easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

hpbbpmbo

fehnel

cabrerite

yierba

partae

pandemini

oppresseratque

celeret

consuloque

horometry

whimperingly

replot

exemplary

archerfish

woundability

boleromania

pubescent

horbachite


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: unacquit
cipher variations:
vobdrvju wpceswkv xqdftxlw yreguymx zsfhvzny
atgiwaoz buhjxbpa cvikycqb dwjlzdrc exkmaesd
fylnbfte gzmocguf hanpdhvg iboqeiwh jcprfjxi
kdqsgkyj lerthlzk mfsuimal ngtvjnbm ohuwkocn
pivxlpdo qjwymqep rkxznrfq slyaosgr tmzbpths

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: unacquit
Cipher: fmzxjfrg

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: unacquit
Cipher: BAABB ABBAA AAAAA AAABA ABBBB BAABB ABAAA BAABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: unacquit
cipher variations:
vobdrvjujobhxjzgxobldxpslobpjlfezobtpzvqnobxvnlcpobfhpradobjndhm
robntrxyfobrzfnktobvftdwhobzlhtiwpceswkvkpciykahypcmeyqtmpcqkmgf
apcuqawropcywomdqpcgiqsbepckoeinspcousyzgpcsagolupcwguexipcamiuj
xqdftxlwlqdjzlbizqdnfzrunqdrlnhgbqdvrbxspqdzxpnerqdhjrtcfqdlpfjo
tqdpvtzahqdtbhpmvqdxhvfyjqdbnjvkyreguymxmrekamcjareogasvoresmoih
crewscytqreayqofsreiksudgremqgkpureqwuabireuciqnwreyiwgzkrecokwl
zsfhvznynsflbndkbsfphbtwpsftnpjidsfxtdzursfbzrpgtsfjltvehsfnrhlq
vsfrxvbcjsfvdjroxsfzjxhalsfdplxmatgiwaozotgmcoelctgqicuxqtguoqkj
etgyueavstgcasqhutgkmuwfitgosimrwtgsywcdktgwekspytgakyibmtgeqmyn
buhjxbpapuhndpfmduhrjdvyruhvprlkfuhzvfbwtuhdbtrivuhlnvxgjuhptjns
xuhtzxdeluhxfltqzuhblzjcnuhfrnzocvikycqbqvioeqgneviskewzsviwqsml
gviawgcxuviecusjwvimowyhkviqukotyviuayefmviygmuravicmakdovigsoap
dwjlzdrcrwjpfrhofwjtlfxatwjxrtnmhwjbxhdyvwjfdvtkxwjnpxzilwjrvlpu
zwjvbzfgnwjzhnvsbwjdnblepwjhtpbqexkmaesdsxkqgsipgxkumgybuxkysuon
ixkcyiezwxkgewulyxkoqyajmxkswmqvaxkwcaghoxkaiowtcxkeocmfqxkiuqcr
fylnbftetylrhtjqhylvnhzcvylztvpojyldzjfaxylhfxvmzylprzbknyltxnrw
bylxdbhipylbjpxudylfpdngryljvrdsgzmocgufuzmsiukrizmwoiadwzmauwqp
kzmeakgbyzmigywnazmqsaclozmuyosxczmyecijqzmckqyvezmgqeohszmkwset
hanpdhvgvantjvlsjanxpjbexanbvxrqlanfblhczanjhzxobanrtbdmpanvzpty
danzfdjkrandlrzwfanhrfpitanlxtfuiboqeiwhwboukwmtkboyqkcfybocwysr
mbogcmidabokiaypcbosucenqbowaquzeboageklsboemsaxgboisgqjubomyugv
jcprfjxixcpvlxnulcpzrldgzcpdxztsncphdnjebcpljbzqdcptvdforcpxbrva
fcpbhflmtcpfntbyhcpjthrkvcpnzvhwkdqsgkyjydqwmyovmdqasmehadqeyaut
odqieokfcdqmkcaredquwegpsdqycswbgdqcigmnudqgouczidqkuislwdqoawix
lerthlzkzerxnzpwnerbtnfiberfzbvuperjfplgdernldbsfervxfhqterzdtxc
herdjhnoverhpvdajerlvjtmxerpbxjymfsuimalafsyoaqxofscuogjcfsgacwv
qfskgqmhefsomectgfswygirufsaeuydifsekiopwfsiqwebkfsmwkunyfsqcykz
ngtvjnbmbgtzpbrypgtdvphkdgthbdxwrgtlhrnifgtpnfduhgtxzhjsvgtbfvze
jgtfljpqxgtjrxfclgtnxlvozgtrdzlaohuwkocnchuaqcszqhuewqilehuiceyx
shumisojghuqogevihuyaiktwhucgwafkhugmkqryhuksygdmhuoymwpahuseamb
pivxlpdodivbrdtarivfxrjmfivjdfzytivnjtpkhivrphfwjivzbjluxivdhxbg
livhnlrszivltzhenivpznxqbivtfbncqjwymqepejwcseubsjwgyskngjwkegaz
ujwokuqlijwsqigxkjwackmvyjweiychmjwiomstajwmuaifojwqaoyrcjwugcod
rkxznrfqfkxdtfvctkxhztlohkxlfhbavkxplvrmjkxtrjhylkxbdlnwzkxfjzdi
nkxjpntubkxnvbjgpkxrbpzsdkxvhdpeslyaosgrglyeugwdulyiaumpilymgicb
wlyqmwsnklyuskizmlycemoxalygkaejolykqouvclyowckhqlyscqatelywieqf
tmzbpthshmzfvhxevmzjbvnqjmznhjdcxmzrnxtolmzvtljanmzdfnpybmzhlbfk
pmzlrpvwdmzpxdlirmztdrbufmzxjfrgunacquitinagwiyfwnakcworknaoiked
ynasoyupmnawumkbonaegoqzcnaimcglqnamsqwxenaqyemjsnauescvgnaykgsh

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: unacquit
Cipher: hanpdhvg

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: unacquit
Cipher: 5433113114544244

Extended Methods:
Method #1

Plaintext: unacquit
method variations:
zsfhvzoyexlnaetdkcqsfkyiphvxlpdo

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
u n a c q u i t 
5 3 1 3 1 5 4 4 
4 3 1 1 4 4 2 4 
They are then read out in rows:
5313154443114424
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: unacquit
Cipher: plvtoatr

Read more ...
Method #3

Plaintext: unacquit
method variations:
oclaytry claytryo laytryoc
aytryocl ytryocla tryoclay
ryoclayt yoclaytr

