easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

dissipatedness

despiceretque

imprudently

audiamque

bronchiolitis

isochores

dissimulantque

ethynyl

lehigh

memorized

caconychia

sanaa

heveydd

praeconor

christiansted

macroglobulinemia

interpolater

colpohyperplasia


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: uocasque
cipher variations:
vpdbtrvf wqecuswg xrfdvtxh ysgewuyi zthfxvzj
auigywak bvjhzxbl cwkiaycm dxljbzdn eymkcaeo
fznldbfp gaomecgq hbpnfdhr icqogeis jdrphfjt
kesqigku lftrjhlv mguskimw nhvtljnx oiwumkoy
pjxvnlpz qkywomqa rlzxpnrb smayqosc tnbzrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: uocasque
Cipher: flxzhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: uocasque
Cipher: BAABB ABBAB AAABA AAAAA BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: uocasque
cipher variations:
vpdbtrvfjrhbdxjnxtlbndxvlvpbxjldzxtbhpzlnzxbrvntpdfblhpjdfjbvndr
rhnbftrzfjrbpzfhtlvbzftphnzbjlhxwqecuswgksiceykoyumcoeywmwqcykme
ayuciqamoaycswouqegcmiqkegkcwoessiocgusagkscqagiumwcaguqioackmiy
xrfdvtxhltjdfzlpzvndpfzxnxrdzlnfbzvdjrbnpbzdtxpvrfhdnjrlfhldxpft
tjpdhvtbhltdrbhjvnxdbhvrjpbdlnjzysgewuyimukegamqawoeqgayoyseamog
cawekscoqcaeuyqwsgieoksmgimeyqguukqeiwucimuescikwoyeciwskqcemoka
zthfxvzjnvlfhbnrbxpfrhbzpztfbnphdbxfltdprdbfvzrxthjfpltnhjnfzrhv
vlrfjxvdjnvftdjlxpzfdjxtlrdfnplbauigywakowmgicoscyqgsicaqaugcoqi
ecygmueqsecgwasyuikgqmuoikogasiwwmsgkywekowguekmyqagekyumsegoqmc
bvjhzxblpxnhjdptdzrhtjdbrbvhdprjfdzhnvfrtfdhxbtzvjlhrnvpjlphbtjx
xnthlzxflpxhvflnzrbhflzvntfhprndcwkiaycmqyoikequeasiukecscwieqsk
geaiowgsugeiycuawkmisowqkmqicukyyouimaygmqyiwgmoascigmawougiqsoe
dxljbzdnrzpjlfrvfbtjvlfdtdxjfrtlhfbjpxhtvhfjzdvbxlnjtpxrlnrjdvlz
zpvjnbzhnrzjxhnpbtdjhnbxpvhjrtpfeymkcaeosaqkmgswgcukwmgeueykgsum
igckqyiuwigkaewcymokuqysmoskewmaaqwkocaiosakyioqcuekiocyqwiksuqg
fznldbfptbrlnhtxhdvlxnhfvfzlhtvnjhdlrzjvxjhlbfxdznplvrztnptlfxnb
brxlpdbjptblzjprdvfljpdzrxjltvrhgaomecgqucsmoiuyiewmyoigwgamiuwo
kiemsakwykimcgyeaoqmwsauoqumgyoccsymqeckqucmakqsewgmkqeasykmuwsi
hbpnfdhrvdtnpjvzjfxnzpjhxhbnjvxpljfntblxzljndhzfbprnxtbvprvnhzpd
dtznrfdlrvdnblrtfxhnlrfbtzlnvxtjicqogeisweuoqkwakgyoaqkiyicokwyq
mkgoucmyamkoeiagcqsoyucwqswoiaqeeuaosgemsweocmsugyiomsgcuamowyuk
jdrphfjtxfvprlxblhzpbrljzjdplxzrnlhpvdnzbnlpfjbhdrtpzvdxrtxpjbrf
fvbpthfntxfpdntvhzjpnthdvbnpxzvlkesqigkuygwqsmycmiaqcsmkakeqmyas
omiqweoacomqgkciesuqaweysuyqkcsggwcquigouygqeouwiakqouiewcoqyawm
lftrjhlvzhxrtnzdnjbrdtnlblfrnzbtpnjrxfpbdpnrhldjftvrbxfztvzrldth
hxdrvjhpvzhrfpvxjblrpvjfxdprzbxnmguskimwaiysuoaeokcseuomcmgsoacu
qoksygqceqosimekguwscygauwasmeuiiyeswkiqwaisgqwykcmsqwkgyeqsacyo
nhvtljnxbjztvpbfpldtfvpndnhtpbdvrpltzhrdfrptjnflhvxtdzhbvxbtnfvj
jzftxljrxbjthrxzldntrxlhzfrtbdzpoiwumkoyckauwqcgqmeugwqoeoiuqcew
sqmuaisegsqukogmiwyueaicwycuogwkkaguymksyckuisyameousymiagsuceaq
pjxvnlpzdlbvxrdhrnfvhxrpfpjvrdfxtrnvbjtfhtrvlphnjxzvfbjdxzdvphxl
lbhvznltzdlvjtzbnfpvtznjbhtvdfbrqkywomqaemcwyseisogwiysqgqkwsegy
usowckugiuswmqiokyawgckeyaewqiymmciwaomuaemwkuacogqwuaokciuwegcs
rlzxpnrbfndxztfjtphxjztrhrlxtfhzvtpxdlvhjvtxnrjplzbxhdlfzbfxrjzn
ndjxbpnvbfnxlvbdphrxvbpldjvxfhdtsmayqoscgoeyaugkuqiykausismyugia
wuqyemwikwuyoskqmacyiemgacgyskaooekycqowcgoymwceqisywcqmekwygieu
tnbzrptdhpfzbvhlvrjzlbvtjtnzvhjbxvrzfnxjlxvzptlrnbdzjfnhbdhztlbp
pflzdrpxdhpznxdfrjtzxdrnflxzhjfvuocasqueiqgacwimwskamcwukuoawikc
ywsagoykmywaqumsoceakgoiceiaumcqqgmaesqyeiqaoyegskuayesogmyaikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: uocasque
Cipher: hbpnfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: uocasque
Cipher: 5443311134145451

Extended Methods:
Method #1

Plaintext: uocasque
method variations:
zthfxvzkeynlcaepkdsqhfkupixvnlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
u o c a s q u e 
5 4 3 1 3 1 5 5 
4 3 1 1 4 4 4 1 
They are then read out in rows:
5431315543114441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: uocasque
Cipher: ucczoatd

Read more ...
Method #3

Plaintext: uocasque
method variations:
tnaldyyv naldyyvt aldyyvtn
ldyyvtna dyyvtnal yyvtnald
yvtnaldy vtnaldyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: uocasque

