveaurqes veniveaursqe
veniveaurseq veniveauresq veniveaureqs veniveaueqrs veniveaueqsr veniveauerqs veniveauersq veniveauesrq veniveauesqr
veniveaesqur veniveaesqru veniveaesuqr veniveaesurq veniveaesruq veniveaesrqu veniveaeqsur veniveaeqsru veniveaequsr
veniveaequrs veniveaeqrus veniveaeqrsu veniveaeuqsr veniveaeuqrs veniveaeusqr veniveaeusrq veniveaeursq veniveaeurqs
veniveaerqus veniveaerqsu veniveaeruqs veniveaerusq veniveaersuq veniveaersqu venivesarque venivesarqeu venivesaruqe
venivesarueq venivesareuq venivesarequ venivesaqrue venivesaqreu venivesaqure venivesaquer venivesaqeur venivesaqeru
venivesauqre venivesauqer venivesaurqe venivesaureq venivesauerq venivesaueqr venivesaequr venivesaeqru venivesaeuqr
venivesaeurq venivesaeruq venivesaerqu venivesraque venivesraqeu venivesrauqe venivesraueq venivesraeuq venivesraequ
venivesrqaue venivesrqaeu venivesrquae venivesrquea venivesrqeua venivesrqeau venivesruqae venivesruqea venivesruaqe
venivesruaeq venivesrueaq venivesrueqa venivesrequa venivesreqau venivesreuqa venivesreuaq venivesreauq venivesreaqu
venivesqraue venivesqraeu venivesqruae venivesqruea venivesqreua venivesqreau venivesqarue venivesqareu venivesqaure
venivesqauer venivesqaeur venivesqaeru venivesquare venivesquaer venivesqurae venivesqurea venivesquera venivesquear
venivesqeaur venivesqearu venivesqeuar venivesqeura venivesqerua venivesqerau venivesurqae venivesurqea venivesuraqe
venivesuraeq venivesureaq venivesureqa venivesuqrae venivesuqrea venivesuqare venivesuqaer venivesuqear venivesuqera
venivesuaqre venivesuaqer venivesuarqe venivesuareq venivesuaerq venivesuaeqr venivesueqar venivesueqra venivesueaqr
venivesuearq venivesueraq venivesuerqa veniveserqua veniveserqau veniveseruqa veniveseruaq veniveserauq veniveseraqu
veniveseqrua veniveseqrau venivesequra venivesequar veniveseqaur veniveseqaru veniveseuqra veniveseuqar veniveseurqa
veniveseuraq veniveseuarq veniveseuaqr veniveseaqur veniveseaqru veniveseauqr veniveseaurq venivesearuq venivesearqu
veniveqasrue veniveqasreu veniveqasure veniveqasuer veniveqaseur veniveqaseru veniveqarsue veniveqarseu veniveqaruse
veniveqarues veniveqareus veniveqaresu veniveqaurse veniveqaures veniveqausre veniveqauser veniveqauesr veniveqauers
veniveqaerus veniveqaersu veniveqaeurs veniveqaeusr veniveqaesur veniveqaesru veniveqsarue veniveqsareu veniveqsaure
veniveqsauer veniveqsaeur veniveqsaeru veniveqsraue veniveqsraeu veniveqsruae veniveqsruea veniveqsreua veniveqsreau
veniveqsurae veniveqsurea veniveqsuare veniveqsuaer veniveqsuear veniveqsuera veniveqserua veniveqserau veniveqseura
veniveqseuar veniveqseaur veniveqsearu veniveqrsaue veniveqrsaeu veniveqrsuae veniveqrsuea veniveqrseua veniveqrseau
veniveqrasue veniveqraseu veniveqrause veniveqraues veniveqraeus veniveqraesu veniveqruase veniveqruaes veniveqrusae
veniveqrusea veniveqruesa veniveqrueas veniveqreaus veniveqreasu veniveqreuas veniveqreusa veniveqresua veniveqresau
venivequsrae venivequsrea venivequsare venivequsaer venivequsear venivequsera veniveqursae veniveqursea venivequrase
venivequraes venivequreas venivequresa venivequarse venivequares venivequasre venivequaser venivequaesr venivequaers
venivequeras venivequersa venivequears venivequeasr venivequesar venivequesra veniveqesrua veniveqesrau veniveqesura
veniveqesuar veniveqesaur veniveqesaru veniveqersua veniveqersau veniveqerusa veniveqeruas veniveqeraus veniveqerasu
veniveqeursa veniveqeuras veniveqeusra veniveqeusar veniveqeuasr veniveqeuars veniveqearus veniveqearsu veniveqeaurs
veniveqeausr veniveqeasur veniveqeasru veniveuasqre veniveuasqer veniveuasrqe veniveuasreq veniveuaserq veniveuaseqr
veniveuaqsre veniveuaqser veniveuaqrse veniveuaqres veniveuaqers veniveuaqesr veniveuarqse veniveuarqes veniveuarsqe
veniveuarseq veniveuaresq veniveuareqs veniveuaeqrs veniveuaeqsr veniveuaerqs veniveuaersq veniveuaesrq veniveuaesqr
veniveusaqre veniveusaqer veniveusarqe veniveusareq veniveusaerq veniveusaeqr veniveusqare veniveusqaer veniveusqrae
veniveusqrea veniveusqera veniveusqear veniveusrqae veniveusrqea veniveusraqe veniveusraeq veniveusreaq veniveusreqa
veniveuseqra veniveuseqar veniveuserqa veniveuseraq veniveusearq veniveuseaqr veniveuqsare veniveuqsaer veniveuqsrae
veniveuqsrea veniveuqsera veniveuqsear veniveuqasre veniveuqaser veniveuqarse veniveuqares veniveuqaers veniveuqaesr
veniveuqrase veniveuqraes veniveuqrsae veniveuqrsea veniveuqresa veniveuqreas veniveuqears veniveuqeasr veniveuqeras
veniveuqersa veniveuqesra veniveuqesar veniveursqae veniveursqea veniveursaqe veniveursaeq veniveurseaq veniveurseqa
veniveurqsae veniveurqsea veniveurqase veniveurqaes veniveurqeas veniveurqesa veniveuraqse veniveuraqes veniveurasqe
veniveuraseq veniveuraesq veniveuraeqs veniveureqas veniveureqsa veniveureaqs veniveureasq veniveuresaq veniveuresqa
veniveuesqra veniveuesqar veniveuesrqa veniveuesraq veniveuesarq veniveuesaqr veniveueqsra veniveueqsar veniveueqrsa
veniveueqras veniveueqars veniveueqasr veniveuerqsa veniveuerqas veniveuersqa veniveuersaq veniveuerasq veniveueraqs
veniveueaqrs veniveueaqsr veniveuearqs veniveuearsq veniveueasrq veniveueasqr veniveeasqur veniveeasqru veniveeasuqr
veniveeasurq veniveeasruq veniveeasrqu veniveeaqsur veniveeaqsru veniveeaqusr veniveeaqurs veniveeaqrus veniveeaqrsu
veniveeauqsr veniveeauqrs veniveeausqr veniveeausrq veniveeaursq veniveeaurqs veniveearqus veniveearqsu veniveearuqs
veniveearusq veniveearsuq veniveearsqu veniveesaqur veniveesaqru veniveesauqr veniveesaurq veniveesaruq veniveesarqu
veniveesqaur veniveesqaru veniveesquar veniveesqura veniveesqrua veniveesqrau veniveesuqar veniveesuqra veniveesuaqr
veniveesuarq veniveesuraq veniveesurqa veniveesrqua veniveesrqau veniveesruqa veniveesruaq veniveesrauq veniveesraqu
veniveeqsaur veniveeqsaru veniveeqsuar veniveeqsura veniveeqsrua veniveeqsrau veniveeqasur veniveeqasru veniveeqausr
veniveeqaurs veniveeqarus veniveeqarsu veniveequasr veniveequars veniveequsar veniveequsra veniveeqursa veniveequras
veniveeqraus veniveeqrasu veniveeqruas veniveeqrusa veniveeqrsua veniveeqrsau veniveeusqar veniveeusqra veniveeusaqr
veniveeusarq veniveeusraq veniveeusrqa veniveeuqsar veniveeuqsra veniveeuqasr veniveeuqars veniveeuqras veniveeuqrsa
veniveeuaqsr veniveeuaqrs veniveeuasqr veniveeuasrq veniveeuarsq veniveeuarqs veniveeurqas veniveeurqsa veniveeuraqs
veniveeurasq veniveeursaq veniveeursqa veniveersqua veniveersqau veniveersuqa veniveersuaq veniveersauq veniveersaqu
veniveerqsua veniveerqsau veniveerqusa veniveerquas veniveerqaus veniveerqasu veniveeruqsa veniveeruqas veniveerusqa
veniveerusaq veniveeruasq veniveeruaqs veniveeraqus veniveeraqsu veniveerauqs veniveerausq veniveerasuq veniveerasqu
venivreasque venivreasqeu venivreasuqe venivreasueq venivreaseuq venivreasequ venivreaqsue venivreaqseu venivreaquse
venivreaques venivreaqeus venivreaqesu venivreauqse venivreauqes venivreausqe venivreauseq venivreauesq venivreaueqs
venivreaequs venivreaeqsu venivreaeuqs venivreaeusq venivreaesuq venivreaesqu venivresaque venivresaqeu venivresauqe
venivresaueq venivresaeuq venivresaequ venivresqaue venivresqaeu venivresquae venivresquea venivresqeua venivresqeau
venivresuqae venivresuqea venivresuaqe venivresuaeq venivresueaq venivresueqa venivresequa venivreseqau venivreseuqa
venivreseuaq venivreseauq venivreseaqu venivreqsaue venivreqsaeu venivreqsuae venivreqsuea venivreqseua venivreqseau
venivreqasue venivreqaseu venivreqause venivreqaues venivreqaeus venivreqaesu venivrequase venivrequaes venivrequsae
venivrequsea venivrequesa venivrequeas venivreqeaus venivreqeasu venivreqeuas venivreqeusa venivreqesua venivreqesau
venivreusqae venivreusqea venivreusaqe venivreusaeq venivreuseaq venivreuseqa venivreuqsae venivreuqsea venivreuqase
venivreuqaes venivreuqeas venivreuqesa venivreuaqse venivreuaqes venivreuasqe venivreuaseq venivreuaesq venivreuaeqs