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: unacquit

first 5040 cipher variations(40320 total)
unacquit unacquti unacqiut unacqitu unacqtiu unacqtui unacuqit unacuqti unacuiqt unacuitq unacutiq
unacutqi unaciuqt unaciutq unaciqut unaciqtu unacitqu unacituq unactuiq unactuqi unactiuq unactiqu
unactqiu unactqui unaqcuit unaqcuti unaqciut unaqcitu unaqctiu unaqctui unaqucit unaqucti unaquict
unaquitc unaqutic unaqutci unaqiuct unaqiutc unaqicut unaqictu unaqitcu unaqituc unaqtuic unaqtuci
unaqtiuc unaqticu unaqtciu unaqtcui unauqcit unauqcti unauqict unauqitc unauqtic unauqtci unaucqit
unaucqti unauciqt unaucitq unauctiq unauctqi unauicqt unauictq unauiqct unauiqtc unauitqc unauitcq
unautciq unautcqi unauticq unautiqc unautqic unautqci unaiquct unaiqutc unaiqcut unaiqctu unaiqtcu
unaiqtuc unaiuqct unaiuqtc unaiucqt unaiuctq unaiutcq unaiutqc unaicuqt unaicutq unaicqut unaicqtu
unaictqu unaictuq unaitucq unaituqc unaitcuq unaitcqu unaitqcu unaitquc unatquic unatquci unatqiuc
unatqicu unatqciu unatqcui unatuqic unatuqci unatuiqc unatuicq unatuciq unatucqi unatiuqc unatiucq
unatiquc unatiqcu unaticqu unaticuq unatcuiq unatcuqi unatciuq unatciqu unatcqiu unatcqui uncaquit
uncaquti uncaqiut uncaqitu uncaqtiu uncaqtui uncauqit uncauqti uncauiqt uncauitq uncautiq uncautqi
uncaiuqt uncaiutq uncaiqut uncaiqtu uncaitqu uncaituq uncatuiq uncatuqi uncatiuq uncatiqu uncatqiu
uncatqui uncqauit uncqauti uncqaiut uncqaitu uncqatiu uncqatui uncquait uncquati uncquiat uncquita
uncqutia uncqutai uncqiuat uncqiuta uncqiaut uncqiatu uncqitau uncqitua uncqtuia uncqtuai uncqtiua
uncqtiau uncqtaiu uncqtaui uncuqait uncuqati uncuqiat uncuqita uncuqtia uncuqtai uncuaqit uncuaqti
uncuaiqt uncuaitq uncuatiq uncuatqi uncuiaqt uncuiatq uncuiqat uncuiqta uncuitqa uncuitaq uncutaiq
uncutaqi uncutiaq uncutiqa uncutqia uncutqai unciquat unciquta unciqaut unciqatu unciqtau unciqtua
unciuqat unciuqta unciuaqt unciuatq unciutaq unciutqa unciauqt unciautq unciaqut unciaqtu unciatqu
unciatuq uncituaq uncituqa uncitauq uncitaqu uncitqau uncitqua unctquia unctquai unctqiua unctqiau
unctqaiu unctqaui unctuqia unctuqai unctuiqa unctuiaq unctuaiq unctuaqi unctiuqa unctiuaq unctiqua
unctiqau unctiaqu unctiauq unctauiq unctauqi unctaiuq unctaiqu unctaqiu unctaqui unqcauit unqcauti
unqcaiut unqcaitu unqcatiu unqcatui unqcuait unqcuati unqcuiat unqcuita unqcutia unqcutai unqciuat
unqciuta unqciaut unqciatu unqcitau unqcitua unqctuia unqctuai unqctiua unqctiau unqctaiu unqctaui
unqacuit unqacuti unqaciut unqacitu unqactiu unqactui unqaucit unqaucti unqauict unqauitc unqautic
unqautci unqaiuct unqaiutc unqaicut unqaictu unqaitcu unqaituc unqatuic unqatuci unqatiuc unqaticu
unqatciu unqatcui unquacit unquacti unquaict unquaitc unquatic unquatci unqucait unqucati unquciat
unqucita unquctia unquctai unquicat unquicta unquiact unquiatc unquitac unquitca unqutcia unqutcai
unqutica unqutiac unqutaic unqutaci unqiauct unqiautc unqiacut unqiactu unqiatcu unqiatuc unqiuact
unqiuatc unqiucat unqiucta unqiutca unqiutac unqicuat unqicuta unqicaut unqicatu unqictau unqictua
unqituca unqituac unqitcua unqitcau unqitacu unqitauc unqtauic unqtauci unqtaiuc unqtaicu unqtaciu
unqtacui unqtuaic unqtuaci unqtuiac unqtuica unqtucia unqtucai unqtiuac unqtiuca unqtiauc unqtiacu
unqticau unqticua unqtcuia unqtcuai unqtciua unqtciau unqtcaiu unqtcaui unucqait unucqati unucqiat
unucqita unucqtia unucqtai unucaqit unucaqti unucaiqt unucaitq unucatiq unucatqi unuciaqt unuciatq
unuciqat unuciqta unucitqa unucitaq unuctaiq unuctaqi unuctiaq unuctiqa unuctqia unuctqai unuqcait
unuqcati unuqciat unuqcita unuqctia unuqctai unuqacit unuqacti unuqaict unuqaitc unuqatic unuqatci
unuqiact unuqiatc unuqicat unuqicta unuqitca unuqitac unuqtaic unuqtaci unuqtiac unuqtica unuqtcia
unuqtcai unuaqcit unuaqcti unuaqict unuaqitc unuaqtic unuaqtci unuacqit unuacqti unuaciqt unuacitq
unuactiq unuactqi unuaicqt unuaictq unuaiqct unuaiqtc unuaitqc unuaitcq unuatciq unuatcqi unuaticq
unuatiqc unuatqic unuatqci unuiqact unuiqatc unuiqcat unuiqcta unuiqtca unuiqtac unuiaqct unuiaqtc
unuiacqt unuiactq unuiatcq unuiatqc unuicaqt unuicatq unuicqat unuicqta unuictqa unuictaq unuitacq
unuitaqc unuitcaq unuitcqa unuitqca unuitqac unutqaic unutqaci unutqiac unutqica unutqcia unutqcai
unutaqic unutaqci unutaiqc unutaicq unutaciq unutacqi unutiaqc unutiacq unutiqac unutiqca unuticqa
unuticaq unutcaiq unutcaqi unutciaq unutciqa unutcqia unutcqai unicquat unicquta unicqaut unicqatu
unicqtau unicqtua unicuqat unicuqta unicuaqt unicuatq unicutaq unicutqa unicauqt unicautq unicaqut
unicaqtu unicatqu unicatuq unictuaq unictuqa unictauq unictaqu unictqau unictqua uniqcuat uniqcuta