first 5040 cipher variations(40320 total)
uocasque uocasqeu uocasuqe uocasueq uocaseuq uocasequ uocaqsue uocaqseu uocaquse uocaques uocaqeus
uocaqesu uocauqse uocauqes uocausqe uocauseq uocauesq uocaueqs uocaequs uocaeqsu uocaeuqs uocaeusq
uocaesuq uocaesqu uocsaque uocsaqeu uocsauqe uocsaueq uocsaeuq uocsaequ uocsqaue uocsqaeu uocsquae
uocsquea uocsqeua uocsqeau uocsuqae uocsuqea uocsuaqe uocsuaeq uocsueaq uocsueqa uocsequa uocseqau
uocseuqa uocseuaq uocseauq uocseaqu uocqsaue uocqsaeu uocqsuae uocqsuea uocqseua uocqseau uocqasue
uocqaseu uocqause uocqaues uocqaeus uocqaesu uocquase uocquaes uocqusae uocqusea uocquesa uocqueas
uocqeaus uocqeasu uocqeuas uocqeusa uocqesua uocqesau uocusqae uocusqea uocusaqe uocusaeq uocuseaq
uocuseqa uocuqsae uocuqsea uocuqase uocuqaes uocuqeas uocuqesa uocuaqse uocuaqes uocuasqe uocuaseq
uocuaesq uocuaeqs uocueqas uocueqsa uocueaqs uocueasq uocuesaq uocuesqa uocesqua uocesqau uocesuqa
uocesuaq uocesauq uocesaqu uoceqsua uoceqsau uocequsa uocequas uoceqaus uoceqasu uoceuqsa uoceuqas
uoceusqa uoceusaq uoceuasq uoceuaqs uoceaqus uoceaqsu uoceauqs uoceausq uoceasuq uoceasqu uoacsque
uoacsqeu uoacsuqe uoacsueq uoacseuq uoacsequ uoacqsue uoacqseu uoacquse uoacques uoacqeus uoacqesu
uoacuqse uoacuqes uoacusqe uoacuseq uoacuesq uoacueqs uoacequs uoaceqsu uoaceuqs uoaceusq uoacesuq
uoacesqu uoascque uoascqeu uoascuqe uoascueq uoasceuq uoascequ uoasqcue uoasqceu uoasquce uoasquec
uoasqeuc uoasqecu uoasuqce uoasuqec uoasucqe uoasuceq uoasuecq uoasueqc uoasequc uoaseqcu uoaseuqc
uoaseucq uoasecuq uoasecqu uoaqscue uoaqsceu uoaqsuce uoaqsuec uoaqseuc uoaqsecu uoaqcsue uoaqcseu
uoaqcuse uoaqcues uoaqceus uoaqcesu uoaqucse uoaquces uoaqusce uoaqusec uoaquesc uoaquecs uoaqecus
uoaqecsu uoaqeucs uoaqeusc uoaqesuc uoaqescu uoausqce uoausqec uoauscqe uoausceq uoausecq uoauseqc
uoauqsce uoauqsec uoauqcse uoauqces uoauqecs uoauqesc uoaucqse uoaucqes uoaucsqe uoaucseq uoaucesq
uoauceqs uoaueqcs uoaueqsc uoauecqs uoauecsq uoauescq uoauesqc uoaesquc uoaesqcu uoaesuqc uoaesucq
uoaescuq uoaescqu uoaeqsuc uoaeqscu uoaequsc uoaequcs uoaeqcus uoaeqcsu uoaeuqsc uoaeuqcs uoaeusqc
uoaeuscq uoaeucsq uoaeucqs uoaecqus uoaecqsu uoaecuqs uoaecusq uoaecsuq uoaecsqu uosacque uosacqeu
uosacuqe uosacueq uosaceuq uosacequ uosaqcue uosaqceu uosaquce uosaquec uosaqeuc uosaqecu uosauqce
uosauqec uosaucqe uosauceq uosauecq uosaueqc uosaequc uosaeqcu uosaeuqc uosaeucq uosaecuq uosaecqu
uoscaque uoscaqeu uoscauqe uoscaueq uoscaeuq uoscaequ uoscqaue uoscqaeu uoscquae uoscquea uoscqeua
uoscqeau uoscuqae uoscuqea uoscuaqe uoscuaeq uoscueaq uoscueqa uoscequa uosceqau uosceuqa uosceuaq
uosceauq uosceaqu uosqcaue uosqcaeu uosqcuae uosqcuea uosqceua uosqceau uosqacue uosqaceu uosqauce
uosqauec uosqaeuc uosqaecu uosquace uosquaec uosqucae uosqucea uosqueca uosqueac uosqeauc uosqeacu
uosqeuac uosqeuca uosqecua uosqecau uosucqae uosucqea uosucaqe uosucaeq uosuceaq uosuceqa uosuqcae
uosuqcea uosuqace uosuqaec uosuqeac uosuqeca uosuaqce uosuaqec uosuacqe uosuaceq uosuaecq uosuaeqc
uosueqac uosueqca uosueaqc uosueacq uosuecaq uosuecqa uosecqua uosecqau uosecuqa uosecuaq uosecauq
uosecaqu uoseqcua uoseqcau uosequca uosequac uoseqauc uoseqacu uoseuqca uoseuqac uoseucqa uoseucaq
uoseuacq uoseuaqc uoseaquc uoseaqcu uoseauqc uoseaucq uoseacuq uoseacqu uoqascue uoqasceu uoqasuce
uoqasuec uoqaseuc uoqasecu uoqacsue uoqacseu uoqacuse uoqacues uoqaceus uoqacesu uoqaucse uoqauces
uoqausce uoqausec uoqauesc uoqauecs uoqaecus uoqaecsu uoqaeucs uoqaeusc uoqaesuc uoqaescu uoqsacue
uoqsaceu uoqsauce uoqsauec uoqsaeuc uoqsaecu uoqscaue uoqscaeu uoqscuae uoqscuea uoqsceua uoqsceau
uoqsucae uoqsucea uoqsuace uoqsuaec uoqsueac uoqsueca uoqsecua uoqsecau uoqseuca uoqseuac uoqseauc
uoqseacu uoqcsaue uoqcsaeu uoqcsuae uoqcsuea uoqcseua uoqcseau uoqcasue uoqcaseu uoqcause uoqcaues
uoqcaeus uoqcaesu uoqcuase uoqcuaes uoqcusae uoqcusea uoqcuesa uoqcueas uoqceaus uoqceasu uoqceuas
uoqceusa uoqcesua uoqcesau uoquscae uoquscea uoqusace uoqusaec uoquseac uoquseca uoqucsae uoqucsea
uoqucase uoqucaes uoquceas uoqucesa uoquacse uoquaces uoquasce uoquasec uoquaesc uoquaecs uoquecas
uoquecsa uoqueacs uoqueasc uoquesac uoquesca uoqescua uoqescau uoqesuca uoqesuac uoqesauc uoqesacu
uoqecsua uoqecsau uoqecusa uoqecuas uoqecaus uoqecasu uoqeucsa uoqeucas uoqeusca uoqeusac uoqeuasc
uoqeuacs uoqeacus uoqeacsu uoqeaucs uoqeausc uoqeasuc uoqeascu uouasqce uouasqec uouascqe uouasceq
uouasecq uouaseqc uouaqsce uouaqsec uouaqcse uouaqces uouaqecs uouaqesc uouacqse uouacqes uouacsqe
uouacseq uouacesq uouaceqs uouaeqcs uouaeqsc uouaecqs uouaecsq uouaescq uouaesqc uousaqce uousaqec
uousacqe uousaceq uousaecq uousaeqc uousqace uousqaec uousqcae uousqcea uousqeca uousqeac uouscqae
uouscqea uouscaqe uouscaeq uousceaq uousceqa uouseqca uouseqac uousecqa uousecaq uouseacq uouseaqc
uouqsace uouqsaec uouqscae uouqscea uouqseca uouqseac uouqasce uouqasec uouqacse uouqaces uouqaecs
uouqaesc uouqcase uouqcaes uouqcsae uouqcsea uouqcesa uouqceas uouqeacs uouqeasc uouqecas uouqecsa
uouqesca uouqesac uoucsqae uoucsqea uoucsaqe uoucsaeq uoucseaq uoucseqa uoucqsae uoucqsea uoucqase
uoucqaes uoucqeas uoucqesa uoucaqse uoucaqes uoucasqe uoucaseq uoucaesq uoucaeqs uouceqas uouceqsa
uouceaqs uouceasq uoucesaq uoucesqa uouesqca uouesqac uouescqa uouescaq uouesacq uouesaqc uoueqsca
uoueqsac uoueqcsa uoueqcas uoueqacs uoueqasc uouecqsa uouecqas uouecsqa uouecsaq uouecasq uouecaqs
uoueaqcs uoueaqsc uoueacqs uoueacsq uoueascq uoueasqc uoeasquc uoeasqcu uoeasuqc uoeasucq uoeascuq
uoeascqu uoeaqsuc uoeaqscu uoeaqusc uoeaqucs uoeaqcus uoeaqcsu uoeauqsc uoeauqcs uoeausqc uoeauscq
uoeaucsq uoeaucqs uoeacqus uoeacqsu uoeacuqs uoeacusq uoeacsuq uoeacsqu uoesaquc uoesaqcu uoesauqc
uoesaucq uoesacuq uoesacqu uoesqauc uoesqacu uoesquac uoesquca uoesqcua uoesqcau uoesuqac uoesuqca
uoesuaqc uoesuacq uoesucaq uoesucqa uoescqua uoescqau uoescuqa uoescuaq uoescauq uoescaqu uoeqsauc
uoeqsacu uoeqsuac uoeqsuca uoeqscua uoeqscau uoeqasuc uoeqascu uoeqausc uoeqaucs uoeqacus uoeqacsu
uoequasc uoequacs uoequsac uoequsca uoequcsa uoequcas uoeqcaus uoeqcasu uoeqcuas uoeqcusa uoeqcsua
uoeqcsau uoeusqac uoeusqca uoeusaqc uoeusacq uoeuscaq uoeuscqa uoeuqsac uoeuqsca uoeuqasc uoeuqacs
uoeuqcas uoeuqcsa uoeuaqsc uoeuaqcs uoeuasqc uoeuascq uoeuacsq uoeuacqs uoeucqas uoeucqsa uoeucaqs
uoeucasq uoeucsaq uoeucsqa uoecsqua uoecsqau uoecsuqa uoecsuaq uoecsauq uoecsaqu uoecqsua uoecqsau
uoecqusa uoecquas uoecqaus uoecqasu uoecuqsa uoecuqas uoecusqa uoecusaq uoecuasq uoecuaqs uoecaqus