venivreueqas venivreueqsa venivreueaqs venivreueasq venivreuesaq venivreuesqa venivreesqua venivreesqau venivreesuqa
venivreesuaq venivreesauq venivreesaqu venivreeqsua venivreeqsau venivreequsa venivreequas venivreeqaus venivreeqasu
venivreeuqsa venivreeuqas venivreeusqa venivreeusaq venivreeuasq venivreeuaqs venivreeaqus venivreeaqsu venivreeauqs
venivreeausq venivreeasuq venivreeasqu venivraesque venivraesqeu venivraesuqe venivraesueq venivraeseuq venivraesequ
venivraeqsue venivraeqseu venivraequse venivraeques venivraeqeus venivraeqesu venivraeuqse venivraeuqes venivraeusqe
venivraeuseq venivraeuesq venivraeueqs venivraeequs venivraeeqsu venivraeeuqs venivraeeusq venivraeesuq venivraeesqu
venivraseque venivraseqeu venivraseuqe venivraseueq venivraseeuq venivraseequ venivrasqeue venivrasqeeu venivrasquee
venivrasquee venivrasqeue venivrasqeeu venivrasuqee venivrasuqee venivrasueqe venivrasueeq venivrasueeq venivrasueqe
venivraseque venivraseqeu venivraseuqe venivraseueq venivraseeuq venivraseequ venivraqseue venivraqseeu venivraqsuee
venivraqsuee venivraqseue venivraqseeu venivraqesue venivraqeseu venivraqeuse venivraqeues venivraqeeus venivraqeesu
venivraquese venivraquees venivraqusee venivraqusee venivraquese venivraquees venivraqeeus venivraqeesu venivraqeues
venivraqeuse venivraqesue venivraqeseu venivrausqee venivrausqee venivrauseqe venivrauseeq venivrauseeq venivrauseqe
venivrauqsee venivrauqsee venivrauqese venivrauqees venivrauqees venivrauqese venivraueqse venivraueqes venivrauesqe
venivraueseq venivraueesq venivraueeqs venivraueqes venivraueqse venivraueeqs venivraueesq venivraueseq venivrauesqe
venivraesque venivraesqeu venivraesuqe venivraesueq venivraeseuq venivraesequ venivraeqsue venivraeqseu venivraequse
venivraeques venivraeqeus venivraeqesu venivraeuqse venivraeuqes venivraeusqe venivraeuseq venivraeuesq venivraeueqs
venivraeequs venivraeeqsu venivraeeuqs venivraeeusq venivraeesuq venivraeesqu venivrsaeque venivrsaeqeu venivrsaeuqe
venivrsaeueq venivrsaeeuq venivrsaeequ venivrsaqeue venivrsaqeeu venivrsaquee venivrsaquee venivrsaqeue venivrsaqeeu
venivrsauqee venivrsauqee venivrsaueqe venivrsaueeq venivrsaueeq venivrsaueqe venivrsaeque venivrsaeqeu venivrsaeuqe
venivrsaeueq venivrsaeeuq venivrsaeequ venivrseaque venivrseaqeu venivrseauqe venivrseaueq venivrseaeuq venivrseaequ
venivrseqaue venivrseqaeu venivrsequae venivrsequea venivrseqeua venivrseqeau venivrseuqae venivrseuqea venivrseuaqe
venivrseuaeq venivrseueaq venivrseueqa venivrseequa venivrseeqau venivrseeuqa venivrseeuaq venivrseeauq venivrseeaqu
venivrsqeaue venivrsqeaeu venivrsqeuae venivrsqeuea venivrsqeeua venivrsqeeau venivrsqaeue venivrsqaeeu venivrsqauee
venivrsqauee venivrsqaeue venivrsqaeeu venivrsquaee venivrsquaee venivrsqueae venivrsqueea venivrsqueea venivrsqueae
venivrsqeaue venivrsqeaeu venivrsqeuae venivrsqeuea venivrsqeeua venivrsqeeau venivrsueqae venivrsueqea venivrsueaqe
venivrsueaeq venivrsueeaq venivrsueeqa venivrsuqeae venivrsuqeea venivrsuqaee venivrsuqaee venivrsuqeae venivrsuqeea
venivrsuaqee venivrsuaqee venivrsuaeqe venivrsuaeeq venivrsuaeeq venivrsuaeqe venivrsueqae venivrsueqea venivrsueaqe
venivrsueaeq venivrsueeaq venivrsueeqa venivrseequa venivrseeqau venivrseeuqa venivrseeuaq venivrseeauq venivrseeaqu
venivrseqeua venivrseqeau venivrsequea venivrsequae venivrseqaue venivrseqaeu venivrseuqea venivrseuqae venivrseueqa
venivrseueaq venivrseuaeq venivrseuaqe venivrseaque venivrseaqeu venivrseauqe venivrseaueq venivrseaeuq venivrseaequ
venivrqaseue venivrqaseeu venivrqasuee venivrqasuee venivrqaseue venivrqaseeu venivrqaesue venivrqaeseu venivrqaeuse
venivrqaeues venivrqaeeus venivrqaeesu venivrqauese venivrqauees venivrqausee venivrqausee venivrqauese venivrqauees
venivrqaeeus venivrqaeesu venivrqaeues venivrqaeuse venivrqaesue venivrqaeseu venivrqsaeue venivrqsaeeu venivrqsauee
venivrqsauee venivrqsaeue venivrqsaeeu venivrqseaue venivrqseaeu venivrqseuae venivrqseuea venivrqseeua venivrqseeau
venivrqsueae venivrqsueea venivrqsuaee venivrqsuaee venivrqsueae venivrqsueea venivrqseeua venivrqseeau venivrqseuea
venivrqseuae venivrqseaue venivrqseaeu venivrqesaue venivrqesaeu venivrqesuae venivrqesuea venivrqeseua venivrqeseau
venivrqeasue venivrqeaseu venivrqeause venivrqeaues venivrqeaeus venivrqeaesu venivrqeuase venivrqeuaes venivrqeusae
venivrqeusea venivrqeuesa venivrqeueas venivrqeeaus venivrqeeasu venivrqeeuas venivrqeeusa venivrqeesua venivrqeesau
venivrquseae venivrquseea venivrqusaee venivrqusaee venivrquseae venivrquseea venivrquesae venivrquesea venivrquease
venivrqueaes venivrqueeas venivrqueesa venivrquaese venivrquaees venivrquasee venivrquasee venivrquaese venivrquaees
venivrqueeas venivrqueesa venivrqueaes venivrquease venivrquesae venivrquesea venivrqeseua venivrqeseau venivrqesuea
venivrqesuae venivrqesaue venivrqesaeu venivrqeesua venivrqeesau venivrqeeusa venivrqeeuas venivrqeeaus venivrqeeasu
venivrqeuesa venivrqeueas venivrqeusea venivrqeusae venivrqeuase venivrqeuaes venivrqeaeus venivrqeaesu venivrqeaues
venivrqeause venivrqeasue venivrqeaseu venivruasqee venivruasqee venivruaseqe venivruaseeq venivruaseeq venivruaseqe
venivruaqsee venivruaqsee venivruaqese venivruaqees venivruaqees venivruaqese venivruaeqse venivruaeqes venivruaesqe
venivruaeseq venivruaeesq venivruaeeqs venivruaeqes venivruaeqse venivruaeeqs venivruaeesq venivruaeseq venivruaesqe
venivrusaqee venivrusaqee venivrusaeqe venivrusaeeq venivrusaeeq venivrusaeqe venivrusqaee venivrusqaee venivrusqeae
venivrusqeea venivrusqeea venivrusqeae venivruseqae venivruseqea venivruseaqe venivruseaeq venivruseeaq venivruseeqa
venivruseqea venivruseqae venivruseeqa venivruseeaq venivruseaeq venivruseaqe venivruqsaee venivruqsaee venivruqseae
venivruqseea venivruqseea venivruqseae venivruqasee venivruqasee venivruqaese venivruqaees venivruqaees venivruqaese
venivruqease venivruqeaes venivruqesae venivruqesea venivruqeesa venivruqeeas venivruqeaes venivruqease venivruqeeas
venivruqeesa venivruqesea venivruqesae venivruesqae venivruesqea venivruesaqe venivruesaeq venivrueseaq venivrueseqa
venivrueqsae venivrueqsea venivrueqase venivrueqaes venivrueqeas venivrueqesa venivrueaqse venivrueaqes venivrueasqe
venivrueaseq venivrueaesq venivrueaeqs venivrueeqas venivrueeqsa venivrueeaqs venivrueeasq venivrueesaq venivrueesqa
venivruesqea venivruesqae venivrueseqa venivrueseaq venivruesaeq venivruesaqe venivrueqsea venivrueqsae venivrueqesa
venivrueqeas venivrueqaes venivrueqase venivrueeqsa venivrueeqas venivrueesqa venivrueesaq venivrueeasq venivrueeaqs
venivrueaqes venivrueaqse venivrueaeqs venivrueaesq venivrueaseq venivrueasqe venivreasque venivreasqeu venivreasuqe
venivreasueq venivreaseuq venivreasequ venivreaqsue venivreaqseu venivreaquse venivreaques venivreaqeus venivreaqesu
venivreauqse venivreauqes venivreausqe venivreauseq venivreauesq venivreaueqs venivreaequs venivreaeqsu venivreaeuqs
venivreaeusq venivreaesuq venivreaesqu venivresaque venivresaqeu venivresauqe venivresaueq venivresaeuq venivresaequ
venivresqaue venivresqaeu venivresquae venivresquea venivresqeua venivresqeau venivresuqae venivresuqea venivresuaqe
venivresuaeq venivresueaq venivresueqa venivresequa venivreseqau venivreseuqa venivreseuaq venivreseauq venivreseaqu
venivreqsaue venivreqsaeu venivreqsuae venivreqsuea venivreqseua venivreqseau venivreqasue venivreqaseu venivreqause
venivreqaues venivreqaeus venivreqaesu venivrequase venivrequaes venivrequsae venivrequsea venivrequesa venivrequeas
venivreqeaus venivreqeasu venivreqeuas venivreqeusa venivreqesua venivreqesau venivreusqae venivreusqea venivreusaqe
venivreusaeq venivreuseaq venivreuseqa venivreuqsae venivreuqsea venivreuqase venivreuqaes venivreuqeas venivreuqesa
venivreuaqse venivreuaqes venivreuasqe venivreuaseq venivreuaesq venivreuaeqs venivreueqas venivreueqsa venivreueaqs