uniqcaut uniqcatu uniqctau uniqctua uniqucat uniqucta uniquact uniquatc uniqutac uniqutca uniqauct
uniqautc uniqacut uniqactu uniqatcu uniqatuc uniqtuac uniqtuca uniqtauc uniqtacu uniqtcau uniqtcua
uniuqcat uniuqcta uniuqact uniuqatc uniuqtac uniuqtca uniucqat uniucqta uniucaqt uniucatq uniuctaq
uniuctqa uniuacqt uniuactq uniuaqct uniuaqtc uniuatqc uniuatcq uniutcaq uniutcqa uniutacq uniutaqc
uniutqac uniutqca uniaquct uniaqutc uniaqcut uniaqctu uniaqtcu uniaqtuc uniauqct uniauqtc uniaucqt
uniauctq uniautcq uniautqc uniacuqt uniacutq uniacqut uniacqtu uniactqu uniactuq uniatucq uniatuqc
uniatcuq uniatcqu uniatqcu uniatquc unitquac unitquca unitqauc unitqacu unitqcau unitqcua unituqac
unituqca unituaqc unituacq unitucaq unitucqa unitauqc unitaucq unitaquc unitaqcu unitacqu unitacuq
unitcuaq unitcuqa unitcauq unitcaqu unitcqau unitcqua untcquia untcquai untcqiua untcqiau untcqaiu
untcqaui untcuqia untcuqai untcuiqa untcuiaq untcuaiq untcuaqi untciuqa untciuaq untciqua untciqau
untciaqu untciauq untcauiq untcauqi untcaiuq untcaiqu untcaqiu untcaqui untqcuia untqcuai untqciua
untqciau untqcaiu untqcaui untqucia untqucai untquica untquiac untquaic untquaci untqiuca untqiuac
untqicua untqicau untqiacu untqiauc untqauic untqauci untqaiuc untqaicu untqaciu untqacui untuqcia
untuqcai untuqica untuqiac untuqaic untuqaci untucqia untucqai untuciqa untuciaq untucaiq untucaqi
untuicqa untuicaq untuiqca untuiqac untuiaqc untuiacq untuaciq untuacqi untuaicq untuaiqc untuaqic
untuaqci untiquca untiquac untiqcua untiqcau untiqacu untiqauc untiuqca untiuqac untiucqa untiucaq
untiuacq untiuaqc unticuqa unticuaq unticqua unticqau unticaqu unticauq untiaucq untiauqc untiacuq
untiacqu untiaqcu untiaquc untaquic untaquci untaqiuc untaqicu untaqciu untaqcui untauqic untauqci
untauiqc untauicq untauciq untaucqi untaiuqc untaiucq untaiquc untaiqcu untaicqu untaicuq untacuiq
untacuqi untaciuq untaciqu untacqiu untacqui uancquit uancquti uancqiut uancqitu uancqtiu uancqtui
uancuqit uancuqti uancuiqt uancuitq uancutiq uancutqi uanciuqt uanciutq uanciqut uanciqtu uancitqu
uancituq uanctuiq uanctuqi uanctiuq uanctiqu uanctqiu uanctqui uanqcuit uanqcuti uanqciut uanqcitu
uanqctiu uanqctui uanqucit uanqucti uanquict uanquitc uanqutic uanqutci uanqiuct uanqiutc uanqicut
uanqictu uanqitcu uanqituc uanqtuic uanqtuci uanqtiuc uanqticu uanqtciu uanqtcui uanuqcit uanuqcti
uanuqict uanuqitc uanuqtic uanuqtci uanucqit uanucqti uanuciqt uanucitq uanuctiq uanuctqi uanuicqt
uanuictq uanuiqct uanuiqtc uanuitqc uanuitcq uanutciq uanutcqi uanuticq uanutiqc uanutqic uanutqci
uaniquct uaniqutc uaniqcut uaniqctu uaniqtcu uaniqtuc uaniuqct uaniuqtc uaniucqt uaniuctq uaniutcq
uaniutqc uanicuqt uanicutq uanicqut uanicqtu uanictqu uanictuq uanitucq uanituqc uanitcuq uanitcqu
uanitqcu uanitquc uantquic uantquci uantqiuc uantqicu uantqciu uantqcui uantuqic uantuqci uantuiqc
uantuicq uantuciq uantucqi uantiuqc uantiucq uantiquc uantiqcu uanticqu uanticuq uantcuiq uantcuqi
uantciuq uantciqu uantcqiu uantcqui uacnquit uacnquti uacnqiut uacnqitu uacnqtiu uacnqtui uacnuqit
uacnuqti uacnuiqt uacnuitq uacnutiq uacnutqi uacniuqt uacniutq uacniqut uacniqtu uacnitqu uacnituq
uacntuiq uacntuqi uacntiuq uacntiqu uacntqiu uacntqui uacqnuit uacqnuti uacqniut uacqnitu uacqntiu
uacqntui uacqunit uacqunti uacquint uacquitn uacqutin uacqutni uacqiunt uacqiutn uacqinut uacqintu
uacqitnu uacqitun uacqtuin uacqtuni uacqtiun uacqtinu uacqtniu uacqtnui uacuqnit uacuqnti uacuqint
uacuqitn uacuqtin uacuqtni uacunqit uacunqti uacuniqt uacunitq uacuntiq uacuntqi uacuinqt uacuintq
uacuiqnt uacuiqtn uacuitqn uacuitnq uacutniq uacutnqi uacutinq uacutiqn uacutqin uacutqni uaciqunt
uaciqutn uaciqnut uaciqntu uaciqtnu uaciqtun uaciuqnt uaciuqtn uaciunqt uaciuntq uaciutnq uaciutqn
uacinuqt uacinutq uacinqut uacinqtu uacintqu uacintuq uacitunq uacituqn uacitnuq uacitnqu uacitqnu
uacitqun uactquin uactquni uactqiun uactqinu uactqniu uactqnui uactuqin uactuqni uactuiqn uactuinq
uactuniq uactunqi uactiuqn uactiunq uactiqun uactiqnu uactinqu uactinuq uactnuiq uactnuqi uactniuq
uactniqu uactnqiu uactnqui uaqcnuit uaqcnuti uaqcniut uaqcnitu uaqcntiu uaqcntui uaqcunit uaqcunti
uaqcuint uaqcuitn uaqcutin uaqcutni uaqciunt uaqciutn uaqcinut uaqcintu uaqcitnu uaqcitun uaqctuin
uaqctuni uaqctiun uaqctinu uaqctniu uaqctnui uaqncuit uaqncuti uaqnciut uaqncitu uaqnctiu uaqnctui
uaqnucit uaqnucti uaqnuict uaqnuitc uaqnutic uaqnutci uaqniuct uaqniutc uaqnicut uaqnictu uaqnitcu
uaqnituc uaqntuic uaqntuci uaqntiuc uaqnticu uaqntciu uaqntcui uaquncit uaquncti uaqunict uaqunitc
uaquntic uaquntci uaqucnit uaqucnti uaqucint uaqucitn uaquctin uaquctni uaquicnt uaquictn uaquinct
uaquintc uaquitnc uaquitcn uaqutcin uaqutcni uaquticn uaqutinc uaqutnic uaqutnci uaqinuct uaqinutc