uoecaqsu uoecauqs uoecausq uoecasuq uoecasqu ucoasque ucoasqeu ucoasuqe ucoasueq ucoaseuq ucoasequ
ucoaqsue ucoaqseu ucoaquse ucoaques ucoaqeus ucoaqesu ucoauqse ucoauqes ucoausqe ucoauseq ucoauesq
ucoaueqs ucoaequs ucoaeqsu ucoaeuqs ucoaeusq ucoaesuq ucoaesqu ucosaque ucosaqeu ucosauqe ucosaueq
ucosaeuq ucosaequ ucosqaue ucosqaeu ucosquae ucosquea ucosqeua ucosqeau ucosuqae ucosuqea ucosuaqe
ucosuaeq ucosueaq ucosueqa ucosequa ucoseqau ucoseuqa ucoseuaq ucoseauq ucoseaqu ucoqsaue ucoqsaeu
ucoqsuae ucoqsuea ucoqseua ucoqseau ucoqasue ucoqaseu ucoqause ucoqaues ucoqaeus ucoqaesu ucoquase
ucoquaes ucoqusae ucoqusea ucoquesa ucoqueas ucoqeaus ucoqeasu ucoqeuas ucoqeusa ucoqesua ucoqesau
ucousqae ucousqea ucousaqe ucousaeq ucouseaq ucouseqa ucouqsae ucouqsea ucouqase ucouqaes ucouqeas
ucouqesa ucouaqse ucouaqes ucouasqe ucouaseq ucouaesq ucouaeqs ucoueqas ucoueqsa ucoueaqs ucoueasq
ucouesaq ucouesqa ucoesqua ucoesqau ucoesuqa ucoesuaq ucoesauq ucoesaqu ucoeqsua ucoeqsau ucoequsa
ucoequas ucoeqaus ucoeqasu ucoeuqsa ucoeuqas ucoeusqa ucoeusaq ucoeuasq ucoeuaqs ucoeaqus ucoeaqsu
ucoeauqs ucoeausq ucoeasuq ucoeasqu ucaosque ucaosqeu ucaosuqe ucaosueq ucaoseuq ucaosequ ucaoqsue
ucaoqseu ucaoquse ucaoques ucaoqeus ucaoqesu ucaouqse ucaouqes ucaousqe ucaouseq ucaouesq ucaoueqs
ucaoequs ucaoeqsu ucaoeuqs ucaoeusq ucaoesuq ucaoesqu ucasoque ucasoqeu ucasouqe ucasoueq ucasoeuq
ucasoequ ucasqoue ucasqoeu ucasquoe ucasqueo ucasqeuo ucasqeou ucasuqoe ucasuqeo ucasuoqe ucasuoeq
ucasueoq ucasueqo ucasequo ucaseqou ucaseuqo ucaseuoq ucaseouq ucaseoqu ucaqsoue ucaqsoeu ucaqsuoe
ucaqsueo ucaqseuo ucaqseou ucaqosue ucaqoseu ucaqouse ucaqoues ucaqoeus ucaqoesu ucaquose ucaquoes
ucaqusoe ucaquseo ucaqueso ucaqueos ucaqeous ucaqeosu ucaqeuos ucaqeuso ucaqesuo ucaqesou ucausqoe
ucausqeo ucausoqe ucausoeq ucauseoq ucauseqo ucauqsoe ucauqseo ucauqose ucauqoes ucauqeos ucauqeso
ucauoqse ucauoqes ucauosqe ucauoseq ucauoesq ucauoeqs ucaueqos ucaueqso ucaueoqs ucaueosq ucauesoq
ucauesqo ucaesquo ucaesqou ucaesuqo ucaesuoq ucaesouq ucaesoqu ucaeqsuo ucaeqsou ucaequso ucaequos
ucaeqous ucaeqosu ucaeuqso ucaeuqos ucaeusqo ucaeusoq ucaeuosq ucaeuoqs ucaeoqus ucaeoqsu ucaeouqs
ucaeousq ucaeosuq ucaeosqu ucsaoque ucsaoqeu ucsaouqe ucsaoueq ucsaoeuq ucsaoequ ucsaqoue ucsaqoeu
ucsaquoe ucsaqueo ucsaqeuo ucsaqeou ucsauqoe ucsauqeo ucsauoqe ucsauoeq ucsaueoq ucsaueqo ucsaequo
ucsaeqou ucsaeuqo ucsaeuoq ucsaeouq ucsaeoqu ucsoaque ucsoaqeu ucsoauqe ucsoaueq ucsoaeuq ucsoaequ
ucsoqaue ucsoqaeu ucsoquae ucsoquea ucsoqeua ucsoqeau ucsouqae ucsouqea ucsouaqe ucsouaeq ucsoueaq
ucsoueqa ucsoequa ucsoeqau ucsoeuqa ucsoeuaq ucsoeauq ucsoeaqu ucsqoaue ucsqoaeu ucsqouae ucsqouea
ucsqoeua ucsqoeau ucsqaoue ucsqaoeu ucsqauoe ucsqaueo ucsqaeuo ucsqaeou ucsquaoe ucsquaeo ucsquoae
ucsquoea ucsqueoa ucsqueao ucsqeauo ucsqeaou ucsqeuao ucsqeuoa ucsqeoua ucsqeoau ucsuoqae ucsuoqea
ucsuoaqe ucsuoaeq ucsuoeaq ucsuoeqa ucsuqoae ucsuqoea ucsuqaoe ucsuqaeo ucsuqeao ucsuqeoa ucsuaqoe
ucsuaqeo ucsuaoqe ucsuaoeq ucsuaeoq ucsuaeqo ucsueqao ucsueqoa ucsueaqo ucsueaoq ucsueoaq ucsueoqa
ucseoqua ucseoqau ucseouqa ucseouaq ucseoauq ucseoaqu ucseqoua ucseqoau ucsequoa ucsequao ucseqauo
ucseqaou ucseuqoa ucseuqao ucseuoqa ucseuoaq ucseuaoq ucseuaqo ucseaquo ucseaqou ucseauqo ucseauoq
ucseaouq ucseaoqu ucqasoue ucqasoeu ucqasuoe ucqasueo ucqaseuo ucqaseou ucqaosue ucqaoseu ucqaouse
ucqaoues ucqaoeus ucqaoesu ucqauose ucqauoes ucqausoe ucqauseo ucqaueso ucqaueos ucqaeous ucqaeosu
ucqaeuos ucqaeuso ucqaesuo ucqaesou ucqsaoue ucqsaoeu ucqsauoe ucqsaueo ucqsaeuo ucqsaeou ucqsoaue
ucqsoaeu ucqsouae ucqsouea ucqsoeua ucqsoeau ucqsuoae ucqsuoea ucqsuaoe ucqsuaeo ucqsueao ucqsueoa
ucqseoua ucqseoau ucqseuoa ucqseuao ucqseauo ucqseaou ucqosaue ucqosaeu ucqosuae ucqosuea ucqoseua
ucqoseau ucqoasue ucqoaseu ucqoause ucqoaues ucqoaeus ucqoaesu ucqouase ucqouaes ucqousae ucqousea
ucqouesa ucqoueas ucqoeaus ucqoeasu ucqoeuas ucqoeusa ucqoesua ucqoesau ucqusoae ucqusoea ucqusaoe
ucqusaeo ucquseao ucquseoa ucquosae ucquosea ucquoase ucquoaes ucquoeas ucquoesa ucquaose ucquaoes
ucquasoe ucquaseo ucquaeso ucquaeos ucqueoas ucqueosa ucqueaos ucqueaso ucquesao ucquesoa ucqesoua
ucqesoau ucqesuoa ucqesuao ucqesauo ucqesaou ucqeosua ucqeosau ucqeousa ucqeouas ucqeoaus ucqeoasu
ucqeuosa ucqeuoas ucqeusoa ucqeusao ucqeuaso ucqeuaos ucqeaous ucqeaosu ucqeauos ucqeauso ucqeasuo
ucqeasou ucuasqoe ucuasqeo ucuasoqe ucuasoeq ucuaseoq ucuaseqo ucuaqsoe ucuaqseo ucuaqose ucuaqoes
ucuaqeos ucuaqeso ucuaoqse ucuaoqes ucuaosqe ucuaoseq ucuaoesq ucuaoeqs ucuaeqos ucuaeqso ucuaeoqs
ucuaeosq ucuaesoq ucuaesqo ucusaqoe ucusaqeo ucusaoqe ucusaoeq ucusaeoq ucusaeqo ucusqaoe ucusqaeo
ucusqoae ucusqoea ucusqeoa ucusqeao ucusoqae ucusoqea ucusoaqe ucusoaeq ucusoeaq ucusoeqa ucuseqoa
ucuseqao ucuseoqa ucuseoaq ucuseaoq ucuseaqo ucuqsaoe ucuqsaeo ucuqsoae ucuqsoea ucuqseoa ucuqseao
ucuqasoe ucuqaseo ucuqaose ucuqaoes ucuqaeos ucuqaeso ucuqoase ucuqoaes ucuqosae ucuqosea ucuqoesa
ucuqoeas ucuqeaos ucuqeaso ucuqeoas ucuqeosa ucuqesoa ucuqesao ucuosqae ucuosqea ucuosaqe ucuosaeq
ucuoseaq ucuoseqa ucuoqsae ucuoqsea ucuoqase ucuoqaes ucuoqeas ucuoqesa ucuoaqse ucuoaqes ucuoasqe
ucuoaseq ucuoaesq ucuoaeqs ucuoeqas ucuoeqsa ucuoeaqs ucuoeasq ucuoesaq ucuoesqa ucuesqoa ucuesqao
ucuesoqa ucuesoaq ucuesaoq ucuesaqo ucueqsoa ucueqsao ucueqosa ucueqoas ucueqaos ucueqaso ucueoqsa
ucueoqas ucueosqa ucueosaq ucueoasq ucueoaqs ucueaqos ucueaqso ucueaoqs ucueaosq ucueasoq ucueasqo
uceasquo uceasqou uceasuqo uceasuoq uceasouq uceasoqu uceaqsuo uceaqsou uceaquso uceaquos uceaqous
uceaqosu uceauqso uceauqos uceausqo uceausoq uceauosq uceauoqs uceaoqus uceaoqsu uceaouqs uceaousq
uceaosuq uceaosqu ucesaquo ucesaqou ucesauqo ucesauoq ucesaouq ucesaoqu ucesqauo ucesqaou ucesquao
ucesquoa ucesqoua ucesqoau ucesuqao ucesuqoa ucesuaqo ucesuaoq ucesuoaq ucesuoqa ucesoqua ucesoqau
ucesouqa ucesouaq ucesoauq ucesoaqu uceqsauo uceqsaou uceqsuao uceqsuoa uceqsoua uceqsoau uceqasuo
uceqasou uceqauso uceqauos uceqaous uceqaosu ucequaso ucequaos ucequsao ucequsoa ucequosa ucequoas
uceqoaus uceqoasu uceqouas uceqousa uceqosua uceqosau uceusqao uceusqoa uceusaqo uceusaoq uceusoaq
uceusoqa uceuqsao uceuqsoa uceuqaso uceuqaos uceuqoas uceuqosa uceuaqso uceuaqos uceuasqo uceuasoq
uceuaosq uceuaoqs uceuoqas uceuoqsa uceuoaqs uceuoasq uceuosaq uceuosqa uceosqua uceosqau uceosuqa
uceosuaq uceosauq uceosaqu uceoqsua uceoqsau uceoqusa uceoquas uceoqaus uceoqasu uceouqsa uceouqas
uceousqa uceousaq uceouasq uceouaqs uceoaqus uceoaqsu uceoauqs uceoausq uceoasuq uceoasqu uacosque