venivreueasq venivreuesaq venivreuesqa venivreesqua venivreesqau venivreesuqa venivreesuaq venivreesauq venivreesaqu
venivreeqsua venivreeqsau venivreequsa venivreequas venivreeqaus venivreeqasu venivreeuqsa venivreeuqas venivreeusqa
venivreeusaq venivreeuasq venivreeuaqs venivreeaqus venivreeaqsu venivreeauqs venivreeausq venivreeasuq venivreeasqu
venivaresque venivaresqeu venivaresuqe venivaresueq venivareseuq venivaresequ venivareqsue venivareqseu venivarequse
venivareques venivareqeus venivareqesu venivareuqse venivareuqes venivareusqe venivareuseq venivareuesq venivareueqs
venivareequs venivareeqsu venivareeuqs venivareeusq venivareesuq venivareesqu venivarseque venivarseqeu venivarseuqe
venivarseueq venivarseeuq venivarseequ venivarsqeue venivarsqeeu venivarsquee venivarsquee venivarsqeue venivarsqeeu
venivarsuqee venivarsuqee venivarsueqe venivarsueeq venivarsueeq venivarsueqe venivarseque venivarseqeu venivarseuqe
venivarseueq venivarseeuq venivarseequ venivarqseue venivarqseeu venivarqsuee venivarqsuee venivarqseue venivarqseeu
venivarqesue venivarqeseu venivarqeuse venivarqeues venivarqeeus venivarqeesu venivarquese venivarquees venivarqusee
venivarqusee venivarquese venivarquees venivarqeeus venivarqeesu venivarqeues venivarqeuse venivarqesue venivarqeseu
venivarusqee venivarusqee venivaruseqe venivaruseeq venivaruseeq venivaruseqe venivaruqsee venivaruqsee venivaruqese
venivaruqees venivaruqees venivaruqese venivarueqse venivarueqes venivaruesqe venivarueseq venivarueesq venivarueeqs
venivarueqes venivarueqse venivarueeqs venivarueesq venivarueseq venivaruesqe venivaresque venivaresqeu venivaresuqe
venivaresueq venivareseuq venivaresequ venivareqsue venivareqseu venivarequse venivareques venivareqeus venivareqesu
venivareuqse venivareuqes venivareusqe venivareuseq venivareuesq venivareueqs venivareequs venivareeqsu venivareeuqs
venivareeusq venivareesuq venivareesqu venivaersque venivaersqeu venivaersuqe venivaersueq venivaerseuq venivaersequ
venivaerqsue venivaerqseu venivaerquse venivaerques venivaerqeus venivaerqesu venivaeruqse venivaeruqes venivaerusqe
venivaeruseq venivaeruesq venivaerueqs venivaerequs venivaereqsu venivaereuqs venivaereusq venivaeresuq venivaeresqu
venivaesrque venivaesrqeu venivaesruqe venivaesrueq venivaesreuq venivaesrequ venivaesqrue venivaesqreu venivaesqure
venivaesquer venivaesqeur venivaesqeru venivaesuqre venivaesuqer venivaesurqe venivaesureq venivaesuerq venivaesueqr
venivaesequr venivaeseqru venivaeseuqr venivaeseurq venivaeseruq venivaeserqu venivaeqsrue venivaeqsreu venivaeqsure
venivaeqsuer venivaeqseur venivaeqseru venivaeqrsue venivaeqrseu venivaeqruse venivaeqrues venivaeqreus venivaeqresu
venivaequrse venivaequres venivaequsre venivaequser venivaequesr venivaequers venivaeqerus venivaeqersu venivaeqeurs
venivaeqeusr venivaeqesur venivaeqesru venivaeusqre venivaeusqer venivaeusrqe venivaeusreq venivaeuserq venivaeuseqr
venivaeuqsre venivaeuqser venivaeuqrse venivaeuqres venivaeuqers venivaeuqesr venivaeurqse venivaeurqes venivaeursqe
venivaeurseq venivaeuresq venivaeureqs venivaeueqrs venivaeueqsr venivaeuerqs venivaeuersq venivaeuesrq venivaeuesqr
venivaeesqur venivaeesqru venivaeesuqr venivaeesurq venivaeesruq venivaeesrqu venivaeeqsur venivaeeqsru venivaeequsr
venivaeequrs venivaeeqrus venivaeeqrsu venivaeeuqsr venivaeeuqrs venivaeeusqr venivaeeusrq venivaeeursq venivaeeurqs
venivaeerqus venivaeerqsu venivaeeruqs venivaeerusq venivaeersuq venivaeersqu venivaserque venivaserqeu venivaseruqe
venivaserueq venivasereuq venivaserequ venivaseqrue venivaseqreu venivasequre venivasequer venivaseqeur venivaseqeru
venivaseuqre venivaseuqer venivaseurqe venivaseureq venivaseuerq venivaseueqr venivaseequr venivaseeqru venivaseeuqr
venivaseeurq venivaseeruq venivaseerqu venivasreque venivasreqeu venivasreuqe venivasreueq venivasreeuq venivasreequ
venivasrqeue venivasrqeeu venivasrquee venivasrquee venivasrqeue venivasrqeeu venivasruqee venivasruqee venivasrueqe
venivasrueeq venivasrueeq venivasrueqe venivasreque venivasreqeu venivasreuqe venivasreueq venivasreeuq venivasreequ
venivasqreue venivasqreeu venivasqruee venivasqruee venivasqreue venivasqreeu venivasqerue venivasqereu venivasqeure
venivasqeuer venivasqeeur venivasqeeru venivasquere venivasqueer venivasquree venivasquree venivasquere venivasqueer
venivasqeeur venivasqeeru venivasqeuer venivasqeure venivasqerue venivasqereu venivasurqee venivasurqee venivasureqe
venivasureeq venivasureeq venivasureqe venivasuqree venivasuqree venivasuqere venivasuqeer venivasuqeer venivasuqere
venivasueqre venivasueqer venivasuerqe venivasuereq venivasueerq venivasueeqr venivasueqer venivasueqre venivasueeqr
venivasueerq venivasuereq venivasuerqe venivaserque venivaserqeu venivaseruqe venivaserueq venivasereuq venivaserequ
venivaseqrue venivaseqreu venivasequre venivasequer venivaseqeur venivaseqeru venivaseuqre venivaseuqer venivaseurqe
venivaseureq venivaseuerq venivaseueqr venivaseequr venivaseeqru venivaseeuqr venivaseeurq venivaseeruq venivaseerqu
venivaqesrue venivaqesreu venivaqesure venivaqesuer venivaqeseur venivaqeseru venivaqersue venivaqerseu venivaqeruse
venivaqerues venivaqereus venivaqeresu venivaqeurse venivaqeures venivaqeusre venivaqeuser venivaqeuesr venivaqeuers
venivaqeerus venivaqeersu venivaqeeurs venivaqeeusr venivaqeesur venivaqeesru venivaqserue venivaqsereu venivaqseure
venivaqseuer venivaqseeur venivaqseeru venivaqsreue venivaqsreeu venivaqsruee venivaqsruee venivaqsreue venivaqsreeu
venivaqsuree venivaqsuree venivaqsuere venivaqsueer venivaqsueer venivaqsuere venivaqserue venivaqsereu venivaqseure
venivaqseuer venivaqseeur venivaqseeru venivaqrseue venivaqrseeu venivaqrsuee venivaqrsuee venivaqrseue venivaqrseeu
venivaqresue venivaqreseu venivaqreuse venivaqreues venivaqreeus venivaqreesu venivaqruese venivaqruees venivaqrusee
venivaqrusee venivaqruese venivaqruees venivaqreeus venivaqreesu venivaqreues venivaqreuse venivaqresue venivaqreseu
venivaqusree venivaqusree venivaqusere venivaquseer venivaquseer venivaqusere venivaqursee venivaqursee venivaqurese
venivaqurees venivaqurees venivaqurese venivaquerse venivaqueres venivaquesre venivaqueser venivaqueesr venivaqueers
venivaqueres venivaquerse venivaqueers venivaqueesr venivaqueser venivaquesre venivaqesrue venivaqesreu venivaqesure
venivaqesuer venivaqeseur venivaqeseru venivaqersue venivaqerseu venivaqeruse venivaqerues venivaqereus venivaqeresu
venivaqeurse venivaqeures venivaqeusre venivaqeuser venivaqeuesr venivaqeuers venivaqeerus venivaqeersu venivaqeeurs
venivaqeeusr venivaqeesur venivaqeesru venivauesqre venivauesqer venivauesrqe venivauesreq venivaueserq venivaueseqr
venivaueqsre venivaueqser venivaueqrse venivaueqres venivaueqers venivaueqesr venivauerqse venivauerqes venivauersqe
venivauerseq venivaueresq venivauereqs venivaueeqrs venivaueeqsr venivaueerqs venivaueersq venivaueesrq venivaueesqr
venivauseqre venivauseqer venivauserqe venivausereq venivauseerq venivauseeqr venivausqere venivausqeer venivausqree
venivausqree venivausqere venivausqeer venivausrqee venivausrqee venivausreqe venivausreeq venivausreeq venivausreqe
venivauseqre venivauseqer venivauserqe venivausereq venivauseerq venivauseeqr venivauqsere venivauqseer venivauqsree
venivauqsree venivauqsere venivauqseer venivauqesre venivauqeser venivauqerse venivauqeres venivauqeers venivauqeesr
venivauqrese venivauqrees venivauqrsee venivauqrsee venivauqrese venivauqrees venivauqeers venivauqeesr venivauqeres
venivauqerse venivauqesre venivauqeser venivaursqee venivaursqee venivaurseqe venivaurseeq venivaurseeq venivaurseqe
venivaurqsee venivaurqsee venivaurqese venivaurqees venivaurqees venivaurqese venivaureqse venivaureqes venivauresqe
venivaureseq venivaureesq venivaureeqs venivaureqes venivaureqse venivaureeqs venivaureesq venivaureseq venivauresqe