uaqincut uaqinctu uaqintcu uaqintuc uaqiunct uaqiuntc uaqiucnt uaqiuctn uaqiutcn uaqiutnc uaqicunt
uaqicutn uaqicnut uaqicntu uaqictnu uaqictun uaqitucn uaqitunc uaqitcun uaqitcnu uaqitncu uaqitnuc
uaqtnuic uaqtnuci uaqtniuc uaqtnicu uaqtnciu uaqtncui uaqtunic uaqtunci uaqtuinc uaqtuicn uaqtucin
uaqtucni uaqtiunc uaqtiucn uaqtinuc uaqtincu uaqticnu uaqticun uaqtcuin uaqtcuni uaqtciun uaqtcinu
uaqtcniu uaqtcnui uaucqnit uaucqnti uaucqint uaucqitn uaucqtin uaucqtni uaucnqit uaucnqti uaucniqt
uaucnitq uaucntiq uaucntqi uaucinqt uaucintq uauciqnt uauciqtn uaucitqn uaucitnq uauctniq uauctnqi
uauctinq uauctiqn uauctqin uauctqni uauqcnit uauqcnti uauqcint uauqcitn uauqctin uauqctni uauqncit
uauqncti uauqnict uauqnitc uauqntic uauqntci uauqinct uauqintc uauqicnt uauqictn uauqitcn uauqitnc
uauqtnic uauqtnci uauqtinc uauqticn uauqtcin uauqtcni uaunqcit uaunqcti uaunqict uaunqitc uaunqtic
uaunqtci uauncqit uauncqti uaunciqt uauncitq uaunctiq uaunctqi uaunicqt uaunictq uauniqct uauniqtc
uaunitqc uaunitcq uauntciq uauntcqi uaunticq uauntiqc uauntqic uauntqci uauiqnct uauiqntc uauiqcnt
uauiqctn uauiqtcn uauiqtnc uauinqct uauinqtc uauincqt uauinctq uauintcq uauintqc uauicnqt uauicntq
uauicqnt uauicqtn uauictqn uauictnq uauitncq uauitnqc uauitcnq uauitcqn uauitqcn uauitqnc uautqnic
uautqnci uautqinc uautqicn uautqcin uautqcni uautnqic uautnqci uautniqc uautnicq uautnciq uautncqi
uautinqc uautincq uautiqnc uautiqcn uauticqn uauticnq uautcniq uautcnqi uautcinq uautciqn uautcqin
uautcqni uaicqunt uaicqutn uaicqnut uaicqntu uaicqtnu uaicqtun uaicuqnt uaicuqtn uaicunqt uaicuntq
uaicutnq uaicutqn uaicnuqt uaicnutq uaicnqut uaicnqtu uaicntqu uaicntuq uaictunq uaictuqn uaictnuq
uaictnqu uaictqnu uaictqun uaiqcunt uaiqcutn uaiqcnut uaiqcntu uaiqctnu uaiqctun uaiqucnt uaiquctn
uaiqunct uaiquntc uaiqutnc uaiqutcn uaiqnuct uaiqnutc uaiqncut uaiqnctu uaiqntcu uaiqntuc uaiqtunc
uaiqtucn uaiqtnuc uaiqtncu uaiqtcnu uaiqtcun uaiuqcnt uaiuqctn uaiuqnct uaiuqntc uaiuqtnc uaiuqtcn
uaiucqnt uaiucqtn uaiucnqt uaiucntq uaiuctnq uaiuctqn uaiuncqt uaiunctq uaiunqct uaiunqtc uaiuntqc
uaiuntcq uaiutcnq uaiutcqn uaiutncq uaiutnqc uaiutqnc uaiutqcn uainquct uainqutc uainqcut uainqctu
uainqtcu uainqtuc uainuqct uainuqtc uainucqt uainuctq uainutcq uainutqc uaincuqt uaincutq uaincqut
uaincqtu uainctqu uainctuq uaintucq uaintuqc uaintcuq uaintcqu uaintqcu uaintquc uaitqunc uaitqucn
uaitqnuc uaitqncu uaitqcnu uaitqcun uaituqnc uaituqcn uaitunqc uaituncq uaitucnq uaitucqn uaitnuqc
uaitnucq uaitnquc uaitnqcu uaitncqu uaitncuq uaitcunq uaitcuqn uaitcnuq uaitcnqu uaitcqnu uaitcqun
uatcquin uatcquni uatcqiun uatcqinu uatcqniu uatcqnui uatcuqin uatcuqni uatcuiqn uatcuinq uatcuniq
uatcunqi uatciuqn uatciunq uatciqun uatciqnu uatcinqu uatcinuq uatcnuiq uatcnuqi uatcniuq uatcniqu
uatcnqiu uatcnqui uatqcuin uatqcuni uatqciun uatqcinu uatqcniu uatqcnui uatqucin uatqucni uatquicn
uatquinc uatqunic uatqunci uatqiucn uatqiunc uatqicun uatqicnu uatqincu uatqinuc uatqnuic uatqnuci
uatqniuc uatqnicu uatqnciu uatqncui uatuqcin uatuqcni uatuqicn uatuqinc uatuqnic uatuqnci uatucqin
uatucqni uatuciqn uatucinq uatucniq uatucnqi uatuicqn uatuicnq uatuiqcn uatuiqnc uatuinqc uatuincq
uatunciq uatuncqi uatunicq uatuniqc uatunqic uatunqci uatiqucn uatiqunc uatiqcun uatiqcnu uatiqncu
uatiqnuc uatiuqcn uatiuqnc uatiucqn uatiucnq uatiuncq uatiunqc uaticuqn uaticunq uaticqun uaticqnu
uaticnqu uaticnuq uatinucq uatinuqc uatincuq uatincqu uatinqcu uatinquc uatnquic uatnquci uatnqiuc
uatnqicu uatnqciu uatnqcui uatnuqic uatnuqci uatnuiqc uatnuicq uatnuciq uatnucqi uatniuqc uatniucq
uatniquc uatniqcu uatnicqu uatnicuq uatncuiq uatncuqi uatnciuq uatnciqu uatncqiu uatncqui ucanquit
ucanquti ucanqiut ucanqitu ucanqtiu ucanqtui ucanuqit ucanuqti ucanuiqt ucanuitq ucanutiq ucanutqi
ucaniuqt ucaniutq ucaniqut ucaniqtu ucanitqu ucanituq ucantuiq ucantuqi ucantiuq ucantiqu ucantqiu
ucantqui ucaqnuit ucaqnuti ucaqniut ucaqnitu ucaqntiu ucaqntui ucaqunit ucaqunti ucaquint ucaquitn
ucaqutin ucaqutni ucaqiunt ucaqiutn ucaqinut ucaqintu ucaqitnu ucaqitun ucaqtuin ucaqtuni ucaqtiun
ucaqtinu ucaqtniu ucaqtnui ucauqnit ucauqnti ucauqint ucauqitn ucauqtin ucauqtni ucaunqit ucaunqti
ucauniqt ucaunitq ucauntiq ucauntqi ucauinqt ucauintq ucauiqnt ucauiqtn ucauitqn ucauitnq ucautniq
ucautnqi ucautinq ucautiqn ucautqin ucautqni ucaiqunt ucaiqutn ucaiqnut ucaiqntu ucaiqtnu ucaiqtun
ucaiuqnt ucaiuqtn ucaiunqt ucaiuntq ucaiutnq ucaiutqn ucainuqt ucainutq ucainqut ucainqtu ucaintqu
ucaintuq ucaitunq ucaituqn ucaitnuq ucaitnqu ucaitqnu ucaitqun ucatquin ucatquni ucatqiun ucatqinu
ucatqniu ucatqnui ucatuqin ucatuqni ucatuiqn ucatuinq ucatuniq ucatunqi ucatiuqn ucatiunq ucatiqun
ucatiqnu ucatinqu ucatinuq ucatnuiq ucatnuqi ucatniuq ucatniqu ucatnqiu ucatnqui ucnaquit ucnaquti