uacosqeu uacosuqe uacosueq uacoseuq uacosequ uacoqsue uacoqseu uacoquse uacoques uacoqeus uacoqesu
uacouqse uacouqes uacousqe uacouseq uacouesq uacoueqs uacoequs uacoeqsu uacoeuqs uacoeusq uacoesuq
uacoesqu uacsoque uacsoqeu uacsouqe uacsoueq uacsoeuq uacsoequ uacsqoue uacsqoeu uacsquoe uacsqueo
uacsqeuo uacsqeou uacsuqoe uacsuqeo uacsuoqe uacsuoeq uacsueoq uacsueqo uacsequo uacseqou uacseuqo
uacseuoq uacseouq uacseoqu uacqsoue uacqsoeu uacqsuoe uacqsueo uacqseuo uacqseou uacqosue uacqoseu
uacqouse uacqoues uacqoeus uacqoesu uacquose uacquoes uacqusoe uacquseo uacqueso uacqueos uacqeous
uacqeosu uacqeuos uacqeuso uacqesuo uacqesou uacusqoe uacusqeo uacusoqe uacusoeq uacuseoq uacuseqo
uacuqsoe uacuqseo uacuqose uacuqoes uacuqeos uacuqeso uacuoqse uacuoqes uacuosqe uacuoseq uacuoesq
uacuoeqs uacueqos uacueqso uacueoqs uacueosq uacuesoq uacuesqo uacesquo uacesqou uacesuqo uacesuoq
uacesouq uacesoqu uaceqsuo uaceqsou uacequso uacequos uaceqous uaceqosu uaceuqso uaceuqos uaceusqo
uaceusoq uaceuosq uaceuoqs uaceoqus uaceoqsu uaceouqs uaceousq uaceosuq uaceosqu uaocsque uaocsqeu
uaocsuqe uaocsueq uaocseuq uaocsequ uaocqsue uaocqseu uaocquse uaocques uaocqeus uaocqesu uaocuqse
uaocuqes uaocusqe uaocuseq uaocuesq uaocueqs uaocequs uaoceqsu uaoceuqs uaoceusq uaocesuq uaocesqu
uaoscque uaoscqeu uaoscuqe uaoscueq uaosceuq uaoscequ uaosqcue uaosqceu uaosquce uaosquec uaosqeuc
uaosqecu uaosuqce uaosuqec uaosucqe uaosuceq uaosuecq uaosueqc uaosequc uaoseqcu uaoseuqc uaoseucq
uaosecuq uaosecqu uaoqscue uaoqsceu uaoqsuce uaoqsuec uaoqseuc uaoqsecu uaoqcsue uaoqcseu uaoqcuse
uaoqcues uaoqceus uaoqcesu uaoqucse uaoquces uaoqusce uaoqusec uaoquesc uaoquecs uaoqecus uaoqecsu
uaoqeucs uaoqeusc uaoqesuc uaoqescu uaousqce uaousqec uaouscqe uaousceq uaousecq uaouseqc uaouqsce
uaouqsec uaouqcse uaouqces uaouqecs uaouqesc uaoucqse uaoucqes uaoucsqe uaoucseq uaoucesq uaouceqs
uaoueqcs uaoueqsc uaouecqs uaouecsq uaouescq uaouesqc uaoesquc uaoesqcu uaoesuqc uaoesucq uaoescuq
uaoescqu uaoeqsuc uaoeqscu uaoequsc uaoequcs uaoeqcus uaoeqcsu uaoeuqsc uaoeuqcs uaoeusqc uaoeuscq
uaoeucsq uaoeucqs uaoecqus uaoecqsu uaoecuqs uaoecusq uaoecsuq uaoecsqu uasocque uasocqeu uasocuqe
uasocueq uasoceuq uasocequ uasoqcue uasoqceu uasoquce uasoquec uasoqeuc uasoqecu uasouqce uasouqec
uasoucqe uasouceq uasouecq uasoueqc uasoequc uasoeqcu uasoeuqc uasoeucq uasoecuq uasoecqu uascoque
uascoqeu uascouqe uascoueq uascoeuq uascoequ uascqoue uascqoeu uascquoe uascqueo uascqeuo uascqeou
uascuqoe uascuqeo uascuoqe uascuoeq uascueoq uascueqo uascequo uasceqou uasceuqo uasceuoq uasceouq
uasceoqu uasqcoue uasqcoeu uasqcuoe uasqcueo uasqceuo uasqceou uasqocue uasqoceu uasqouce uasqouec
uasqoeuc uasqoecu uasquoce uasquoec uasqucoe uasquceo uasqueco uasqueoc uasqeouc uasqeocu uasqeuoc
uasqeuco uasqecuo uasqecou uasucqoe uasucqeo uasucoqe uasucoeq uasuceoq uasuceqo uasuqcoe uasuqceo
uasuqoce uasuqoec uasuqeoc uasuqeco uasuoqce uasuoqec uasuocqe uasuoceq uasuoecq uasuoeqc uasueqoc
uasueqco uasueoqc uasueocq uasuecoq uasuecqo uasecquo uasecqou uasecuqo uasecuoq uasecouq uasecoqu
uaseqcuo uaseqcou uasequco uasequoc uaseqouc uaseqocu uaseuqco uaseuqoc uaseucqo uaseucoq uaseuocq
uaseuoqc uaseoquc uaseoqcu uaseouqc uaseoucq uaseocuq uaseocqu uaqoscue uaqosceu uaqosuce uaqosuec
uaqoseuc uaqosecu uaqocsue uaqocseu uaqocuse uaqocues uaqoceus uaqocesu uaqoucse uaqouces uaqousce
uaqousec uaqouesc uaqouecs uaqoecus uaqoecsu uaqoeucs uaqoeusc uaqoesuc uaqoescu uaqsocue uaqsoceu
uaqsouce uaqsouec uaqsoeuc uaqsoecu uaqscoue uaqscoeu uaqscuoe uaqscueo uaqsceuo uaqsceou uaqsucoe
uaqsuceo uaqsuoce uaqsuoec uaqsueoc uaqsueco uaqsecuo uaqsecou uaqseuco uaqseuoc uaqseouc uaqseocu
uaqcsoue uaqcsoeu uaqcsuoe uaqcsueo uaqcseuo uaqcseou uaqcosue uaqcoseu uaqcouse uaqcoues uaqcoeus
uaqcoesu uaqcuose uaqcuoes uaqcusoe uaqcuseo uaqcueso uaqcueos uaqceous uaqceosu uaqceuos uaqceuso
uaqcesuo uaqcesou uaquscoe uaqusceo uaqusoce uaqusoec uaquseoc uaquseco uaqucsoe uaqucseo uaqucose
uaqucoes uaquceos uaquceso uaquocse uaquoces uaquosce uaquosec uaquoesc uaquoecs uaquecos uaquecso
uaqueocs uaqueosc uaquesoc uaquesco uaqescuo uaqescou uaqesuco uaqesuoc uaqesouc uaqesocu uaqecsuo
uaqecsou uaqecuso uaqecuos uaqecous uaqecosu uaqeucso uaqeucos uaqeusco uaqeusoc uaqeuosc uaqeuocs
uaqeocus uaqeocsu uaqeoucs uaqeousc uaqeosuc uaqeoscu uauosqce uauosqec uauoscqe uauosceq uauosecq
uauoseqc uauoqsce uauoqsec uauoqcse uauoqces uauoqecs uauoqesc uauocqse uauocqes uauocsqe uauocseq
uauocesq uauoceqs uauoeqcs uauoeqsc uauoecqs uauoecsq uauoescq uauoesqc uausoqce uausoqec uausocqe
uausoceq uausoecq uausoeqc uausqoce uausqoec uausqcoe uausqceo uausqeco uausqeoc uauscqoe uauscqeo
uauscoqe uauscoeq uausceoq uausceqo uauseqco uauseqoc uausecqo uausecoq uauseocq uauseoqc uauqsoce
uauqsoec uauqscoe uauqsceo uauqseco uauqseoc uauqosce uauqosec uauqocse uauqoces uauqoecs uauqoesc
uauqcose uauqcoes uauqcsoe uauqcseo uauqceso uauqceos uauqeocs uauqeosc uauqecos uauqecso uauqesco
uauqesoc uaucsqoe uaucsqeo uaucsoqe uaucsoeq uaucseoq uaucseqo uaucqsoe uaucqseo uaucqose uaucqoes
uaucqeos uaucqeso uaucoqse uaucoqes uaucosqe uaucoseq uaucoesq uaucoeqs uauceqos uauceqso uauceoqs
uauceosq uaucesoq uaucesqo uauesqco uauesqoc uauescqo uauescoq uauesocq uauesoqc uaueqsco uaueqsoc
uaueqcso uaueqcos uaueqocs uaueqosc uauecqso uauecqos uauecsqo uauecsoq uauecosq uauecoqs uaueoqcs
uaueoqsc uaueocqs uaueocsq uaueoscq uaueosqc uaeosquc uaeosqcu uaeosuqc uaeosucq uaeoscuq uaeoscqu
uaeoqsuc uaeoqscu uaeoqusc uaeoqucs uaeoqcus uaeoqcsu uaeouqsc uaeouqcs uaeousqc uaeouscq uaeoucsq
uaeoucqs uaeocqus uaeocqsu uaeocuqs uaeocusq uaeocsuq uaeocsqu uaesoquc uaesoqcu uaesouqc uaesoucq
uaesocuq uaesocqu uaesqouc uaesqocu uaesquoc uaesquco uaesqcuo uaesqcou uaesuqoc uaesuqco uaesuoqc
uaesuocq uaesucoq uaesucqo uaescquo uaescqou uaescuqo uaescuoq uaescouq uaescoqu uaeqsouc uaeqsocu
uaeqsuoc uaeqsuco uaeqscuo uaeqscou uaeqosuc uaeqoscu uaeqousc uaeqoucs uaeqocus uaeqocsu uaequosc
uaequocs uaequsoc uaequsco uaequcso uaequcos uaeqcous uaeqcosu uaeqcuos uaeqcuso uaeqcsuo uaeqcsou
uaeusqoc uaeusqco uaeusoqc uaeusocq uaeuscoq uaeuscqo uaeuqsoc uaeuqsco uaeuqosc uaeuqocs uaeuqcos
uaeuqcso uaeuoqsc uaeuoqcs uaeuosqc uaeuoscq uaeuocsq uaeuocqs uaeucqos uaeucqso uaeucoqs uaeucosq
uaeucsoq uaeucsqo uaecsquo uaecsqou uaecsuqo uaecsuoq uaecsouq uaecsoqu uaecqsuo uaecqsou uaecquso
uaecquos uaecqous uaecqosu uaecuqso uaecuqos uaecusqo uaecusoq uaecuosq uaecuoqs uaecoqus uaecoqsu