venivauesqre venivauesqer venivauesrqe venivauesreq venivaueserq venivaueseqr venivaueqsre venivaueqser venivaueqrse
venivaueqres venivaueqers venivaueqesr venivauerqse venivauerqes venivauersqe venivauerseq venivaueresq venivauereqs
venivaueeqrs venivaueeqsr venivaueerqs venivaueersq venivaueesrq venivaueesqr venivaeesqur venivaeesqru venivaeesuqr
venivaeesurq venivaeesruq venivaeesrqu venivaeeqsur venivaeeqsru venivaeequsr venivaeequrs venivaeeqrus venivaeeqrsu
venivaeeuqsr venivaeeuqrs venivaeeusqr venivaeeusrq venivaeeursq venivaeeurqs venivaeerqus venivaeerqsu venivaeeruqs
venivaeerusq venivaeersuq venivaeersqu venivaesequr venivaeseqru venivaeseuqr venivaeseurq venivaeseruq venivaeserqu
venivaesqeur venivaesqeru venivaesquer venivaesqure venivaesqrue venivaesqreu venivaesuqer venivaesuqre venivaesueqr
venivaesuerq venivaesureq venivaesurqe venivaesrque venivaesrqeu venivaesruqe venivaesrueq venivaesreuq venivaesrequ
venivaeqseur venivaeqseru venivaeqsuer venivaeqsure venivaeqsrue venivaeqsreu venivaeqesur venivaeqesru venivaeqeusr
venivaeqeurs venivaeqerus venivaeqersu venivaequesr venivaequers venivaequser venivaequsre venivaequrse venivaequres
venivaeqreus venivaeqresu venivaeqrues venivaeqruse venivaeqrsue venivaeqrseu venivaeusqer venivaeusqre venivaeuseqr
venivaeuserq venivaeusreq venivaeusrqe venivaeuqser venivaeuqsre venivaeuqesr venivaeuqers venivaeuqres venivaeuqrse
venivaeueqsr venivaeueqrs venivaeuesqr venivaeuesrq venivaeuersq venivaeuerqs venivaeurqes venivaeurqse venivaeureqs
venivaeuresq venivaeurseq venivaeursqe venivaersque venivaersqeu venivaersuqe venivaersueq venivaerseuq venivaersequ
venivaerqsue venivaerqseu venivaerquse venivaerques venivaerqeus venivaerqesu venivaeruqse venivaeruqes venivaerusqe
venivaeruseq venivaeruesq venivaerueqs venivaerequs venivaereqsu venivaereuqs venivaereusq venivaeresuq venivaeresqu
venivsraeque venivsraeqeu venivsraeuqe venivsraeueq venivsraeeuq venivsraeequ venivsraqeue venivsraqeeu venivsraquee
venivsraquee venivsraqeue venivsraqeeu venivsrauqee venivsrauqee venivsraueqe venivsraueeq venivsraueeq venivsraueqe
venivsraeque venivsraeqeu venivsraeuqe venivsraeueq venivsraeeuq venivsraeequ venivsreaque venivsreaqeu venivsreauqe
venivsreaueq venivsreaeuq venivsreaequ venivsreqaue venivsreqaeu venivsrequae venivsrequea venivsreqeua venivsreqeau
venivsreuqae venivsreuqea venivsreuaqe venivsreuaeq venivsreueaq venivsreueqa venivsreequa venivsreeqau venivsreeuqa
venivsreeuaq venivsreeauq venivsreeaqu venivsrqeaue venivsrqeaeu venivsrqeuae venivsrqeuea venivsrqeeua venivsrqeeau
venivsrqaeue venivsrqaeeu venivsrqauee venivsrqauee venivsrqaeue venivsrqaeeu venivsrquaee venivsrquaee venivsrqueae
venivsrqueea venivsrqueea venivsrqueae venivsrqeaue venivsrqeaeu venivsrqeuae venivsrqeuea venivsrqeeua venivsrqeeau
venivsrueqae venivsrueqea venivsrueaqe venivsrueaeq venivsrueeaq venivsrueeqa venivsruqeae venivsruqeea venivsruqaee
venivsruqaee venivsruqeae venivsruqeea venivsruaqee venivsruaqee venivsruaeqe venivsruaeeq venivsruaeeq venivsruaeqe
venivsrueqae venivsrueqea venivsrueaqe venivsrueaeq venivsrueeaq venivsrueeqa venivsreequa venivsreeqau venivsreeuqa
venivsreeuaq venivsreeauq venivsreeaqu venivsreqeua venivsreqeau venivsrequea venivsrequae venivsreqaue venivsreqaeu
venivsreuqea venivsreuqae venivsreueqa venivsreueaq venivsreuaeq venivsreuaqe venivsreaque venivsreaqeu venivsreauqe
venivsreaueq venivsreaeuq venivsreaequ venivsareque venivsareqeu venivsareuqe venivsareueq venivsareeuq venivsareequ
venivsarqeue venivsarqeeu venivsarquee venivsarquee venivsarqeue venivsarqeeu venivsaruqee venivsaruqee venivsarueqe
venivsarueeq venivsarueeq venivsarueqe venivsareque venivsareqeu venivsareuqe venivsareueq venivsareeuq venivsareequ
venivsaerque venivsaerqeu venivsaeruqe venivsaerueq venivsaereuq venivsaerequ venivsaeqrue venivsaeqreu venivsaequre
venivsaequer venivsaeqeur venivsaeqeru venivsaeuqre venivsaeuqer venivsaeurqe venivsaeureq venivsaeuerq venivsaeueqr
venivsaeequr venivsaeeqru venivsaeeuqr venivsaeeurq venivsaeeruq venivsaeerqu venivsaqerue venivsaqereu venivsaqeure
venivsaqeuer venivsaqeeur venivsaqeeru venivsaqreue venivsaqreeu venivsaqruee venivsaqruee venivsaqreue venivsaqreeu
venivsaquree venivsaquree venivsaquere venivsaqueer venivsaqueer venivsaquere venivsaqerue venivsaqereu venivsaqeure
venivsaqeuer venivsaqeeur venivsaqeeru venivsaueqre venivsaueqer venivsauerqe venivsauereq venivsaueerq venivsaueeqr
venivsauqere venivsauqeer venivsauqree venivsauqree venivsauqere venivsauqeer venivsaurqee venivsaurqee venivsaureqe
venivsaureeq venivsaureeq venivsaureqe venivsaueqre venivsaueqer venivsauerqe venivsauereq venivsaueerq venivsaueeqr
venivsaeequr venivsaeeqru venivsaeeuqr venivsaeeurq venivsaeeruq venivsaeerqu venivsaeqeur venivsaeqeru venivsaequer
venivsaequre venivsaeqrue venivsaeqreu venivsaeuqer venivsaeuqre venivsaeueqr venivsaeuerq venivsaeureq venivsaeurqe
venivsaerque venivsaerqeu venivsaeruqe venivsaerueq venivsaereuq venivsaerequ venivsearque venivsearqeu venivsearuqe
venivsearueq venivseareuq venivsearequ venivseaqrue venivseaqreu venivseaqure venivseaquer venivseaqeur venivseaqeru
venivseauqre venivseauqer venivseaurqe venivseaureq venivseauerq venivseaueqr venivseaequr venivseaeqru venivseaeuqr
venivseaeurq venivseaeruq venivseaerqu venivseraque venivseraqeu venivserauqe venivseraueq venivseraeuq venivseraequ
venivserqaue venivserqaeu venivserquae venivserquea venivserqeua venivserqeau venivseruqae venivseruqea venivseruaqe
venivseruaeq venivserueaq venivserueqa venivserequa venivsereqau venivsereuqa venivsereuaq venivsereauq venivsereaqu
venivseqraue venivseqraeu venivseqruae venivseqruea venivseqreua venivseqreau venivseqarue venivseqareu venivseqaure
venivseqauer venivseqaeur venivseqaeru venivsequare venivsequaer venivsequrae venivsequrea venivsequera venivsequear
venivseqeaur venivseqearu venivseqeuar venivseqeura venivseqerua venivseqerau venivseurqae venivseurqea venivseuraqe
venivseuraeq venivseureaq venivseureqa venivseuqrae venivseuqrea venivseuqare venivseuqaer venivseuqear venivseuqera
venivseuaqre venivseuaqer venivseuarqe venivseuareq venivseuaerq venivseuaeqr venivseueqar venivseueqra venivseueaqr
venivseuearq venivseueraq venivseuerqa venivseerqua venivseerqau venivseeruqa venivseeruaq venivseerauq venivseeraqu
venivseeqrua venivseeqrau venivseequra venivseequar venivseeqaur venivseeqaru venivseeuqra venivseeuqar venivseeurqa
venivseeuraq venivseeuarq venivseeuaqr venivseeaqur venivseeaqru venivseeauqr venivseeaurq venivseearuq venivseearqu
venivsqaerue venivsqaereu venivsqaeure venivsqaeuer venivsqaeeur venivsqaeeru venivsqareue venivsqareeu venivsqaruee
venivsqaruee venivsqareue venivsqareeu venivsqauree venivsqauree venivsqauere venivsqaueer venivsqaueer venivsqauere
venivsqaerue venivsqaereu venivsqaeure venivsqaeuer venivsqaeeur venivsqaeeru venivsqearue venivsqeareu venivsqeaure
venivsqeauer venivsqeaeur venivsqeaeru venivsqeraue venivsqeraeu venivsqeruae venivsqeruea venivsqereua venivsqereau
venivsqeurae venivsqeurea venivsqeuare venivsqeuaer venivsqeuear venivsqeuera venivsqeerua venivsqeerau venivsqeeura
venivsqeeuar venivsqeeaur venivsqeearu venivsqreaue venivsqreaeu venivsqreuae venivsqreuea venivsqreeua venivsqreeau
venivsqraeue venivsqraeeu venivsqrauee venivsqrauee venivsqraeue venivsqraeeu venivsqruaee venivsqruaee venivsqrueae
venivsqrueea venivsqrueea venivsqrueae venivsqreaue venivsqreaeu venivsqreuae venivsqreuea venivsqreeua venivsqreeau
venivsquerae venivsquerea venivsqueare venivsqueaer venivsqueear venivsqueera venivsqureae venivsqureea venivsquraee
venivsquraee venivsqureae venivsqureea venivsquaree venivsquaree venivsquaere venivsquaeer venivsquaeer venivsquaere
venivsquerae venivsquerea venivsqueare venivsqueaer venivsqueear venivsqueera venivsqeerua venivsqeerau venivsqeeura
venivsqeeuar venivsqeeaur venivsqeearu venivsqereua venivsqereau venivsqeruea venivsqeruae venivsqeraue venivsqeraeu