ucnaqiut ucnaqitu ucnaqtiu ucnaqtui ucnauqit ucnauqti ucnauiqt ucnauitq ucnautiq ucnautqi ucnaiuqt
ucnaiutq ucnaiqut ucnaiqtu ucnaitqu ucnaituq ucnatuiq ucnatuqi ucnatiuq ucnatiqu ucnatqiu ucnatqui
ucnqauit ucnqauti ucnqaiut ucnqaitu ucnqatiu ucnqatui ucnquait ucnquati ucnquiat ucnquita ucnqutia
ucnqutai ucnqiuat ucnqiuta ucnqiaut ucnqiatu ucnqitau ucnqitua ucnqtuia ucnqtuai ucnqtiua ucnqtiau
ucnqtaiu ucnqtaui ucnuqait ucnuqati ucnuqiat ucnuqita ucnuqtia ucnuqtai ucnuaqit ucnuaqti ucnuaiqt
ucnuaitq ucnuatiq ucnuatqi ucnuiaqt ucnuiatq ucnuiqat ucnuiqta ucnuitqa ucnuitaq ucnutaiq ucnutaqi
ucnutiaq ucnutiqa ucnutqia ucnutqai ucniquat ucniquta ucniqaut ucniqatu ucniqtau ucniqtua ucniuqat
ucniuqta ucniuaqt ucniuatq ucniutaq ucniutqa ucniauqt ucniautq ucniaqut ucniaqtu ucniatqu ucniatuq
ucnituaq ucnituqa ucnitauq ucnitaqu ucnitqau ucnitqua ucntquia ucntquai ucntqiua ucntqiau ucntqaiu
ucntqaui ucntuqia ucntuqai ucntuiqa ucntuiaq ucntuaiq ucntuaqi ucntiuqa ucntiuaq ucntiqua ucntiqau
ucntiaqu ucntiauq ucntauiq ucntauqi ucntaiuq ucntaiqu ucntaqiu ucntaqui ucqnauit ucqnauti ucqnaiut
ucqnaitu ucqnatiu ucqnatui ucqnuait ucqnuati ucqnuiat ucqnuita ucqnutia ucqnutai ucqniuat ucqniuta
ucqniaut ucqniatu ucqnitau ucqnitua ucqntuia ucqntuai ucqntiua ucqntiau ucqntaiu ucqntaui ucqanuit
ucqanuti ucqaniut ucqanitu ucqantiu ucqantui ucqaunit ucqaunti ucqauint ucqauitn ucqautin ucqautni
ucqaiunt ucqaiutn ucqainut ucqaintu ucqaitnu ucqaitun ucqatuin ucqatuni ucqatiun ucqatinu ucqatniu
ucqatnui ucquanit ucquanti ucquaint ucquaitn ucquatin ucquatni ucqunait ucqunati ucquniat ucqunita
ucquntia ucquntai ucquinat ucquinta ucquiant ucquiatn ucquitan ucquitna ucqutnia ucqutnai ucqutina
ucqutian ucqutain ucqutani ucqiaunt ucqiautn ucqianut ucqiantu ucqiatnu ucqiatun ucqiuant ucqiuatn
ucqiunat ucqiunta ucqiutna ucqiutan ucqinuat ucqinuta ucqinaut ucqinatu ucqintau ucqintua ucqituna
ucqituan ucqitnua ucqitnau ucqitanu ucqitaun ucqtauin ucqtauni ucqtaiun ucqtainu ucqtaniu ucqtanui
ucqtuain ucqtuani ucqtuian ucqtuina ucqtunia ucqtunai ucqtiuan ucqtiuna ucqtiaun ucqtianu ucqtinau
ucqtinua ucqtnuia ucqtnuai ucqtniua ucqtniau ucqtnaiu ucqtnaui ucunqait ucunqati ucunqiat ucunqita
ucunqtia ucunqtai ucunaqit ucunaqti ucunaiqt ucunaitq ucunatiq ucunatqi ucuniaqt ucuniatq ucuniqat
ucuniqta ucunitqa ucunitaq ucuntaiq ucuntaqi ucuntiaq ucuntiqa ucuntqia ucuntqai ucuqnait ucuqnati
ucuqniat ucuqnita ucuqntia ucuqntai ucuqanit ucuqanti ucuqaint ucuqaitn ucuqatin ucuqatni ucuqiant
ucuqiatn ucuqinat ucuqinta ucuqitna ucuqitan ucuqtain ucuqtani ucuqtian ucuqtina ucuqtnia ucuqtnai
ucuaqnit ucuaqnti ucuaqint ucuaqitn ucuaqtin ucuaqtni ucuanqit ucuanqti ucuaniqt ucuanitq ucuantiq
ucuantqi ucuainqt ucuaintq ucuaiqnt ucuaiqtn ucuaitqn ucuaitnq ucuatniq ucuatnqi ucuatinq ucuatiqn
ucuatqin ucuatqni ucuiqant ucuiqatn ucuiqnat ucuiqnta ucuiqtna ucuiqtan ucuiaqnt ucuiaqtn ucuianqt
ucuiantq ucuiatnq ucuiatqn ucuinaqt ucuinatq ucuinqat ucuinqta ucuintqa ucuintaq ucuitanq ucuitaqn
ucuitnaq ucuitnqa ucuitqna ucuitqan ucutqain ucutqani ucutqian ucutqina ucutqnia ucutqnai ucutaqin
ucutaqni ucutaiqn ucutainq ucutaniq ucutanqi ucutiaqn ucutianq ucutiqan ucutiqna ucutinqa ucutinaq
ucutnaiq ucutnaqi ucutniaq ucutniqa ucutnqia ucutnqai ucinquat ucinquta ucinqaut ucinqatu ucinqtau
ucinqtua ucinuqat ucinuqta ucinuaqt ucinuatq ucinutaq ucinutqa ucinauqt ucinautq ucinaqut ucinaqtu
ucinatqu ucinatuq ucintuaq ucintuqa ucintauq ucintaqu ucintqau ucintqua uciqnuat uciqnuta uciqnaut
uciqnatu uciqntau uciqntua uciqunat uciqunta uciquant uciquatn uciqutan uciqutna uciqaunt uciqautn
uciqanut uciqantu uciqatnu uciqatun uciqtuan uciqtuna uciqtaun uciqtanu uciqtnau uciqtnua uciuqnat
uciuqnta uciuqant uciuqatn uciuqtan uciuqtna uciunqat uciunqta uciunaqt uciunatq uciuntaq uciuntqa
uciuanqt uciuantq uciuaqnt uciuaqtn uciuatqn uciuatnq uciutnaq uciutnqa uciutanq uciutaqn uciutqan
uciutqna uciaqunt uciaqutn uciaqnut uciaqntu uciaqtnu uciaqtun uciauqnt uciauqtn uciaunqt uciauntq
uciautnq uciautqn ucianuqt ucianutq ucianqut ucianqtu uciantqu uciantuq uciatunq uciatuqn uciatnuq
uciatnqu uciatqnu uciatqun ucitquan ucitquna ucitqaun ucitqanu ucitqnau ucitqnua ucituqan ucituqna
ucituaqn ucituanq ucitunaq ucitunqa ucitauqn ucitaunq ucitaqun ucitaqnu ucitanqu ucitanuq ucitnuaq
ucitnuqa ucitnauq ucitnaqu ucitnqau ucitnqua uctnquia uctnquai uctnqiua uctnqiau uctnqaiu uctnqaui
uctnuqia uctnuqai uctnuiqa uctnuiaq uctnuaiq uctnuaqi uctniuqa uctniuaq uctniqua uctniqau uctniaqu
uctniauq uctnauiq uctnauqi uctnaiuq uctnaiqu uctnaqiu uctnaqui uctqnuia uctqnuai uctqniua uctqniau
uctqnaiu uctqnaui uctqunia uctqunai uctquina uctquian uctquain uctquani uctqiuna uctqiuan uctqinua