uaecouqs uaecousq uaecosuq uaecosqu uscaoque uscaoqeu uscaouqe uscaoueq uscaoeuq uscaoequ uscaqoue
uscaqoeu uscaquoe uscaqueo uscaqeuo uscaqeou uscauqoe uscauqeo uscauoqe uscauoeq uscaueoq uscaueqo
uscaequo uscaeqou uscaeuqo uscaeuoq uscaeouq uscaeoqu uscoaque uscoaqeu uscoauqe uscoaueq uscoaeuq
uscoaequ uscoqaue uscoqaeu uscoquae uscoquea uscoqeua uscoqeau uscouqae uscouqea uscouaqe uscouaeq
uscoueaq uscoueqa uscoequa uscoeqau uscoeuqa uscoeuaq uscoeauq uscoeaqu uscqoaue uscqoaeu uscqouae
uscqouea uscqoeua uscqoeau uscqaoue uscqaoeu uscqauoe uscqaueo uscqaeuo uscqaeou uscquaoe uscquaeo
uscquoae uscquoea uscqueoa uscqueao uscqeauo uscqeaou uscqeuao uscqeuoa uscqeoua uscqeoau uscuoqae
uscuoqea uscuoaqe uscuoaeq uscuoeaq uscuoeqa uscuqoae uscuqoea uscuqaoe uscuqaeo uscuqeao uscuqeoa
uscuaqoe uscuaqeo uscuaoqe uscuaoeq uscuaeoq uscuaeqo uscueqao uscueqoa uscueaqo uscueaoq uscueoaq
uscueoqa usceoqua usceoqau usceouqa usceouaq usceoauq usceoaqu usceqoua usceqoau uscequoa uscequao
usceqauo usceqaou usceuqoa usceuqao usceuoqa usceuoaq usceuaoq usceuaqo usceaquo usceaqou usceauqo
usceauoq usceaouq usceaoqu usacoque usacoqeu usacouqe usacoueq usacoeuq usacoequ usacqoue usacqoeu
usacquoe usacqueo usacqeuo usacqeou usacuqoe usacuqeo usacuoqe usacuoeq usacueoq usacueqo usacequo
usaceqou usaceuqo usaceuoq usaceouq usaceoqu usaocque usaocqeu usaocuqe usaocueq usaoceuq usaocequ
usaoqcue usaoqceu usaoquce usaoquec usaoqeuc usaoqecu usaouqce usaouqec usaoucqe usaouceq usaouecq
usaoueqc usaoequc usaoeqcu usaoeuqc usaoeucq usaoecuq usaoecqu usaqocue usaqoceu usaqouce usaqouec
usaqoeuc usaqoecu usaqcoue usaqcoeu usaqcuoe usaqcueo usaqceuo usaqceou usaqucoe usaquceo usaquoce
usaquoec usaqueoc usaqueco usaqecuo usaqecou usaqeuco usaqeuoc usaqeouc usaqeocu usauoqce usauoqec
usauocqe usauoceq usauoecq usauoeqc usauqoce usauqoec usauqcoe usauqceo usauqeco usauqeoc usaucqoe
usaucqeo usaucoqe usaucoeq usauceoq usauceqo usaueqco usaueqoc usauecqo usauecoq usaueocq usaueoqc
usaeoquc usaeoqcu usaeouqc usaeoucq usaeocuq usaeocqu usaeqouc usaeqocu usaequoc usaequco usaeqcuo
usaeqcou usaeuqoc usaeuqco usaeuoqc usaeuocq usaeucoq usaeucqo usaecquo usaecqou usaecuqo usaecuoq
usaecouq usaecoqu usoacque usoacqeu usoacuqe usoacueq usoaceuq usoacequ usoaqcue usoaqceu usoaquce
usoaquec usoaqeuc usoaqecu usoauqce usoauqec usoaucqe usoauceq usoauecq usoaueqc usoaequc usoaeqcu
usoaeuqc usoaeucq usoaecuq usoaecqu usocaque usocaqeu usocauqe usocaueq usocaeuq usocaequ usocqaue
usocqaeu usocquae usocquea usocqeua usocqeau usocuqae usocuqea usocuaqe usocuaeq usocueaq usocueqa
usocequa usoceqau usoceuqa usoceuaq usoceauq usoceaqu usoqcaue usoqcaeu usoqcuae usoqcuea usoqceua
usoqceau usoqacue usoqaceu usoqauce usoqauec usoqaeuc usoqaecu usoquace usoquaec usoqucae usoqucea
usoqueca usoqueac usoqeauc usoqeacu usoqeuac usoqeuca usoqecua usoqecau usoucqae usoucqea usoucaqe
usoucaeq usouceaq usouceqa usouqcae usouqcea usouqace usouqaec usouqeac usouqeca usouaqce usouaqec
usouacqe usouaceq usouaecq usouaeqc usoueqac usoueqca usoueaqc usoueacq usouecaq usouecqa usoecqua
usoecqau usoecuqa usoecuaq usoecauq usoecaqu usoeqcua usoeqcau usoequca usoequac usoeqauc usoeqacu
usoeuqca usoeuqac usoeucqa usoeucaq usoeuacq usoeuaqc usoeaquc usoeaqcu usoeauqc usoeaucq usoeacuq
usoeacqu usqaocue usqaoceu usqaouce usqaouec usqaoeuc usqaoecu usqacoue usqacoeu usqacuoe usqacueo
usqaceuo usqaceou usqaucoe usqauceo usqauoce usqauoec usqaueoc usqaueco usqaecuo usqaecou usqaeuco
usqaeuoc usqaeouc usqaeocu usqoacue usqoaceu usqoauce usqoauec usqoaeuc usqoaecu usqocaue usqocaeu
usqocuae usqocuea usqoceua usqoceau usqoucae usqoucea usqouace usqouaec usqoueac usqoueca usqoecua
usqoecau usqoeuca usqoeuac usqoeauc usqoeacu usqcoaue usqcoaeu usqcouae usqcouea usqcoeua usqcoeau
usqcaoue usqcaoeu usqcauoe usqcaueo usqcaeuo usqcaeou usqcuaoe usqcuaeo usqcuoae usqcuoea usqcueoa
usqcueao usqceauo usqceaou usqceuao usqceuoa usqceoua usqceoau usquocae usquocea usquoace usquoaec
usquoeac usquoeca usqucoae usqucoea usqucaoe usqucaeo usquceao usquceoa usquacoe usquaceo usquaoce
usquaoec usquaeoc usquaeco usquecao usquecoa usqueaco usqueaoc usqueoac usqueoca usqeocua usqeocau
usqeouca usqeouac usqeoauc usqeoacu usqecoua usqecoau usqecuoa usqecuao usqecauo usqecaou usqeucoa
usqeucao usqeuoca usqeuoac usqeuaoc usqeuaco usqeacuo usqeacou usqeauco usqeauoc usqeaouc usqeaocu
usuaoqce usuaoqec usuaocqe usuaoceq usuaoecq usuaoeqc usuaqoce usuaqoec usuaqcoe usuaqceo usuaqeco
usuaqeoc usuacqoe usuacqeo usuacoqe usuacoeq usuaceoq usuaceqo usuaeqco usuaeqoc usuaecqo usuaecoq
usuaeocq usuaeoqc usuoaqce usuoaqec usuoacqe usuoaceq usuoaecq usuoaeqc usuoqace usuoqaec usuoqcae
usuoqcea usuoqeca usuoqeac usuocqae usuocqea usuocaqe usuocaeq usuoceaq usuoceqa usuoeqca usuoeqac
usuoecqa usuoecaq usuoeacq usuoeaqc usuqoace usuqoaec usuqocae usuqocea usuqoeca usuqoeac usuqaoce
usuqaoec usuqacoe usuqaceo usuqaeco usuqaeoc usuqcaoe usuqcaeo usuqcoae usuqcoea usuqceoa usuqceao
usuqeaco usuqeaoc usuqecao usuqecoa usuqeoca usuqeoac usucoqae usucoqea usucoaqe usucoaeq usucoeaq
usucoeqa usucqoae usucqoea usucqaoe usucqaeo usucqeao usucqeoa usucaqoe usucaqeo usucaoqe usucaoeq
usucaeoq usucaeqo usuceqao usuceqoa usuceaqo usuceaoq usuceoaq usuceoqa usueoqca usueoqac usueocqa
usueocaq usueoacq usueoaqc usueqoca usueqoac usueqcoa usueqcao usueqaco usueqaoc usuecqoa usuecqao
usuecoqa usuecoaq usuecaoq usuecaqo usueaqco usueaqoc usueacqo usueacoq usueaocq usueaoqc useaoquc
useaoqcu useaouqc useaoucq useaocuq useaocqu useaqouc useaqocu useaquoc useaquco useaqcuo useaqcou
useauqoc useauqco useauoqc useauocq useaucoq useaucqo useacquo useacqou useacuqo useacuoq useacouq
useacoqu useoaquc useoaqcu useoauqc useoaucq useoacuq useoacqu useoqauc useoqacu useoquac useoquca
useoqcua useoqcau useouqac useouqca useouaqc useouacq useoucaq useoucqa useocqua useocqau useocuqa
useocuaq useocauq useocaqu useqoauc useqoacu useqouac useqouca useqocua useqocau useqaouc useqaocu
useqauoc useqauco useqacuo useqacou usequaoc usequaco usequoac usequoca usequcoa usequcao useqcauo
useqcaou useqcuao useqcuoa useqcoua useqcoau useuoqac useuoqca useuoaqc useuoacq useuocaq useuocqa
useuqoac useuqoca useuqaoc useuqaco useuqcao useuqcoa useuaqoc useuaqco useuaoqc useuaocq useuacoq
useuacqo useucqao useucqoa useucaqo useucaoq useucoaq useucoqa usecoqua usecoqau usecouqa usecouaq
usecoauq usecoaqu usecqoua usecqoau usecquoa usecquao usecqauo usecqaou usecuqoa usecuqao usecuoqa
usecuoaq usecuaoq usecuaqo usecaquo usecaqou usecauqo usecauoq usecaouq usecaoqu uqcasoue uqcasoeu