venivsqeurea venivsqeurae venivsqeuera venivsqeuear venivsqeuaer venivsqeuare venivsqearue venivsqeareu venivsqeaure
venivsqeauer venivsqeaeur venivsqeaeru venivsuaeqre venivsuaeqer venivsuaerqe venivsuaereq venivsuaeerq venivsuaeeqr
venivsuaqere venivsuaqeer venivsuaqree venivsuaqree venivsuaqere venivsuaqeer venivsuarqee venivsuarqee venivsuareqe
venivsuareeq venivsuareeq venivsuareqe venivsuaeqre venivsuaeqer venivsuaerqe venivsuaereq venivsuaeerq venivsuaeeqr
venivsueaqre venivsueaqer venivsuearqe venivsueareq venivsueaerq venivsueaeqr venivsueqare venivsueqaer venivsueqrae
venivsueqrea venivsueqera venivsueqear venivsuerqae venivsuerqea venivsueraqe venivsueraeq venivsuereaq venivsuereqa
venivsueeqra venivsueeqar venivsueerqa venivsueeraq venivsueearq venivsueeaqr venivsuqeare venivsuqeaer venivsuqerae
venivsuqerea venivsuqeera venivsuqeear venivsuqaere venivsuqaeer venivsuqaree venivsuqaree venivsuqaere venivsuqaeer
venivsuqraee venivsuqraee venivsuqreae venivsuqreea venivsuqreea venivsuqreae venivsuqeare venivsuqeaer venivsuqerae
venivsuqerea venivsuqeera venivsuqeear venivsureqae venivsureqea venivsureaqe venivsureaeq venivsureeaq venivsureeqa
venivsurqeae venivsurqeea venivsurqaee venivsurqaee venivsurqeae venivsurqeea venivsuraqee venivsuraqee venivsuraeqe
venivsuraeeq venivsuraeeq venivsuraeqe venivsureqae venivsureqea venivsureaqe venivsureaeq venivsureeaq venivsureeqa
venivsueeqra venivsueeqar venivsueerqa venivsueeraq venivsueearq venivsueeaqr venivsueqera venivsueqear venivsueqrea
venivsueqrae venivsueqare venivsueqaer venivsuerqea venivsuerqae venivsuereqa venivsuereaq venivsueraeq venivsueraqe
venivsueaqre venivsueaqer venivsuearqe venivsueareq venivsueaerq venivsueaeqr venivseaequr venivseaeqru venivseaeuqr
venivseaeurq venivseaeruq venivseaerqu venivseaqeur venivseaqeru venivseaquer venivseaqure venivseaqrue venivseaqreu
venivseauqer venivseauqre venivseaueqr venivseauerq venivseaureq venivseaurqe venivsearque venivsearqeu venivsearuqe
venivsearueq venivseareuq venivsearequ venivseeaqur venivseeaqru venivseeauqr venivseeaurq venivseearuq venivseearqu
venivseeqaur venivseeqaru venivseequar venivseequra venivseeqrua venivseeqrau venivseeuqar venivseeuqra venivseeuaqr
venivseeuarq venivseeuraq venivseeurqa venivseerqua venivseerqau venivseeruqa venivseeruaq venivseerauq venivseeraqu
venivseqeaur venivseqearu venivseqeuar venivseqeura venivseqerua venivseqerau venivseqaeur venivseqaeru venivseqauer
venivseqaure venivseqarue venivseqareu venivsequaer venivsequare venivsequear venivsequera venivsequrea venivsequrae
venivseqraue venivseqraeu venivseqruae venivseqruea venivseqreua venivseqreau venivseueqar venivseueqra venivseueaqr
venivseuearq venivseueraq venivseuerqa venivseuqear venivseuqera venivseuqaer venivseuqare venivseuqrae venivseuqrea
venivseuaqer venivseuaqre venivseuaeqr venivseuaerq venivseuareq venivseuarqe venivseurqae venivseurqea venivseuraqe
venivseuraeq venivseureaq venivseureqa venivserequa venivsereqau venivsereuqa venivsereuaq venivsereauq venivsereaqu
venivserqeua venivserqeau venivserquea venivserquae venivserqaue venivserqaeu venivseruqea venivseruqae venivserueqa
venivserueaq venivseruaeq venivseruaqe venivseraque venivseraqeu venivserauqe venivseraueq venivseraeuq venivseraequ
venivqraseue venivqraseeu venivqrasuee venivqrasuee venivqraseue venivqraseeu venivqraesue venivqraeseu venivqraeuse
venivqraeues venivqraeeus venivqraeesu venivqrauese venivqrauees venivqrausee venivqrausee venivqrauese venivqrauees
venivqraeeus venivqraeesu venivqraeues venivqraeuse venivqraesue venivqraeseu venivqrsaeue venivqrsaeeu venivqrsauee
venivqrsauee venivqrsaeue venivqrsaeeu venivqrseaue venivqrseaeu venivqrseuae venivqrseuea venivqrseeua venivqrseeau
venivqrsueae venivqrsueea venivqrsuaee venivqrsuaee venivqrsueae venivqrsueea venivqrseeua venivqrseeau venivqrseuea
venivqrseuae venivqrseaue venivqrseaeu venivqresaue venivqresaeu venivqresuae venivqresuea venivqreseua venivqreseau
venivqreasue venivqreaseu venivqreause venivqreaues venivqreaeus venivqreaesu venivqreuase venivqreuaes venivqreusae
venivqreusea venivqreuesa venivqreueas venivqreeaus venivqreeasu venivqreeuas venivqreeusa venivqreesua venivqreesau
venivqruseae venivqruseea venivqrusaee venivqrusaee venivqruseae venivqruseea venivqruesae venivqruesea venivqruease
venivqrueaes venivqrueeas venivqrueesa venivqruaese venivqruaees venivqruasee venivqruasee venivqruaese venivqruaees
venivqrueeas venivqrueesa venivqrueaes venivqruease venivqruesae venivqruesea venivqreseua venivqreseau venivqresuea
venivqresuae venivqresaue venivqresaeu venivqreesua venivqreesau venivqreeusa venivqreeuas venivqreeaus venivqreeasu
venivqreuesa venivqreueas venivqreusea venivqreusae venivqreuase venivqreuaes venivqreaeus venivqreaesu venivqreaues
venivqreause venivqreasue venivqreaseu venivqarseue venivqarseeu venivqarsuee venivqarsuee venivqarseue venivqarseeu
venivqaresue venivqareseu venivqareuse venivqareues venivqareeus venivqareesu venivqaruese venivqaruees venivqarusee
venivqarusee venivqaruese venivqaruees venivqareeus venivqareesu venivqareues venivqareuse venivqaresue venivqareseu
venivqasreue venivqasreeu venivqasruee venivqasruee venivqasreue venivqasreeu venivqaserue venivqasereu venivqaseure
venivqaseuer venivqaseeur venivqaseeru venivqasuere venivqasueer venivqasuree venivqasuree venivqasuere venivqasueer
venivqaseeur venivqaseeru venivqaseuer venivqaseure venivqaserue venivqasereu venivqaesrue venivqaesreu venivqaesure
venivqaesuer venivqaeseur venivqaeseru venivqaersue venivqaerseu venivqaeruse venivqaerues venivqaereus venivqaeresu
venivqaeurse venivqaeures venivqaeusre venivqaeuser venivqaeuesr venivqaeuers venivqaeerus venivqaeersu venivqaeeurs
venivqaeeusr venivqaeesur venivqaeesru venivqausere venivqauseer venivqausree venivqausree venivqausere venivqauseer
venivqauesre venivqaueser venivqauerse venivqaueres venivqaueers venivqaueesr venivqaurese venivqaurees venivqaursee
venivqaursee venivqaurese venivqaurees venivqaueers venivqaueesr venivqaueres venivqauerse venivqauesre venivqaueser
venivqaeseur venivqaeseru venivqaesuer venivqaesure venivqaesrue venivqaesreu venivqaeesur venivqaeesru venivqaeeusr
venivqaeeurs venivqaeerus venivqaeersu venivqaeuesr venivqaeuers venivqaeuser venivqaeusre venivqaeurse venivqaeures
venivqaereus venivqaeresu venivqaerues venivqaeruse venivqaersue venivqaerseu venivqsareue venivqsareeu venivqsaruee
venivqsaruee venivqsareue venivqsareeu venivqsaerue venivqsaereu venivqsaeure venivqsaeuer venivqsaeeur venivqsaeeru
venivqsauere venivqsaueer venivqsauree venivqsauree venivqsauere venivqsaueer venivqsaeeur venivqsaeeru venivqsaeuer
venivqsaeure venivqsaerue venivqsaereu venivqsraeue venivqsraeeu venivqsrauee venivqsrauee venivqsraeue venivqsraeeu
venivqsreaue venivqsreaeu venivqsreuae venivqsreuea venivqsreeua venivqsreeau venivqsrueae venivqsrueea venivqsruaee
venivqsruaee venivqsrueae venivqsrueea venivqsreeua venivqsreeau venivqsreuea venivqsreuae venivqsreaue venivqsreaeu
venivqseraue venivqseraeu venivqseruae venivqseruea venivqsereua venivqsereau venivqsearue venivqseareu venivqseaure
venivqseauer venivqseaeur venivqseaeru venivqseuare venivqseuaer venivqseurae venivqseurea venivqseuera venivqseuear
venivqseeaur venivqseearu venivqseeuar venivqseeura venivqseerua venivqseerau venivqsureae venivqsureea venivqsuraee
venivqsuraee venivqsureae venivqsureea venivqsuerae venivqsuerea venivqsueare venivqsueaer venivqsueear venivqsueera
venivqsuaere venivqsuaeer venivqsuaree venivqsuaree venivqsuaere venivqsuaeer venivqsueear venivqsueera venivqsueaer
venivqsueare venivqsuerae venivqsuerea venivqsereua venivqsereau venivqseruea venivqseruae venivqseraue venivqseraeu
venivqseerua venivqseerau venivqseeura venivqseeuar venivqseeaur venivqseearu venivqseuera venivqseuear venivqseurea