uctqinau uctqianu uctqiaun uctqauin uctqauni uctqaiun uctqainu uctqaniu uctqanui uctuqnia uctuqnai
uctuqina uctuqian uctuqain uctuqani uctunqia uctunqai uctuniqa uctuniaq uctunaiq uctunaqi uctuinqa
uctuinaq uctuiqna uctuiqan uctuiaqn uctuianq uctuaniq uctuanqi uctuainq uctuaiqn uctuaqin uctuaqni
uctiquna uctiquan uctiqnua uctiqnau uctiqanu uctiqaun uctiuqna uctiuqan uctiunqa uctiunaq uctiuanq
uctiuaqn uctinuqa uctinuaq uctinqua uctinqau uctinaqu uctinauq uctiaunq uctiauqn uctianuq uctianqu
uctiaqnu uctiaqun uctaquin uctaquni uctaqiun uctaqinu uctaqniu uctaqnui uctauqin uctauqni uctauiqn
uctauinq uctauniq uctaunqi uctaiuqn uctaiunq uctaiqun uctaiqnu uctainqu uctainuq uctanuiq uctanuqi
uctaniuq uctaniqu uctanqiu uctanqui uqacnuit uqacnuti uqacniut uqacnitu uqacntiu uqacntui uqacunit
uqacunti uqacuint uqacuitn uqacutin uqacutni uqaciunt uqaciutn uqacinut uqacintu uqacitnu uqacitun
uqactuin uqactuni uqactiun uqactinu uqactniu uqactnui uqancuit uqancuti uqanciut uqancitu uqanctiu
uqanctui uqanucit uqanucti uqanuict uqanuitc uqanutic uqanutci uqaniuct uqaniutc uqanicut uqanictu
uqanitcu uqanituc uqantuic uqantuci uqantiuc uqanticu uqantciu uqantcui uqauncit uqauncti uqaunict
uqaunitc uqauntic uqauntci uqaucnit uqaucnti uqaucint uqaucitn uqauctin uqauctni uqauicnt uqauictn
uqauinct uqauintc uqauitnc uqauitcn uqautcin uqautcni uqauticn uqautinc uqautnic uqautnci uqainuct
uqainutc uqaincut uqainctu uqaintcu uqaintuc uqaiunct uqaiuntc uqaiucnt uqaiuctn uqaiutcn uqaiutnc
uqaicunt uqaicutn uqaicnut uqaicntu uqaictnu uqaictun uqaitucn uqaitunc uqaitcun uqaitcnu uqaitncu
uqaitnuc uqatnuic uqatnuci uqatniuc uqatnicu uqatnciu uqatncui uqatunic uqatunci uqatuinc uqatuicn
uqatucin uqatucni uqatiunc uqatiucn uqatinuc uqatincu uqaticnu uqaticun uqatcuin uqatcuni uqatciun
uqatcinu uqatcniu uqatcnui uqcanuit uqcanuti uqcaniut uqcanitu uqcantiu uqcantui uqcaunit uqcaunti
uqcauint uqcauitn uqcautin uqcautni uqcaiunt uqcaiutn uqcainut uqcaintu uqcaitnu uqcaitun uqcatuin
uqcatuni uqcatiun uqcatinu uqcatniu uqcatnui uqcnauit uqcnauti uqcnaiut uqcnaitu uqcnatiu uqcnatui
uqcnuait uqcnuati uqcnuiat uqcnuita uqcnutia uqcnutai uqcniuat uqcniuta uqcniaut uqcniatu uqcnitau
uqcnitua uqcntuia uqcntuai uqcntiua uqcntiau uqcntaiu uqcntaui uqcunait uqcunati uqcuniat uqcunita
uqcuntia uqcuntai uqcuanit uqcuanti uqcuaint uqcuaitn uqcuatin uqcuatni uqcuiant uqcuiatn uqcuinat
uqcuinta uqcuitna uqcuitan uqcutain uqcutani uqcutian uqcutina uqcutnia uqcutnai uqcinuat uqcinuta
uqcinaut uqcinatu uqcintau uqcintua uqciunat uqciunta uqciuant uqciuatn uqciutan uqciutna uqciaunt
uqciautn uqcianut uqciantu uqciatnu uqciatun uqcituan uqcituna uqcitaun uqcitanu uqcitnau uqcitnua
uqctnuia uqctnuai uqctniua uqctniau uqctnaiu uqctnaui uqctunia uqctunai uqctuina uqctuian uqctuain
uqctuani uqctiuna uqctiuan uqctinua uqctinau uqctianu uqctiaun uqctauin uqctauni uqctaiun uqctainu
uqctaniu uqctanui uqncauit uqncauti uqncaiut uqncaitu uqncatiu uqncatui uqncuait uqncuati uqncuiat
uqncuita uqncutia uqncutai uqnciuat uqnciuta uqnciaut uqnciatu uqncitau uqncitua uqnctuia uqnctuai
uqnctiua uqnctiau uqnctaiu uqnctaui uqnacuit uqnacuti uqnaciut uqnacitu uqnactiu uqnactui uqnaucit
uqnaucti uqnauict uqnauitc uqnautic uqnautci uqnaiuct uqnaiutc uqnaicut uqnaictu uqnaitcu uqnaituc
uqnatuic uqnatuci uqnatiuc uqnaticu uqnatciu uqnatcui uqnuacit uqnuacti uqnuaict uqnuaitc uqnuatic
uqnuatci uqnucait uqnucati uqnuciat uqnucita uqnuctia uqnuctai uqnuicat uqnuicta uqnuiact uqnuiatc
uqnuitac uqnuitca uqnutcia uqnutcai uqnutica uqnutiac uqnutaic uqnutaci uqniauct uqniautc uqniacut
uqniactu uqniatcu uqniatuc uqniuact uqniuatc uqniucat uqniucta uqniutca uqniutac uqnicuat uqnicuta
uqnicaut uqnicatu uqnictau uqnictua uqnituca uqnituac uqnitcua uqnitcau uqnitacu uqnitauc uqntauic
uqntauci uqntaiuc uqntaicu uqntaciu uqntacui uqntuaic uqntuaci uqntuiac uqntuica uqntucia uqntucai
uqntiuac uqntiuca uqntiauc uqntiacu uqnticau uqnticua uqntcuia uqntcuai uqntciua uqntciau uqntcaiu
uqntcaui uqucnait uqucnati uqucniat uqucnita uqucntia uqucntai uqucanit uqucanti uqucaint uqucaitn
uqucatin uqucatni uquciant uquciatn uqucinat uqucinta uqucitna uqucitan uquctain uquctani uquctian
uquctina uquctnia uquctnai uquncait uquncati uqunciat uquncita uqunctia uqunctai uqunacit uqunacti
uqunaict uqunaitc uqunatic uqunatci uquniact uquniatc uqunicat uqunicta uqunitca uqunitac uquntaic
uquntaci uquntiac uquntica uquntcia uquntcai uquancit uquancti uquanict uquanitc uquantic uquantci
uquacnit uquacnti uquacint uquacitn uquactin uquactni uquaicnt uquaictn uquainct uquaintc uquaitnc
uquaitcn uquatcin uquatcni uquaticn uquatinc uquatnic uquatnci uquinact uquinatc uquincat uquincta
uquintca uquintac uquianct uquiantc uquiacnt uquiactn uquiatcn uquiatnc uquicant uquicatn uquicnat