uqcasuoe uqcasueo uqcaseuo uqcaseou uqcaosue uqcaoseu uqcaouse uqcaoues uqcaoeus uqcaoesu uqcauose
uqcauoes uqcausoe uqcauseo uqcaueso uqcaueos uqcaeous uqcaeosu uqcaeuos uqcaeuso uqcaesuo uqcaesou
uqcsaoue uqcsaoeu uqcsauoe uqcsaueo uqcsaeuo uqcsaeou uqcsoaue uqcsoaeu uqcsouae uqcsouea uqcsoeua
uqcsoeau uqcsuoae uqcsuoea uqcsuaoe uqcsuaeo uqcsueao uqcsueoa uqcseoua uqcseoau uqcseuoa uqcseuao
uqcseauo uqcseaou uqcosaue uqcosaeu uqcosuae uqcosuea uqcoseua uqcoseau uqcoasue uqcoaseu uqcoause
uqcoaues uqcoaeus uqcoaesu uqcouase uqcouaes uqcousae uqcousea uqcouesa uqcoueas uqcoeaus uqcoeasu
uqcoeuas uqcoeusa uqcoesua uqcoesau uqcusoae uqcusoea uqcusaoe uqcusaeo uqcuseao uqcuseoa uqcuosae
uqcuosea uqcuoase uqcuoaes uqcuoeas uqcuoesa uqcuaose uqcuaoes uqcuasoe uqcuaseo uqcuaeso uqcuaeos
uqcueoas uqcueosa uqcueaos uqcueaso uqcuesao uqcuesoa uqcesoua uqcesoau uqcesuoa uqcesuao uqcesauo
uqcesaou uqceosua uqceosau uqceousa uqceouas uqceoaus uqceoasu uqceuosa uqceuoas uqceusoa uqceusao
uqceuaso uqceuaos uqceaous uqceaosu uqceauos uqceauso uqceasuo uqceasou uqacsoue uqacsoeu uqacsuoe
uqacsueo uqacseuo uqacseou uqacosue uqacoseu uqacouse uqacoues uqacoeus uqacoesu uqacuose uqacuoes
uqacusoe uqacuseo uqacueso uqacueos uqaceous uqaceosu uqaceuos uqaceuso uqacesuo uqacesou uqascoue
uqascoeu uqascuoe uqascueo uqasceuo uqasceou uqasocue uqasoceu uqasouce uqasouec uqasoeuc uqasoecu
uqasuoce uqasuoec uqasucoe uqasuceo uqasueco uqasueoc uqaseouc uqaseocu uqaseuoc uqaseuco uqasecuo
uqasecou uqaoscue uqaosceu uqaosuce uqaosuec uqaoseuc uqaosecu uqaocsue uqaocseu uqaocuse uqaocues
uqaoceus uqaocesu uqaoucse uqaouces uqaousce uqaousec uqaouesc uqaouecs uqaoecus uqaoecsu uqaoeucs
uqaoeusc uqaoesuc uqaoescu uqausoce uqausoec uqauscoe uqausceo uqauseco uqauseoc uqauosce uqauosec
uqauocse uqauoces uqauoecs uqauoesc uqaucose uqaucoes uqaucsoe uqaucseo uqauceso uqauceos uqaueocs
uqaueosc uqauecos uqauecso uqauesco uqauesoc uqaesouc uqaesocu uqaesuoc uqaesuco uqaescuo uqaescou
uqaeosuc uqaeoscu uqaeousc uqaeoucs uqaeocus uqaeocsu uqaeuosc uqaeuocs uqaeusoc uqaeusco uqaeucso
uqaeucos uqaecous uqaecosu uqaecuos uqaecuso uqaecsuo uqaecsou uqsacoue uqsacoeu uqsacuoe uqsacueo
uqsaceuo uqsaceou uqsaocue uqsaoceu uqsaouce uqsaouec uqsaoeuc uqsaoecu uqsauoce uqsauoec uqsaucoe
uqsauceo uqsaueco uqsaueoc uqsaeouc uqsaeocu uqsaeuoc uqsaeuco uqsaecuo uqsaecou uqscaoue uqscaoeu
uqscauoe uqscaueo uqscaeuo uqscaeou uqscoaue uqscoaeu uqscouae uqscouea uqscoeua uqscoeau uqscuoae
uqscuoea uqscuaoe uqscuaeo uqscueao uqscueoa uqsceoua uqsceoau uqsceuoa uqsceuao uqsceauo uqsceaou
uqsocaue uqsocaeu uqsocuae uqsocuea uqsoceua uqsoceau uqsoacue uqsoaceu uqsoauce uqsoauec uqsoaeuc
uqsoaecu uqsouace uqsouaec uqsoucae uqsoucea uqsoueca uqsoueac uqsoeauc uqsoeacu uqsoeuac uqsoeuca
uqsoecua uqsoecau uqsucoae uqsucoea uqsucaoe uqsucaeo uqsuceao uqsuceoa uqsuocae uqsuocea uqsuoace
uqsuoaec uqsuoeac uqsuoeca uqsuaoce uqsuaoec uqsuacoe uqsuaceo uqsuaeco uqsuaeoc uqsueoac uqsueoca
uqsueaoc uqsueaco uqsuecao uqsuecoa uqsecoua uqsecoau uqsecuoa uqsecuao uqsecauo uqsecaou uqseocua
uqseocau uqseouca uqseouac uqseoauc uqseoacu uqseuoca uqseuoac uqseucoa uqseucao uqseuaco uqseuaoc
uqseaouc uqseaocu uqseauoc uqseauco uqseacuo uqseacou uqoascue uqoasceu uqoasuce uqoasuec uqoaseuc
uqoasecu uqoacsue uqoacseu uqoacuse uqoacues uqoaceus uqoacesu uqoaucse uqoauces uqoausce uqoausec
uqoauesc uqoauecs uqoaecus uqoaecsu uqoaeucs uqoaeusc uqoaesuc uqoaescu uqosacue uqosaceu uqosauce
uqosauec uqosaeuc uqosaecu uqoscaue uqoscaeu uqoscuae uqoscuea uqosceua uqosceau uqosucae uqosucea
uqosuace uqosuaec uqosueac uqosueca uqosecua uqosecau uqoseuca uqoseuac uqoseauc uqoseacu uqocsaue
uqocsaeu uqocsuae uqocsuea uqocseua uqocseau uqocasue uqocaseu uqocause uqocaues uqocaeus uqocaesu
uqocuase uqocuaes uqocusae uqocusea uqocuesa uqocueas uqoceaus uqoceasu uqoceuas uqoceusa uqocesua
uqocesau uqouscae uqouscea uqousace uqousaec uqouseac uqouseca uqoucsae uqoucsea uqoucase uqoucaes
uqouceas uqoucesa uqouacse uqouaces uqouasce uqouasec uqouaesc uqouaecs uqouecas uqouecsa uqoueacs
uqoueasc uqouesac uqouesca uqoescua uqoescau uqoesuca uqoesuac uqoesauc uqoesacu uqoecsua uqoecsau
uqoecusa uqoecuas uqoecaus uqoecasu uqoeucsa uqoeucas uqoeusca uqoeusac uqoeuasc uqoeuacs uqoeacus
uqoeacsu uqoeaucs uqoeausc uqoeasuc uqoeascu uquasoce uquasoec uquascoe uquasceo uquaseco uquaseoc
uquaosce uquaosec uquaocse uquaoces uquaoecs uquaoesc uquacose uquacoes uquacsoe uquacseo uquaceso
uquaceos uquaeocs uquaeosc uquaecos uquaecso uquaesco uquaesoc uqusaoce uqusaoec uqusacoe uqusaceo
uqusaeco uqusaeoc uqusoace uqusoaec uqusocae uqusocea uqusoeca uqusoeac uquscoae uquscoea uquscaoe
uquscaeo uqusceao uqusceoa uquseoca uquseoac uqusecoa uqusecao uquseaco uquseaoc uquosace uquosaec
uquoscae uquoscea uquoseca uquoseac uquoasce uquoasec uquoacse uquoaces uquoaecs uquoaesc uquocase
uquocaes uquocsae uquocsea uquocesa uquoceas uquoeacs uquoeasc uquoecas uquoecsa uquoesca uquoesac
uqucsoae uqucsoea uqucsaoe uqucsaeo uqucseao uqucseoa uqucosae uqucosea uqucoase uqucoaes uqucoeas
uqucoesa uqucaose uqucaoes uqucasoe uqucaseo uqucaeso uqucaeos uquceoas uquceosa uquceaos uquceaso
uqucesao uqucesoa uquesoca uquesoac uquescoa uquescao uquesaco uquesaoc uqueosca uqueosac uqueocsa
uqueocas uqueoacs uqueoasc uquecosa uquecoas uquecsoa uquecsao uquecaso uquecaos uqueaocs uqueaosc
uqueacos uqueacso uqueasco uqueasoc uqeasouc uqeasocu uqeasuoc uqeasuco uqeascuo uqeascou uqeaosuc
uqeaoscu uqeaousc uqeaoucs uqeaocus uqeaocsu uqeauosc uqeauocs uqeausoc uqeausco uqeaucso uqeaucos
uqeacous uqeacosu uqeacuos uqeacuso uqeacsuo uqeacsou uqesaouc uqesaocu uqesauoc uqesauco uqesacuo
uqesacou uqesoauc uqesoacu uqesouac uqesouca uqesocua uqesocau uqesuoac uqesuoca uqesuaoc uqesuaco
uqesucao uqesucoa uqescoua uqescoau uqescuoa uqescuao uqescauo uqescaou uqeosauc uqeosacu uqeosuac
uqeosuca uqeoscua uqeoscau uqeoasuc uqeoascu uqeoausc uqeoaucs uqeoacus uqeoacsu uqeouasc uqeouacs
uqeousac uqeousca uqeoucsa uqeoucas uqeocaus uqeocasu uqeocuas uqeocusa uqeocsua uqeocsau uqeusoac
uqeusoca uqeusaoc uqeusaco uqeuscao uqeuscoa uqeuosac uqeuosca uqeuoasc uqeuoacs uqeuocas uqeuocsa
uqeuaosc uqeuaocs uqeuasoc uqeuasco uqeuacso uqeuacos uqeucoas uqeucosa uqeucaos uqeucaso uqeucsao
uqeucsoa uqecsoua uqecsoau uqecsuoa uqecsuao uqecsauo uqecsaou uqecosua uqecosau uqecousa uqecouas
uqecoaus uqecoasu uqecuosa uqecuoas uqecusoa uqecusao uqecuaso uqecuaos uqecaous uqecaosu uqecauos
uqecauso uqecasuo uqecasou uucasqoe uucasqeo uucasoqe uucasoeq uucaseoq uucaseqo uucaqsoe uucaqseo