venivqseurae venivqseuare venivqseuaer venivqseaeur venivqseaeru venivqseauer venivqseaure venivqsearue venivqseareu
venivqeasrue venivqeasreu venivqeasure venivqeasuer venivqeaseur venivqeaseru venivqearsue venivqearseu venivqearuse
venivqearues venivqeareus venivqearesu venivqeaurse venivqeaures venivqeausre venivqeauser venivqeauesr venivqeauers
venivqeaerus venivqeaersu venivqeaeurs venivqeaeusr venivqeaesur venivqeaesru venivqesarue venivqesareu venivqesaure
venivqesauer venivqesaeur venivqesaeru venivqesraue venivqesraeu venivqesruae venivqesruea venivqesreua venivqesreau
venivqesurae venivqesurea venivqesuare venivqesuaer venivqesuear venivqesuera venivqeserua venivqeserau venivqeseura
venivqeseuar venivqeseaur venivqesearu venivqersaue venivqersaeu venivqersuae venivqersuea venivqerseua venivqerseau
venivqerasue venivqeraseu venivqerause venivqeraues venivqeraeus venivqeraesu venivqeruase venivqeruaes venivqerusae
venivqerusea venivqeruesa venivqerueas venivqereaus venivqereasu venivqereuas venivqereusa venivqeresua venivqeresau
venivqeusrae venivqeusrea venivqeusare venivqeusaer venivqeusear venivqeusera venivqeursae venivqeursea venivqeurase
venivqeuraes venivqeureas venivqeuresa venivqeuarse venivqeuares venivqeuasre venivqeuaser venivqeuaesr venivqeuaers
venivqeueras venivqeuersa venivqeuears venivqeueasr venivqeuesar venivqeuesra venivqeesrua venivqeesrau venivqeesura
venivqeesuar venivqeesaur venivqeesaru venivqeersua venivqeersau venivqeerusa venivqeeruas venivqeeraus venivqeerasu
venivqeeursa venivqeeuras venivqeeusra venivqeeusar venivqeeuasr venivqeeuars venivqeearus venivqeearsu venivqeeaurs
venivqeeausr venivqeeasur venivqeeasru venivquasere venivquaseer venivquasree venivquasree venivquasere venivquaseer
venivquaesre venivquaeser venivquaerse venivquaeres venivquaeers venivquaeesr venivquarese venivquarees venivquarsee
venivquarsee venivquarese venivquarees venivquaeers venivquaeesr venivquaeres venivquaerse venivquaesre venivquaeser
venivqusaere venivqusaeer venivqusaree venivqusaree venivqusaere venivqusaeer venivquseare venivquseaer venivquserae
venivquserea venivquseera venivquseear venivqusreae venivqusreea venivqusraee venivqusraee venivqusreae venivqusreea
venivquseera venivquseear venivquserea venivquserae venivquseare venivquseaer venivquesare venivquesaer venivquesrae
venivquesrea venivquesera venivquesear venivqueasre venivqueaser venivquearse venivqueares venivqueaers venivqueaesr
venivquerase venivqueraes venivquersae venivquersea venivqueresa venivquereas venivqueears venivqueeasr venivqueeras
venivqueersa venivqueesra venivqueesar venivqurseae venivqurseea venivqursaee venivqursaee venivqurseae venivqurseea
venivquresae venivquresea venivqurease venivqureaes venivqureeas venivqureesa venivquraese venivquraees venivqurasee
venivqurasee venivquraese venivquraees venivqureeas venivqureesa venivqureaes venivqurease venivquresae venivquresea
venivquesera venivquesear venivquesrea venivquesrae venivquesare venivquesaer venivqueesra venivqueesar venivqueersa
venivqueeras venivqueears venivqueeasr venivqueresa venivquereas venivquersea venivquersae venivquerase venivqueraes
venivqueaers venivqueaesr venivqueares venivquearse venivqueasre venivqueaser venivqeaseur venivqeaseru venivqeasuer
venivqeasure venivqeasrue venivqeasreu venivqeaesur venivqeaesru venivqeaeusr venivqeaeurs venivqeaerus venivqeaersu
venivqeauesr venivqeauers venivqeauser venivqeausre venivqeaurse venivqeaures venivqeareus venivqearesu venivqearues
venivqearuse venivqearsue venivqearseu venivqesaeur venivqesaeru venivqesauer venivqesaure venivqesarue venivqesareu
venivqeseaur venivqesearu venivqeseuar venivqeseura venivqeserua venivqeserau venivqesuear venivqesuera venivqesuaer
venivqesuare venivqesurae venivqesurea venivqesreua venivqesreau venivqesruea venivqesruae venivqesraue venivqesraeu
venivqeesaur venivqeesaru venivqeesuar venivqeesura venivqeesrua venivqeesrau venivqeeasur venivqeeasru venivqeeausr
venivqeeaurs venivqeearus venivqeearsu venivqeeuasr venivqeeuars venivqeeusar venivqeeusra venivqeeursa venivqeeuras
venivqeeraus venivqeerasu venivqeeruas venivqeerusa venivqeersua venivqeersau venivqeusear venivqeusera venivqeusaer
venivqeusare venivqeusrae venivqeusrea venivqeuesar venivqeuesra venivqeueasr venivqeuears venivqeueras venivqeuersa
venivqeuaesr venivqeuaers venivqeuaser venivqeuasre venivqeuarse venivqeuares venivqeureas venivqeuresa venivqeuraes
venivqeurase venivqeursae venivqeursea venivqerseua venivqerseau venivqersuea venivqersuae venivqersaue venivqersaeu
venivqeresua venivqeresau venivqereusa venivqereuas venivqereaus venivqereasu venivqeruesa venivqerueas venivqerusea
venivqerusae venivqeruase venivqeruaes venivqeraeus venivqeraesu venivqeraues venivqerause venivqerasue venivqeraseu
venivurasqee venivurasqee venivuraseqe venivuraseeq venivuraseeq venivuraseqe venivuraqsee venivuraqsee venivuraqese
venivuraqees venivuraqees venivuraqese venivuraeqse venivuraeqes venivuraesqe venivuraeseq venivuraeesq venivuraeeqs
venivuraeqes venivuraeqse venivuraeeqs venivuraeesq venivuraeseq venivuraesqe venivursaqee venivursaqee venivursaeqe
venivursaeeq venivursaeeq venivursaeqe venivursqaee venivursqaee venivursqeae venivursqeea venivursqeea venivursqeae
venivurseqae venivurseqea venivurseaqe venivurseaeq venivurseeaq venivurseeqa venivurseqea venivurseqae venivurseeqa
venivurseeaq venivurseaeq venivurseaqe venivurqsaee venivurqsaee venivurqseae venivurqseea venivurqseea venivurqseae
venivurqasee venivurqasee venivurqaese venivurqaees venivurqaees venivurqaese venivurqease venivurqeaes venivurqesae
venivurqesea venivurqeesa venivurqeeas venivurqeaes venivurqease venivurqeeas venivurqeesa venivurqesea venivurqesae
venivuresqae venivuresqea venivuresaqe venivuresaeq venivureseaq venivureseqa venivureqsae venivureqsea venivureqase
venivureqaes venivureqeas venivureqesa venivureaqse venivureaqes venivureasqe venivureaseq venivureaesq venivureaeqs
venivureeqas venivureeqsa venivureeaqs venivureeasq venivureesaq venivureesqa venivuresqea venivuresqae venivureseqa
venivureseaq venivuresaeq venivuresaqe venivureqsea venivureqsae venivureqesa venivureqeas venivureqaes venivureqase
venivureeqsa venivureeqas venivureesqa venivureesaq venivureeasq venivureeaqs venivureaqes venivureaqse venivureaeqs
venivureaesq venivureaseq venivureasqe venivuarsqee venivuarsqee venivuarseqe venivuarseeq venivuarseeq venivuarseqe
venivuarqsee venivuarqsee venivuarqese venivuarqees venivuarqees venivuarqese venivuareqse venivuareqes venivuaresqe
venivuareseq venivuareesq venivuareeqs venivuareqes venivuareqse venivuareeqs venivuareesq venivuareseq venivuaresqe
venivuasrqee venivuasrqee venivuasreqe venivuasreeq venivuasreeq venivuasreqe venivuasqree venivuasqree venivuasqere
venivuasqeer venivuasqeer venivuasqere venivuaseqre venivuaseqer venivuaserqe venivuasereq venivuaseerq venivuaseeqr
venivuaseqer venivuaseqre venivuaseeqr venivuaseerq venivuasereq venivuaserqe venivuaqsree venivuaqsree venivuaqsere
venivuaqseer venivuaqseer venivuaqsere venivuaqrsee venivuaqrsee venivuaqrese venivuaqrees venivuaqrees venivuaqrese
venivuaqerse venivuaqeres venivuaqesre venivuaqeser venivuaqeesr venivuaqeers venivuaqeres venivuaqerse venivuaqeers
venivuaqeesr venivuaqeser venivuaqesre venivuaesqre venivuaesqer venivuaesrqe venivuaesreq venivuaeserq venivuaeseqr
venivuaeqsre venivuaeqser venivuaeqrse venivuaeqres venivuaeqers venivuaeqesr venivuaerqse venivuaerqes venivuaersqe
venivuaerseq venivuaeresq venivuaereqs venivuaeeqrs venivuaeeqsr venivuaeerqs venivuaeersq venivuaeesrq venivuaeesqr
venivuaesqer venivuaesqre venivuaeseqr venivuaeserq venivuaesreq venivuaesrqe venivuaeqser venivuaeqsre venivuaeqesr
venivuaeqers venivuaeqres venivuaeqrse venivuaeeqsr venivuaeeqrs venivuaeesqr venivuaeesrq venivuaeersq venivuaeerqs