uquicnta uquictna uquictan uquitacn uquitanc uquitcan uquitcna uquitnca uquitnac uqutnaic uqutnaci
uqutniac uqutnica uqutncia uqutncai uqutanic uqutanci uqutainc uqutaicn uqutacin uqutacni uqutianc
uqutiacn uqutinac uqutinca uquticna uqutican uqutcain uqutcani uqutcian uqutcina uqutcnia uqutcnai
uqicnuat uqicnuta uqicnaut uqicnatu uqicntau uqicntua uqicunat uqicunta uqicuant uqicuatn uqicutan
uqicutna uqicaunt uqicautn uqicanut uqicantu uqicatnu uqicatun uqictuan uqictuna uqictaun uqictanu
uqictnau uqictnua uqincuat uqincuta uqincaut uqincatu uqinctau uqinctua uqinucat uqinucta uqinuact
uqinuatc uqinutac uqinutca uqinauct uqinautc uqinacut uqinactu uqinatcu uqinatuc uqintuac uqintuca
uqintauc uqintacu uqintcau uqintcua uqiuncat uqiuncta uqiunact uqiunatc uqiuntac uqiuntca uqiucnat
uqiucnta uqiucant uqiucatn uqiuctan uqiuctna uqiuacnt uqiuactn uqiuanct uqiuantc uqiuatnc uqiuatcn
uqiutcan uqiutcna uqiutacn uqiutanc uqiutnac uqiutnca uqianuct uqianutc uqiancut uqianctu uqiantcu
uqiantuc uqiaunct uqiauntc uqiaucnt uqiauctn uqiautcn uqiautnc uqiacunt uqiacutn uqiacnut uqiacntu
uqiactnu uqiactun uqiatucn uqiatunc uqiatcun uqiatcnu uqiatncu uqiatnuc uqitnuac uqitnuca uqitnauc
uqitnacu uqitncau uqitncua uqitunac uqitunca uqituanc uqituacn uqitucan uqitucna uqitaunc uqitaucn
uqitanuc uqitancu uqitacnu uqitacun uqitcuan uqitcuna uqitcaun uqitcanu uqitcnau uqitcnua uqtcnuia
uqtcnuai uqtcniua uqtcniau uqtcnaiu uqtcnaui uqtcunia uqtcunai uqtcuina uqtcuian uqtcuain uqtcuani
uqtciuna uqtciuan uqtcinua uqtcinau uqtcianu uqtciaun uqtcauin uqtcauni uqtcaiun uqtcainu uqtcaniu
uqtcanui uqtncuia uqtncuai uqtnciua uqtnciau uqtncaiu uqtncaui uqtnucia uqtnucai uqtnuica uqtnuiac
uqtnuaic uqtnuaci uqtniuca uqtniuac uqtnicua uqtnicau uqtniacu uqtniauc uqtnauic uqtnauci uqtnaiuc
uqtnaicu uqtnaciu uqtnacui uqtuncia uqtuncai uqtunica uqtuniac uqtunaic uqtunaci uqtucnia uqtucnai
uqtucina uqtucian uqtucain uqtucani uqtuicna uqtuican uqtuinca uqtuinac uqtuianc uqtuiacn uqtuacin
uqtuacni uqtuaicn uqtuainc uqtuanic uqtuanci uqtinuca uqtinuac uqtincua uqtincau uqtinacu uqtinauc
uqtiunca uqtiunac uqtiucna uqtiucan uqtiuacn uqtiuanc uqticuna uqticuan uqticnua uqticnau uqticanu
uqticaun uqtiaucn uqtiaunc uqtiacun uqtiacnu uqtiancu uqtianuc uqtanuic uqtanuci uqtaniuc uqtanicu
uqtanciu uqtancui uqtaunic uqtaunci uqtauinc uqtauicn uqtaucin uqtaucni uqtaiunc uqtaiucn uqtainuc
uqtaincu uqtaicnu uqtaicun uqtacuin uqtacuni uqtaciun uqtacinu uqtacniu uqtacnui uuacqnit uuacqnti
uuacqint uuacqitn uuacqtin uuacqtni uuacnqit uuacnqti uuacniqt uuacnitq uuacntiq uuacntqi uuacinqt
uuacintq uuaciqnt uuaciqtn uuacitqn uuacitnq uuactniq uuactnqi uuactinq uuactiqn uuactqin uuactqni
uuaqcnit uuaqcnti uuaqcint uuaqcitn uuaqctin uuaqctni uuaqncit uuaqncti uuaqnict uuaqnitc uuaqntic
uuaqntci uuaqinct uuaqintc uuaqicnt uuaqictn uuaqitcn uuaqitnc uuaqtnic uuaqtnci uuaqtinc uuaqticn
uuaqtcin uuaqtcni uuanqcit uuanqcti uuanqict uuanqitc uuanqtic uuanqtci uuancqit uuancqti uuanciqt
uuancitq uuanctiq uuanctqi uuanicqt uuanictq uuaniqct uuaniqtc uuanitqc uuanitcq uuantciq uuantcqi
uuanticq uuantiqc uuantqic uuantqci uuaiqnct uuaiqntc uuaiqcnt uuaiqctn uuaiqtcn uuaiqtnc uuainqct
uuainqtc uuaincqt uuainctq uuaintcq uuaintqc uuaicnqt uuaicntq uuaicqnt uuaicqtn uuaictqn uuaictnq
uuaitncq uuaitnqc uuaitcnq uuaitcqn uuaitqcn uuaitqnc uuatqnic uuatqnci uuatqinc uuatqicn uuatqcin
uuatqcni uuatnqic uuatnqci uuatniqc uuatnicq uuatnciq uuatncqi uuatinqc uuatincq uuatiqnc uuatiqcn
uuaticqn uuaticnq uuatcniq uuatcnqi uuatcinq uuatciqn uuatcqin uuatcqni uucaqnit uucaqnti uucaqint
uucaqitn uucaqtin uucaqtni uucanqit uucanqti uucaniqt uucanitq uucantiq uucantqi uucainqt uucaintq
uucaiqnt uucaiqtn uucaitqn uucaitnq uucatniq uucatnqi uucatinq uucatiqn uucatqin uucatqni uucqanit
uucqanti uucqaint uucqaitn uucqatin uucqatni uucqnait uucqnati uucqniat uucqnita uucqntia uucqntai
uucqinat uucqinta uucqiant uucqiatn uucqitan uucqitna uucqtnia uucqtnai uucqtina uucqtian uucqtain
uucqtani uucnqait uucnqati uucnqiat uucnqita uucnqtia uucnqtai uucnaqit uucnaqti uucnaiqt uucnaitq
uucnatiq uucnatqi uucniaqt uucniatq uucniqat uucniqta uucnitqa uucnitaq uucntaiq uucntaqi uucntiaq
uucntiqa uucntqia uucntqai uuciqnat uuciqnta uuciqant uuciqatn uuciqtan uuciqtna uucinqat uucinqta
uucinaqt uucinatq uucintaq uucintqa uucianqt uuciantq uuciaqnt uuciaqtn uuciatqn uuciatnq uucitnaq
uucitnqa uucitanq uucitaqn uucitqan uucitqna uuctqnia uuctqnai uuctqina uuctqian uuctqain uuctqani
uuctnqia uuctnqai uuctniqa uuctniaq uuctnaiq uuctnaqi uuctinqa uuctinaq uuctiqna uuctiqan uuctiaqn
uuctianq uuctaniq uuctanqi uuctainq uuctaiqn uuctaqin uuctaqni uuqcanit uuqcanti uuqcaint uuqcaitn