uucaqose uucaqoes uucaqeos uucaqeso uucaoqse uucaoqes uucaosqe uucaoseq uucaoesq uucaoeqs uucaeqos
uucaeqso uucaeoqs uucaeosq uucaesoq uucaesqo uucsaqoe uucsaqeo uucsaoqe uucsaoeq uucsaeoq uucsaeqo
uucsqaoe uucsqaeo uucsqoae uucsqoea uucsqeoa uucsqeao uucsoqae uucsoqea uucsoaqe uucsoaeq uucsoeaq
uucsoeqa uucseqoa uucseqao uucseoqa uucseoaq uucseaoq uucseaqo uucqsaoe uucqsaeo uucqsoae uucqsoea
uucqseoa uucqseao uucqasoe uucqaseo uucqaose uucqaoes uucqaeos uucqaeso uucqoase uucqoaes uucqosae
uucqosea uucqoesa uucqoeas uucqeaos uucqeaso uucqeoas uucqeosa uucqesoa uucqesao uucosqae uucosqea
uucosaqe uucosaeq uucoseaq uucoseqa uucoqsae uucoqsea uucoqase uucoqaes uucoqeas uucoqesa uucoaqse
uucoaqes uucoasqe uucoaseq uucoaesq uucoaeqs uucoeqas uucoeqsa uucoeaqs uucoeasq uucoesaq uucoesqa
uucesqoa uucesqao uucesoqa uucesoaq uucesaoq uucesaqo uuceqsoa uuceqsao uuceqosa uuceqoas uuceqaos
uuceqaso uuceoqsa uuceoqas uuceosqa uuceosaq uuceoasq uuceoaqs uuceaqos uuceaqso uuceaoqs uuceaosq
uuceasoq uuceasqo uuacsqoe uuacsqeo uuacsoqe uuacsoeq uuacseoq uuacseqo uuacqsoe uuacqseo uuacqose
uuacqoes uuacqeos uuacqeso uuacoqse uuacoqes uuacosqe uuacoseq uuacoesq uuacoeqs uuaceqos uuaceqso
uuaceoqs uuaceosq uuacesoq uuacesqo uuascqoe uuascqeo uuascoqe uuascoeq uuasceoq uuasceqo uuasqcoe
uuasqceo uuasqoce uuasqoec uuasqeoc uuasqeco uuasoqce uuasoqec uuasocqe uuasoceq uuasoecq uuasoeqc
uuaseqoc uuaseqco uuaseoqc uuaseocq uuasecoq uuasecqo uuaqscoe uuaqsceo uuaqsoce uuaqsoec uuaqseoc
uuaqseco uuaqcsoe uuaqcseo uuaqcose uuaqcoes uuaqceos uuaqceso uuaqocse uuaqoces uuaqosce uuaqosec
uuaqoesc uuaqoecs uuaqecos uuaqecso uuaqeocs uuaqeosc uuaqesoc uuaqesco uuaosqce uuaosqec uuaoscqe
uuaosceq uuaosecq uuaoseqc uuaoqsce uuaoqsec uuaoqcse uuaoqces uuaoqecs uuaoqesc uuaocqse uuaocqes
uuaocsqe uuaocseq uuaocesq uuaoceqs uuaoeqcs uuaoeqsc uuaoecqs uuaoecsq uuaoescq uuaoesqc uuaesqoc
uuaesqco uuaesoqc uuaesocq uuaescoq uuaescqo uuaeqsoc uuaeqsco uuaeqosc uuaeqocs uuaeqcos uuaeqcso
uuaeoqsc uuaeoqcs uuaeosqc uuaeoscq uuaeocsq uuaeocqs uuaecqos uuaecqso uuaecoqs uuaecosq uuaecsoq
uuaecsqo uusacqoe uusacqeo uusacoqe uusacoeq uusaceoq uusaceqo uusaqcoe uusaqceo uusaqoce uusaqoec
uusaqeoc uusaqeco uusaoqce uusaoqec uusaocqe uusaoceq uusaoecq uusaoeqc uusaeqoc uusaeqco uusaeoqc
uusaeocq uusaecoq uusaecqo uuscaqoe uuscaqeo uuscaoqe uuscaoeq uuscaeoq uuscaeqo uuscqaoe uuscqaeo
uuscqoae uuscqoea uuscqeoa uuscqeao uuscoqae uuscoqea uuscoaqe uuscoaeq uuscoeaq uuscoeqa uusceqoa
uusceqao uusceoqa uusceoaq uusceaoq uusceaqo uusqcaoe uusqcaeo uusqcoae uusqcoea uusqceoa uusqceao
uusqacoe uusqaceo uusqaoce uusqaoec uusqaeoc uusqaeco uusqoace uusqoaec uusqocae uusqocea uusqoeca
uusqoeac uusqeaoc uusqeaco uusqeoac uusqeoca uusqecoa uusqecao uusocqae uusocqea uusocaqe uusocaeq
uusoceaq uusoceqa uusoqcae uusoqcea uusoqace uusoqaec uusoqeac uusoqeca uusoaqce uusoaqec uusoacqe
uusoaceq uusoaecq uusoaeqc uusoeqac uusoeqca uusoeaqc uusoeacq uusoecaq uusoecqa uusecqoa uusecqao
uusecoqa uusecoaq uusecaoq uusecaqo uuseqcoa uuseqcao uuseqoca uuseqoac uuseqaoc uuseqaco uuseoqca
uuseoqac uuseocqa uuseocaq uuseoacq uuseoaqc uuseaqoc uuseaqco uuseaoqc uuseaocq uuseacoq uuseacqo
uuqascoe uuqasceo uuqasoce uuqasoec uuqaseoc uuqaseco uuqacsoe uuqacseo uuqacose uuqacoes uuqaceos
uuqaceso uuqaocse uuqaoces uuqaosce uuqaosec uuqaoesc uuqaoecs uuqaecos uuqaecso uuqaeocs uuqaeosc
uuqaesoc uuqaesco uuqsacoe uuqsaceo uuqsaoce uuqsaoec uuqsaeoc uuqsaeco uuqscaoe uuqscaeo uuqscoae
uuqscoea uuqsceoa uuqsceao uuqsocae uuqsocea uuqsoace uuqsoaec uuqsoeac uuqsoeca uuqsecoa uuqsecao
uuqseoca uuqseoac uuqseaoc uuqseaco uuqcsaoe uuqcsaeo uuqcsoae uuqcsoea uuqcseoa uuqcseao uuqcasoe
uuqcaseo uuqcaose uuqcaoes uuqcaeos uuqcaeso uuqcoase uuqcoaes uuqcosae uuqcosea uuqcoesa uuqcoeas
uuqceaos uuqceaso uuqceoas uuqceosa uuqcesoa uuqcesao uuqoscae uuqoscea uuqosace uuqosaec uuqoseac
uuqoseca uuqocsae uuqocsea uuqocase uuqocaes uuqoceas uuqocesa uuqoacse uuqoaces uuqoasce uuqoasec
uuqoaesc uuqoaecs uuqoecas uuqoecsa uuqoeacs uuqoeasc uuqoesac uuqoesca uuqescoa uuqescao uuqesoca
uuqesoac uuqesaoc uuqesaco uuqecsoa uuqecsao uuqecosa uuqecoas uuqecaos uuqecaso uuqeocsa uuqeocas
uuqeosca uuqeosac uuqeoasc uuqeoacs uuqeacos uuqeacso uuqeaocs uuqeaosc uuqeasoc uuqeasco uuoasqce
uuoasqec uuoascqe uuoasceq uuoasecq uuoaseqc uuoaqsce uuoaqsec uuoaqcse uuoaqces uuoaqecs uuoaqesc
uuoacqse uuoacqes uuoacsqe uuoacseq uuoacesq uuoaceqs uuoaeqcs uuoaeqsc uuoaecqs uuoaecsq uuoaescq
uuoaesqc uuosaqce uuosaqec uuosacqe uuosaceq uuosaecq uuosaeqc uuosqace uuosqaec uuosqcae uuosqcea
uuosqeca uuosqeac uuoscqae uuoscqea uuoscaqe uuoscaeq uuosceaq uuosceqa uuoseqca uuoseqac uuosecqa
uuosecaq uuoseacq uuoseaqc uuoqsace uuoqsaec uuoqscae uuoqscea uuoqseca uuoqseac uuoqasce uuoqasec
uuoqacse uuoqaces uuoqaecs uuoqaesc uuoqcase uuoqcaes uuoqcsae uuoqcsea uuoqcesa uuoqceas uuoqeacs
uuoqeasc uuoqecas uuoqecsa uuoqesca uuoqesac uuocsqae uuocsqea uuocsaqe uuocsaeq uuocseaq uuocseqa
uuocqsae uuocqsea uuocqase uuocqaes uuocqeas uuocqesa uuocaqse uuocaqes uuocasqe uuocaseq uuocaesq
uuocaeqs uuoceqas uuoceqsa uuoceaqs uuoceasq uuocesaq uuocesqa uuoesqca uuoesqac uuoescqa uuoescaq
uuoesacq uuoesaqc uuoeqsca uuoeqsac uuoeqcsa uuoeqcas uuoeqacs uuoeqasc uuoecqsa uuoecqas uuoecsqa
uuoecsaq uuoecasq uuoecaqs uuoeaqcs uuoeaqsc uuoeacqs uuoeacsq uuoeascq uuoeasqc uueasqoc uueasqco
uueasoqc uueasocq uueascoq uueascqo uueaqsoc uueaqsco uueaqosc uueaqocs uueaqcos uueaqcso uueaoqsc
uueaoqcs uueaosqc uueaoscq uueaocsq uueaocqs uueacqos uueacqso uueacoqs uueacosq uueacsoq uueacsqo
uuesaqoc uuesaqco uuesaoqc uuesaocq uuesacoq uuesacqo uuesqaoc uuesqaco uuesqoac uuesqoca uuesqcoa
uuesqcao uuesoqac uuesoqca uuesoaqc uuesoacq uuesocaq uuesocqa uuescqoa uuescqao uuescoqa uuescoaq
uuescaoq uuescaqo uueqsaoc uueqsaco uueqsoac uueqsoca uueqscoa uueqscao uueqasoc uueqasco uueqaosc
uueqaocs uueqacos uueqacso uueqoasc uueqoacs uueqosac uueqosca uueqocsa uueqocas uueqcaos uueqcaso
uueqcoas uueqcosa uueqcsoa uueqcsao uueosqac uueosqca uueosaqc uueosacq uueoscaq uueoscqa uueoqsac
uueoqsca uueoqasc uueoqacs uueoqcas uueoqcsa uueoaqsc uueoaqcs uueoasqc uueoascq uueoacsq uueoacqs
uueocqas uueocqsa uueocaqs uueocasq uueocsaq uueocsqa uuecsqoa uuecsqao uuecsoqa uuecsoaq uuecsaoq
uuecsaqo uuecqsoa uuecqsao uuecqosa uuecqoas uuecqaos uuecqaso uuecoqsa uuecoqas uuecosqa uuecosaq
uuecoasq uuecoaqs uuecaqos uuecaqso uuecaoqs uuecaosq uuecasoq uuecasqo uecasquo uecasqou uecasuqo