venivuaerqes venivuaerqse venivuaereqs venivuaeresq venivuaerseq venivuaersqe venivusarqee venivusarqee venivusareqe
venivusareeq venivusareeq venivusareqe venivusaqree venivusaqree venivusaqere venivusaqeer venivusaqeer venivusaqere
venivusaeqre venivusaeqer venivusaerqe venivusaereq venivusaeerq venivusaeeqr venivusaeqer venivusaeqre venivusaeeqr
venivusaeerq venivusaereq venivusaerqe venivusraqee venivusraqee venivusraeqe venivusraeeq venivusraeeq venivusraeqe
venivusrqaee venivusrqaee venivusrqeae venivusrqeea venivusrqeea venivusrqeae venivusreqae venivusreqea venivusreaqe
venivusreaeq venivusreeaq venivusreeqa venivusreqea venivusreqae venivusreeqa venivusreeaq venivusreaeq venivusreaqe
venivusqraee venivusqraee venivusqreae venivusqreea venivusqreea venivusqreae venivusqaree venivusqaree venivusqaere
venivusqaeer venivusqaeer venivusqaere venivusqeare venivusqeaer venivusqerae venivusqerea venivusqeera venivusqeear
venivusqeaer venivusqeare venivusqeear venivusqeera venivusqerea venivusqerae venivuserqae venivuserqea venivuseraqe
venivuseraeq venivusereaq venivusereqa venivuseqrae venivuseqrea venivuseqare venivuseqaer venivuseqear venivuseqera
venivuseaqre venivuseaqer venivusearqe venivuseareq venivuseaerq venivuseaeqr venivuseeqar venivuseeqra venivuseeaqr
venivuseearq venivuseeraq venivuseerqa venivuserqea venivuserqae venivusereqa venivusereaq venivuseraeq venivuseraqe
venivuseqrea venivuseqrae venivuseqera venivuseqear venivuseqaer venivuseqare venivuseeqra venivuseeqar venivuseerqa
venivuseeraq venivuseearq venivuseeaqr venivuseaqer venivuseaqre venivuseaeqr venivuseaerq venivuseareq venivusearqe
venivuqasree venivuqasree venivuqasere venivuqaseer venivuqaseer venivuqasere venivuqarsee venivuqarsee venivuqarese
venivuqarees venivuqarees venivuqarese venivuqaerse venivuqaeres venivuqaesre venivuqaeser venivuqaeesr venivuqaeers
venivuqaeres venivuqaerse venivuqaeers venivuqaeesr venivuqaeser venivuqaesre venivuqsaree venivuqsaree venivuqsaere
venivuqsaeer venivuqsaeer venivuqsaere venivuqsraee venivuqsraee venivuqsreae venivuqsreea venivuqsreea venivuqsreae
venivuqserae venivuqserea venivuqseare venivuqseaer venivuqseear venivuqseera venivuqserea venivuqserae venivuqseera
venivuqseear venivuqseaer venivuqseare venivuqrsaee venivuqrsaee venivuqrseae venivuqrseea venivuqrseea venivuqrseae
venivuqrasee venivuqrasee venivuqraese venivuqraees venivuqraees venivuqraese venivuqrease venivuqreaes venivuqresae
venivuqresea venivuqreesa venivuqreeas venivuqreaes venivuqrease venivuqreeas venivuqreesa venivuqresea venivuqresae
venivuqesrae venivuqesrea venivuqesare venivuqesaer venivuqesear venivuqesera venivuqersae venivuqersea venivuqerase
venivuqeraes venivuqereas venivuqeresa venivuqearse venivuqeares venivuqeasre venivuqeaser venivuqeaesr venivuqeaers
venivuqeeras venivuqeersa venivuqeears venivuqeeasr venivuqeesar venivuqeesra venivuqesrea venivuqesrae venivuqesera
venivuqesear venivuqesaer venivuqesare venivuqersea venivuqersae venivuqeresa venivuqereas venivuqeraes venivuqerase
venivuqeersa venivuqeeras venivuqeesra venivuqeesar venivuqeeasr venivuqeears venivuqeares venivuqearse venivuqeaers
venivuqeaesr venivuqeaser venivuqeasre venivueasqre venivueasqer venivueasrqe venivueasreq venivueaserq venivueaseqr
venivueaqsre venivueaqser venivueaqrse venivueaqres venivueaqers venivueaqesr venivuearqse venivuearqes venivuearsqe
venivuearseq venivuearesq venivueareqs venivueaeqrs venivueaeqsr venivueaerqs venivueaersq venivueaesrq venivueaesqr
venivuesaqre venivuesaqer venivuesarqe venivuesareq venivuesaerq venivuesaeqr venivuesqare venivuesqaer venivuesqrae
venivuesqrea venivuesqera venivuesqear venivuesrqae venivuesrqea venivuesraqe venivuesraeq venivuesreaq venivuesreqa
venivueseqra venivueseqar venivueserqa venivueseraq venivuesearq venivueseaqr venivueqsare venivueqsaer venivueqsrae
venivueqsrea venivueqsera venivueqsear venivueqasre venivueqaser venivueqarse venivueqares venivueqaers venivueqaesr
venivueqrase venivueqraes venivueqrsae venivueqrsea venivueqresa venivueqreas venivueqears venivueqeasr venivueqeras
venivueqersa venivueqesra venivueqesar venivuersqae venivuersqea venivuersaqe venivuersaeq venivuerseaq venivuerseqa
venivuerqsae venivuerqsea venivuerqase venivuerqaes venivuerqeas venivuerqesa venivueraqse venivueraqes venivuerasqe
venivueraseq venivueraesq venivueraeqs venivuereqas venivuereqsa venivuereaqs venivuereasq venivueresaq venivueresqa
venivueesqra venivueesqar venivueesrqa venivueesraq venivueesarq venivueesaqr venivueeqsra venivueeqsar venivueeqrsa
venivueeqras venivueeqars venivueeqasr venivueerqsa venivueerqas venivueersqa venivueersaq venivueerasq venivueeraqs
venivueeaqrs venivueeaqsr venivueearqs venivueearsq venivueeasrq venivueeasqr venivueasqer venivueasqre venivueaseqr
venivueaserq venivueasreq venivueasrqe venivueaqser venivueaqsre venivueaqesr venivueaqers venivueaqres venivueaqrse
venivueaeqsr venivueaeqrs venivueaesqr venivueaesrq venivueaersq venivueaerqs venivuearqes venivuearqse venivueareqs
venivuearesq venivuearseq venivuearsqe venivuesaqer venivuesaqre venivuesaeqr venivuesaerq venivuesareq venivuesarqe
venivuesqaer venivuesqare venivuesqear venivuesqera venivuesqrea venivuesqrae venivueseqar venivueseqra venivueseaqr
venivuesearq venivueseraq venivueserqa venivuesrqea venivuesrqae venivuesreqa venivuesreaq venivuesraeq venivuesraqe
venivueqsaer venivueqsare venivueqsear venivueqsera venivueqsrea venivueqsrae venivueqaser venivueqasre venivueqaesr
venivueqaers venivueqares venivueqarse venivueqeasr venivueqears venivueqesar venivueqesra venivueqersa venivueqeras
venivueqraes venivueqrase venivueqreas venivueqresa venivueqrsea venivueqrsae venivueesqar venivueesqra venivueesaqr
venivueesarq venivueesraq venivueesrqa venivueeqsar venivueeqsra venivueeqasr venivueeqars venivueeqras venivueeqrsa
venivueeaqsr venivueeaqrs venivueeasqr venivueeasrq venivueearsq venivueearqs venivueerqas venivueerqsa venivueeraqs
venivueerasq venivueersaq venivueersqa venivuersqea venivuersqae venivuerseqa venivuerseaq venivuersaeq venivuersaqe
venivuerqsea venivuerqsae venivuerqesa venivuerqeas venivuerqaes venivuerqase venivuereqsa venivuereqas venivueresqa
venivueresaq venivuereasq venivuereaqs venivueraqes venivueraqse venivueraeqs venivueraesq venivueraseq venivuerasqe
veniverasque veniverasqeu veniverasuqe veniverasueq veniveraseuq veniverasequ veniveraqsue veniveraqseu veniveraquse
veniveraques veniveraqeus veniveraqesu veniverauqse veniverauqes veniverausqe veniverauseq veniverauesq veniveraueqs
veniveraequs veniveraeqsu veniveraeuqs veniveraeusq veniveraesuq veniveraesqu veniversaque veniversaqeu veniversauqe
veniversaueq veniversaeuq veniversaequ veniversqaue veniversqaeu veniversquae veniversquea veniversqeua veniversqeau
veniversuqae veniversuqea veniversuaqe veniversuaeq veniversueaq veniversueqa veniversequa veniverseqau veniverseuqa
veniverseuaq veniverseauq veniverseaqu veniverqsaue veniverqsaeu veniverqsuae veniverqsuea veniverqseua veniverqseau
veniverqasue veniverqaseu veniverqause veniverqaues veniverqaeus veniverqaesu veniverquase veniverquaes veniverqusae
veniverqusea veniverquesa veniverqueas veniverqeaus veniverqeasu veniverqeuas veniverqeusa veniverqesua veniverqesau
veniverusqae veniverusqea veniverusaqe veniverusaeq veniveruseaq veniveruseqa veniveruqsae veniveruqsea veniveruqase
veniveruqaes veniveruqeas veniveruqesa veniveruaqse veniveruaqes veniveruasqe veniveruaseq veniveruaesq veniveruaeqs
veniverueqas veniverueqsa veniverueaqs veniverueasq veniveruesaq veniveruesqa veniveresqua veniveresqau veniveresuqa
veniveresuaq veniveresauq veniveresaqu venivereqsua venivereqsau veniverequsa veniverequas venivereqaus venivereqasu
venivereuqsa venivereuqas venivereusqa venivereusaq venivereuasq venivereuaqs venivereaqus venivereaqsu venivereauqs
venivereausq venivereasuq venivereasqu venivearsque venivearsqeu venivearsuqe venivearsueq venivearseuq venivearsequ
venivearqsue venivearqseu venivearquse venivearques venivearqeus venivearqesu venivearuqse venivearuqes venivearusqe
venivearuseq venivearuesq venivearueqs venivearequs veniveareqsu veniveareuqs veniveareusq venivearesuq venivearesqu
veniveasrque veniveasrqeu veniveasruqe veniveasrueq veniveasreuq veniveasrequ veniveasqrue veniveasqreu veniveasqure
veniveasquer veniveasqeur veniveasqeru veniveasuqre veniveasuqer veniveasurqe veniveasureq veniveasuerq veniveasueqr
veniveasequr veniveaseqru veniveaseuqr veniveaseurq veniveaseruq veniveaserqu veniveaqsrue veniveaqsreu veniveaqsure
veniveaqsuer veniveaqseur veniveaqseru veniveaqrsue veniveaqrseu veniveaqruse veniveaqrues veniveaqreus veniveaqresu
veniveaqurse veniveaqures veniveaqusre veniveaquser veniveaquesr veniveaquers veniveaqerus veniveaqersu veniveaqeurs
veniveaqeusr veniveaqesur veniveaqesru veniveausqre veniveausqer veniveausrqe veniveausreq veniveauserq veniveauseqr
veniveauqsre veniveauqser veniveauqrse veniveauqres veniveauqers veniveauqesr veniveaurqse veniveaurqes veniveaursqe
veniveaurseq veniveauresq veniveaureqs veniveaueqrs veniveaueqsr veniveauerqs veniveauersq veniveauesrq veniveauesqr
veniveaesqur veniveaesqru veniveaesuqr veniveaesurq veniveaesruq veniveaesrqu veniveaeqsur veniveaeqsru veniveaequsr
veniveaequrs veniveaeqrus veniveaeqrsu veniveaeuqsr veniveaeuqrs veniveaeusqr veniveaeusrq veniveaeursq veniveaeurqs
veniveaerqus veniveaerqsu veniveaeruqs veniveaerusq veniveaersuq veniveaersqu venivesarque venivesarqeu venivesaruqe
venivesarueq venivesareuq venivesarequ venivesaqrue venivesaqreu venivesaqure venivesaquer venivesaqeur venivesaqeru
venivesauqre venivesauqer venivesaurqe venivesaureq venivesauerq venivesaueqr venivesaequr venivesaeqru venivesaeuqr
venivesaeurq venivesaeruq venivesaerqu venivesraque venivesraqeu venivesrauqe venivesraueq venivesraeuq venivesraequ
venivesrqaue venivesrqaeu venivesrquae venivesrquea venivesrqeua venivesrqeau venivesruqae venivesruqea venivesruaqe
venivesruaeq venivesrueaq venivesrueqa venivesrequa venivesreqau venivesreuqa venivesreuaq venivesreauq venivesreaqu
venivesqraue venivesqraeu venivesqruae venivesqruea venivesqreua venivesqreau venivesqarue venivesqareu venivesqaure
venivesqauer venivesqaeur venivesqaeru venivesquare venivesquaer venivesqurae venivesqurea venivesquera venivesquear
venivesqeaur venivesqearu venivesqeuar venivesqeura venivesqerua venivesqerau venivesurqae venivesurqea venivesuraqe
venivesuraeq venivesureaq venivesureqa venivesuqrae venivesuqrea venivesuqare venivesuqaer venivesuqear venivesuqera
venivesuaqre venivesuaqer venivesuarqe venivesuareq venivesuaerq venivesuaeqr venivesueqar venivesueqra venivesueaqr
venivesuearq venivesueraq venivesuerqa veniveserqua veniveserqau veniveseruqa veniveseruaq veniveserauq veniveseraqu
veniveseqrua veniveseqrau venivesequra venivesequar veniveseqaur veniveseqaru veniveseuqra veniveseuqar veniveseurqa
veniveseuraq veniveseuarq veniveseuaqr veniveseaqur veniveseaqru veniveseauqr veniveseaurq venivesearuq venivesearqu
veniveqasrue veniveqasreu veniveqasure veniveqasuer veniveqaseur veniveqaseru veniveqarsue veniveqarseu veniveqaruse
veniveqarues veniveqareus veniveqaresu veniveqaurse veniveqaures veniveqausre veniveqauser veniveqauesr veniveqauers
veniveqaerus veniveqaersu veniveqaeurs veniveqaeusr veniveqaesur veniveqaesru veniveqsarue veniveqsareu veniveqsaure
veniveqsauer veniveqsaeur veniveqsaeru veniveqsraue veniveqsraeu veniveqsruae veniveqsruea veniveqsreua veniveqsreau
veniveqsurae veniveqsurea veniveqsuare veniveqsuaer veniveqsuear veniveqsuera veniveqserua veniveqserau veniveqseura
veniveqseuar veniveqseaur veniveqsearu veniveqrsaue veniveqrsaeu veniveqrsuae veniveqrsuea veniveqrseua veniveqrseau
veniveqrasue veniveqraseu veniveqrause veniveqraues veniveqraeus veniveqraesu veniveqruase veniveqruaes veniveqrusae
veniveqrusea veniveqruesa veniveqrueas veniveqreaus veniveqreasu veniveqreuas veniveqreusa veniveqresua veniveqresau
venivequsrae venivequsrea venivequsare venivequsaer venivequsear venivequsera veniveqursae veniveqursea venivequrase
venivequraes venivequreas venivequresa venivequarse venivequares venivequasre venivequaser venivequaesr venivequaers
venivequeras venivequersa venivequears venivequeasr venivequesar venivequesra veniveqesrua veniveqesrau veniveqesura
veniveqesuar veniveqesaur veniveqesaru veniveqersua veniveqersau veniveqerusa veniveqeruas veniveqeraus veniveqerasu
veniveqeursa veniveqeuras veniveqeusra veniveqeusar veniveqeuasr veniveqeuars veniveqearus veniveqearsu veniveqeaurs
veniveqeausr veniveqeasur veniveqeasru veniveuasqre veniveuasqer veniveuasrqe veniveuasreq veniveuaserq veniveuaseqr
veniveuaqsre veniveuaqser veniveuaqrse veniveuaqres veniveuaqers veniveuaqesr veniveuarqse veniveuarqes veniveuarsqe
veniveuarseq veniveuaresq veniveuareqs veniveuaeqrs veniveuaeqsr veniveuaerqs veniveuaersq veniveuaesrq veniveuaesqr
veniveusaqre veniveusaqer veniveusarqe veniveusareq veniveusaerq veniveusaeqr veniveusqare veniveusqaer veniveusqrae
veniveusqrea veniveusqera veniveusqear veniveusrqae veniveusrqea veniveusraqe veniveusraeq veniveusreaq veniveusreqa
veniveuseqra veniveuseqar veniveuserqa veniveuseraq veniveusearq veniveuseaqr veniveuqsare veniveuqsaer veniveuqsrae
veniveuqsrea veniveuqsera veniveuqsear veniveuqasre veniveuqaser veniveuqarse veniveuqares veniveuqaers veniveuqaesr
veniveuqrase veniveuqraes veniveuqrsae veniveuqrsea veniveuqresa veniveuqreas veniveuqears veniveuqeasr veniveuqeras
veniveuqersa veniveuqesra veniveuqesar veniveursqae veniveursqea veniveursaqe veniveursaeq veniveurseaq veniveurseqa
veniveurqsae veniveurqsea veniveurqase veniveurqaes veniveurqeas veniveurqesa veniveuraqse veniveuraqes veniveurasqe
veniveuraseq veniveuraesq veniveuraeqs veniveureqas veniveureqsa veniveureaqs veniveureasq veniveuresaq veniveuresqa
veniveuesqra veniveuesqar veniveuesrqa veniveuesraq veniveuesarq veniveuesaqr veniveueqsra veniveueqsar veniveueqrsa
veniveueqras veniveueqars veniveueqasr veniveuerqsa veniveuerqas veniveuersqa veniveuersaq veniveuerasq veniveueraqs
veniveueaqrs veniveueaqsr veniveuearqs veniveuearsq veniveueasrq veniveueasqr veniveeasqur veniveeasqru veniveeasuqr
veniveeasurq veniveeasruq veniveeasrqu veniveeaqsur veniveeaqsru veniveeaqusr veniveeaqurs veniveeaqrus veniveeaqrsu
veniveeauqsr veniveeauqrs veniveeausqr veniveeausrq veniveeaursq veniveeaurqs veniveearqus veniveearqsu veniveearuqs
veniveearusq veniveearsuq veniveearsqu veniveesaqur veniveesaqru veniveesauqr veniveesaurq veniveesaruq veniveesarqu
veniveesqaur veniveesqaru veniveesquar veniveesqura veniveesqrua veniveesqrau veniveesuqar veniveesuqra veniveesuaqr
veniveesuarq veniveesuraq veniveesurqa veniveesrqua veniveesrqau veniveesruqa veniveesruaq veniveesrauq veniveesraqu
veniveeqsaur veniveeqsaru veniveeqsuar veniveeqsura veniveeqsrua veniveeqsrau veniveeqasur veniveeqasru veniveeqausr
veniveeqaurs veniveeqarus veniveeqarsu veniveequasr veniveequars veniveequsar veniveequsra veniveeqursa veniveequras
veniveeqraus veniveeqrasu veniveeqruas veniveeqrusa veniveeqrsua veniveeqrsau veniveeusqar veniveeusqra veniveeusaqr
veniveeusarq veniveeusraq veniveeusrqa veniveeuqsar veniveeuqsra veniveeuqasr veniveeuqars veniveeuqras veniveeuqrsa
veniveeuaqsr veniveeuaqrs veniveeuasqr veniveeuasrq veniveeuarsq veniveeuarqs veniveeurqas veniveeurqsa veniveeuraqs
veniveeurasq veniveeursaq veniveeursqa veniveersqua veniveersqau veniveersuqa veniveersuaq veniveersauq veniveersaqu
veniveerqsua veniveerqsau veniveerqusa veniveerquas veniveerqaus veniveerqasu veniveeruqsa veniveeruqas veniveerusqa
veniveerusaq veniveeruasq veniveeruaqs veniveeraqus veniveeraqsu veniveerauqs veniveerausq veniveerasuq veniveerasqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us