uecasuoq uecasouq uecasoqu uecaqsuo uecaqsou uecaquso uecaquos uecaqous uecaqosu uecauqso uecauqos
uecausqo uecausoq uecauosq uecauoqs uecaoqus uecaoqsu uecaouqs uecaousq uecaosuq uecaosqu uecsaquo
uecsaqou uecsauqo uecsauoq uecsaouq uecsaoqu uecsqauo uecsqaou uecsquao uecsquoa uecsqoua uecsqoau
uecsuqao uecsuqoa uecsuaqo uecsuaoq uecsuoaq uecsuoqa uecsoqua uecsoqau uecsouqa uecsouaq uecsoauq
uecsoaqu uecqsauo uecqsaou uecqsuao uecqsuoa uecqsoua uecqsoau uecqasuo uecqasou uecqauso uecqauos
uecqaous uecqaosu uecquaso uecquaos uecqusao uecqusoa uecquosa uecquoas uecqoaus uecqoasu uecqouas
uecqousa uecqosua uecqosau uecusqao uecusqoa uecusaqo uecusaoq uecusoaq uecusoqa uecuqsao uecuqsoa
uecuqaso uecuqaos uecuqoas uecuqosa uecuaqso uecuaqos uecuasqo uecuasoq uecuaosq uecuaoqs uecuoqas
uecuoqsa uecuoaqs uecuoasq uecuosaq uecuosqa uecosqua uecosqau uecosuqa uecosuaq uecosauq uecosaqu
uecoqsua uecoqsau uecoqusa uecoquas uecoqaus uecoqasu uecouqsa uecouqas uecousqa uecousaq uecouasq
uecouaqs uecoaqus uecoaqsu uecoauqs uecoausq uecoasuq uecoasqu ueacsquo ueacsqou ueacsuqo ueacsuoq
ueacsouq ueacsoqu ueacqsuo ueacqsou ueacquso ueacquos ueacqous ueacqosu ueacuqso ueacuqos ueacusqo
ueacusoq ueacuosq ueacuoqs ueacoqus ueacoqsu ueacouqs ueacousq ueacosuq ueacosqu ueascquo ueascqou
ueascuqo ueascuoq ueascouq ueascoqu ueasqcuo ueasqcou ueasquco ueasquoc ueasqouc ueasqocu ueasuqco
ueasuqoc ueasucqo ueasucoq ueasuocq ueasuoqc ueasoquc ueasoqcu ueasouqc ueasoucq ueasocuq ueasocqu
ueaqscuo ueaqscou ueaqsuco ueaqsuoc ueaqsouc ueaqsocu ueaqcsuo ueaqcsou ueaqcuso ueaqcuos ueaqcous
ueaqcosu ueaqucso ueaqucos ueaqusco ueaqusoc ueaquosc ueaquocs ueaqocus ueaqocsu ueaqoucs ueaqousc
ueaqosuc ueaqoscu ueausqco ueausqoc ueauscqo ueauscoq ueausocq ueausoqc ueauqsco ueauqsoc ueauqcso
ueauqcos ueauqocs ueauqosc ueaucqso ueaucqos ueaucsqo ueaucsoq ueaucosq ueaucoqs ueauoqcs ueauoqsc
ueauocqs ueauocsq ueauoscq ueauosqc ueaosquc ueaosqcu ueaosuqc ueaosucq ueaoscuq ueaoscqu ueaoqsuc
ueaoqscu ueaoqusc ueaoqucs ueaoqcus ueaoqcsu ueaouqsc ueaouqcs ueaousqc ueaouscq ueaoucsq ueaoucqs
ueaocqus ueaocqsu ueaocuqs ueaocusq ueaocsuq ueaocsqu uesacquo uesacqou uesacuqo uesacuoq uesacouq
uesacoqu uesaqcuo uesaqcou uesaquco uesaquoc uesaqouc uesaqocu uesauqco uesauqoc uesaucqo uesaucoq
uesauocq uesauoqc uesaoquc uesaoqcu uesaouqc uesaoucq uesaocuq uesaocqu uescaquo uescaqou uescauqo
uescauoq uescaouq uescaoqu uescqauo uescqaou uescquao uescquoa uescqoua uescqoau uescuqao uescuqoa
uescuaqo uescuaoq uescuoaq uescuoqa uescoqua uescoqau uescouqa uescouaq uescoauq uescoaqu uesqcauo
uesqcaou uesqcuao uesqcuoa uesqcoua uesqcoau uesqacuo uesqacou uesqauco uesqauoc uesqaouc uesqaocu
uesquaco uesquaoc uesqucao uesqucoa uesquoca uesquoac uesqoauc uesqoacu uesqouac uesqouca uesqocua
uesqocau uesucqao uesucqoa uesucaqo uesucaoq uesucoaq uesucoqa uesuqcao uesuqcoa uesuqaco uesuqaoc
uesuqoac uesuqoca uesuaqco uesuaqoc uesuacqo uesuacoq uesuaocq uesuaoqc uesuoqac uesuoqca uesuoaqc
uesuoacq uesuocaq uesuocqa uesocqua uesocqau uesocuqa uesocuaq uesocauq uesocaqu uesoqcua uesoqcau
uesoquca uesoquac uesoqauc uesoqacu uesouqca uesouqac uesoucqa uesoucaq uesouacq uesouaqc uesoaquc
uesoaqcu uesoauqc uesoaucq uesoacuq uesoacqu ueqascuo ueqascou ueqasuco ueqasuoc ueqasouc ueqasocu
ueqacsuo ueqacsou ueqacuso ueqacuos ueqacous ueqacosu ueqaucso ueqaucos ueqausco ueqausoc ueqauosc
ueqauocs ueqaocus ueqaocsu ueqaoucs ueqaousc ueqaosuc ueqaoscu ueqsacuo ueqsacou ueqsauco ueqsauoc
ueqsaouc ueqsaocu ueqscauo ueqscaou ueqscuao ueqscuoa ueqscoua ueqscoau ueqsucao ueqsucoa ueqsuaco
ueqsuaoc ueqsuoac ueqsuoca ueqsocua ueqsocau ueqsouca ueqsouac ueqsoauc ueqsoacu ueqcsauo ueqcsaou
ueqcsuao ueqcsuoa ueqcsoua ueqcsoau ueqcasuo ueqcasou ueqcauso ueqcauos ueqcaous ueqcaosu ueqcuaso
ueqcuaos ueqcusao ueqcusoa ueqcuosa ueqcuoas ueqcoaus ueqcoasu ueqcouas ueqcousa ueqcosua ueqcosau
uequscao uequscoa uequsaco uequsaoc uequsoac uequsoca uequcsao uequcsoa uequcaso uequcaos uequcoas
uequcosa uequacso uequacos uequasco uequasoc uequaosc uequaocs uequocas uequocsa uequoacs uequoasc
uequosac uequosca ueqoscua ueqoscau ueqosuca ueqosuac ueqosauc ueqosacu ueqocsua ueqocsau ueqocusa
ueqocuas ueqocaus ueqocasu ueqoucsa ueqoucas ueqousca ueqousac ueqouasc ueqouacs ueqoacus ueqoacsu
ueqoaucs ueqoausc ueqoasuc ueqoascu ueuasqco ueuasqoc ueuascqo ueuascoq ueuasocq ueuasoqc ueuaqsco
ueuaqsoc ueuaqcso ueuaqcos ueuaqocs ueuaqosc ueuacqso ueuacqos ueuacsqo ueuacsoq ueuacosq ueuacoqs
ueuaoqcs ueuaoqsc ueuaocqs ueuaocsq ueuaoscq ueuaosqc ueusaqco ueusaqoc ueusacqo ueusacoq ueusaocq
ueusaoqc ueusqaco ueusqaoc ueusqcao ueusqcoa ueusqoca ueusqoac ueuscqao ueuscqoa ueuscaqo ueuscaoq
ueuscoaq ueuscoqa ueusoqca ueusoqac ueusocqa ueusocaq ueusoacq ueusoaqc ueuqsaco ueuqsaoc ueuqscao
ueuqscoa ueuqsoca ueuqsoac ueuqasco ueuqasoc ueuqacso ueuqacos ueuqaocs ueuqaosc ueuqcaso ueuqcaos
ueuqcsao ueuqcsoa ueuqcosa ueuqcoas ueuqoacs ueuqoasc ueuqocas ueuqocsa ueuqosca ueuqosac ueucsqao
ueucsqoa ueucsaqo ueucsaoq ueucsoaq ueucsoqa ueucqsao ueucqsoa ueucqaso ueucqaos ueucqoas ueucqosa
ueucaqso ueucaqos ueucasqo ueucasoq ueucaosq ueucaoqs ueucoqas ueucoqsa ueucoaqs ueucoasq ueucosaq
ueucosqa ueuosqca ueuosqac ueuoscqa ueuoscaq ueuosacq ueuosaqc ueuoqsca ueuoqsac ueuoqcsa ueuoqcas
ueuoqacs ueuoqasc ueuocqsa ueuocqas ueuocsqa ueuocsaq ueuocasq ueuocaqs ueuoaqcs ueuoaqsc ueuoacqs
ueuoacsq ueuoascq ueuoasqc ueoasquc ueoasqcu ueoasuqc ueoasucq ueoascuq ueoascqu ueoaqsuc ueoaqscu
ueoaqusc ueoaqucs ueoaqcus ueoaqcsu ueoauqsc ueoauqcs ueoausqc ueoauscq ueoaucsq ueoaucqs ueoacqus
ueoacqsu ueoacuqs ueoacusq ueoacsuq ueoacsqu ueosaquc ueosaqcu ueosauqc ueosaucq ueosacuq ueosacqu
ueosqauc ueosqacu ueosquac ueosquca ueosqcua ueosqcau ueosuqac ueosuqca ueosuaqc ueosuacq ueosucaq
ueosucqa ueoscqua ueoscqau ueoscuqa ueoscuaq ueoscauq ueoscaqu ueoqsauc ueoqsacu ueoqsuac ueoqsuca
ueoqscua ueoqscau ueoqasuc ueoqascu ueoqausc ueoqaucs ueoqacus ueoqacsu ueoquasc ueoquacs ueoqusac
ueoqusca ueoqucsa ueoqucas ueoqcaus ueoqcasu ueoqcuas ueoqcusa ueoqcsua ueoqcsau ueousqac ueousqca
ueousaqc ueousacq ueouscaq ueouscqa ueouqsac ueouqsca ueouqasc ueouqacs ueouqcas ueouqcsa ueouaqsc
ueouaqcs ueouasqc ueouascq ueouacsq ueouacqs ueoucqas ueoucqsa ueoucaqs ueoucasq ueoucsaq ueoucsqa
ueocsqua ueocsqau ueocsuqa ueocsuaq ueocsauq ueocsaqu ueocqsua ueocqsau ueocqusa ueocquas ueocqaus
ueocqasu ueocuqsa ueocuqas ueocusqa ueocusaq ueocuasq ueocuaqs ueocaqus ueocaqsu ueocauqs ueocausq
ueocasuq ueocasqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us