uuqcatin uuqcatni uuqcnait uuqcnati uuqcniat uuqcnita uuqcntia uuqcntai uuqcinat uuqcinta uuqciant
uuqciatn uuqcitan uuqcitna uuqctnia uuqctnai uuqctina uuqctian uuqctain uuqctani uuqacnit uuqacnti
uuqacint uuqacitn uuqactin uuqactni uuqancit uuqancti uuqanict uuqanitc uuqantic uuqantci uuqainct
uuqaintc uuqaicnt uuqaictn uuqaitcn uuqaitnc uuqatnic uuqatnci uuqatinc uuqaticn uuqatcin uuqatcni
uuqnacit uuqnacti uuqnaict uuqnaitc uuqnatic uuqnatci uuqncait uuqncati uuqnciat uuqncita uuqnctia
uuqnctai uuqnicat uuqnicta uuqniact uuqniatc uuqnitac uuqnitca uuqntcia uuqntcai uuqntica uuqntiac
uuqntaic uuqntaci uuqianct uuqiantc uuqiacnt uuqiactn uuqiatcn uuqiatnc uuqinact uuqinatc uuqincat
uuqincta uuqintca uuqintac uuqicnat uuqicnta uuqicant uuqicatn uuqictan uuqictna uuqitnca uuqitnac
uuqitcna uuqitcan uuqitacn uuqitanc uuqtanic uuqtanci uuqtainc uuqtaicn uuqtacin uuqtacni uuqtnaic
uuqtnaci uuqtniac uuqtnica uuqtncia uuqtncai uuqtinac uuqtinca uuqtianc uuqtiacn uuqtican uuqticna
uuqtcnia uuqtcnai uuqtcina uuqtcian uuqtcain uuqtcani uuncqait uuncqati uuncqiat uuncqita uuncqtia
uuncqtai uuncaqit uuncaqti uuncaiqt uuncaitq uuncatiq uuncatqi uunciaqt uunciatq uunciqat uunciqta
uuncitqa uuncitaq uunctaiq uunctaqi uunctiaq uunctiqa uunctqia uunctqai uunqcait uunqcati uunqciat
uunqcita uunqctia uunqctai uunqacit uunqacti uunqaict uunqaitc uunqatic uunqatci uunqiact uunqiatc
uunqicat uunqicta uunqitca uunqitac uunqtaic uunqtaci uunqtiac uunqtica uunqtcia uunqtcai uunaqcit
uunaqcti uunaqict uunaqitc uunaqtic uunaqtci uunacqit uunacqti uunaciqt uunacitq uunactiq uunactqi
uunaicqt uunaictq uunaiqct uunaiqtc uunaitqc uunaitcq uunatciq uunatcqi uunaticq uunatiqc uunatqic
uunatqci uuniqact uuniqatc uuniqcat uuniqcta uuniqtca uuniqtac uuniaqct uuniaqtc uuniacqt uuniactq
uuniatcq uuniatqc uunicaqt uunicatq uunicqat uunicqta uunictqa uunictaq uunitacq uunitaqc uunitcaq
uunitcqa uunitqca uunitqac uuntqaic uuntqaci uuntqiac uuntqica uuntqcia uuntqcai uuntaqic uuntaqci
uuntaiqc uuntaicq uuntaciq uuntacqi uuntiaqc uuntiacq uuntiqac uuntiqca uunticqa uunticaq uuntcaiq
uuntcaqi uuntciaq uuntciqa uuntcqia uuntcqai uuicqnat uuicqnta uuicqant uuicqatn uuicqtan uuicqtna
uuicnqat uuicnqta uuicnaqt uuicnatq uuicntaq uuicntqa uuicanqt uuicantq uuicaqnt uuicaqtn uuicatqn
uuicatnq uuictnaq uuictnqa uuictanq uuictaqn uuictqan uuictqna uuiqcnat uuiqcnta uuiqcant uuiqcatn
uuiqctan uuiqctna uuiqncat uuiqncta uuiqnact uuiqnatc uuiqntac uuiqntca uuiqanct uuiqantc uuiqacnt
uuiqactn uuiqatcn uuiqatnc uuiqtnac uuiqtnca uuiqtanc uuiqtacn uuiqtcan uuiqtcna uuinqcat uuinqcta
uuinqact uuinqatc uuinqtac uuinqtca uuincqat uuincqta uuincaqt uuincatq uuinctaq uuinctqa uuinacqt
uuinactq uuinaqct uuinaqtc uuinatqc uuinatcq uuintcaq uuintcqa uuintacq uuintaqc uuintqac uuintqca
uuiaqnct uuiaqntc uuiaqcnt uuiaqctn uuiaqtcn uuiaqtnc uuianqct uuianqtc uuiancqt uuianctq uuiantcq
uuiantqc uuiacnqt uuiacntq uuiacqnt uuiacqtn uuiactqn uuiactnq uuiatncq uuiatnqc uuiatcnq uuiatcqn
uuiatqcn uuiatqnc uuitqnac uuitqnca uuitqanc uuitqacn uuitqcan uuitqcna uuitnqac uuitnqca uuitnaqc
uuitnacq uuitncaq uuitncqa uuitanqc uuitancq uuitaqnc uuitaqcn uuitacqn uuitacnq uuitcnaq uuitcnqa
uuitcanq uuitcaqn uuitcqan uuitcqna uutcqnia uutcqnai uutcqina uutcqian uutcqain uutcqani uutcnqia
uutcnqai uutcniqa uutcniaq uutcnaiq uutcnaqi uutcinqa uutcinaq uutciqna uutciqan uutciaqn uutcianq
uutcaniq uutcanqi uutcainq uutcaiqn uutcaqin uutcaqni uutqcnia uutqcnai uutqcina uutqcian uutqcain
uutqcani uutqncia uutqncai uutqnica uutqniac uutqnaic uutqnaci uutqinca uutqinac uutqicna uutqican
uutqiacn uutqianc uutqanic uutqanci uutqainc uutqaicn uutqacin uutqacni uutnqcia uutnqcai uutnqica
uutnqiac uutnqaic uutnqaci uutncqia uutncqai uutnciqa uutnciaq uutncaiq uutncaqi uutnicqa uutnicaq
uutniqca uutniqac uutniaqc uutniacq uutnaciq uutnacqi uutnaicq uutnaiqc uutnaqic uutnaqci uutiqnca
uutiqnac uutiqcna uutiqcan uutiqacn uutiqanc uutinqca uutinqac uutincqa uutincaq uutinacq uutinaqc
uuticnqa uuticnaq uuticqna uuticqan uuticaqn uuticanq uutiancq uutianqc uutiacnq uutiacqn uutiaqcn
uutiaqnc uutaqnic uutaqnci uutaqinc uutaqicn uutaqcin uutaqcni uutanqic uutanqci uutaniqc uutanicq
uutanciq uutancqi uutainqc uutaincq uutaiqnc uutaiqcn uutaicqn uutaicnq uutacniq uutacnqi uutacinq
uutaciqn uutacqin uutacqni uiacqunt uiacqutn uiacqnut uiacqntu uiacqtnu uiacqtun uiacuqnt uiacuqtn
uiacunqt uiacuntq uiacutnq uiacutqn uiacnuqt uiacnutq uiacnqut uiacnqtu uiacntqu uiacntuq uiactunq
uiactuqn uiactnuq uiactnqu uiactqnu uiactqun uiaqcunt uiaqcutn uiaqcnut uiaqcntu uiaqctnu uiaqctun
uiaqucnt uiaquctn uiaqunct uiaquntc uiaqutnc uiaqutcn uiaqnuct uiaqnutc uiaqncut uiaqnctu uiaqntcu
uiaqntuc uiaqtunc uiaqtucn uiaqtnuc uiaqtncu uiaqtcnu uiaqtcun uiauqcnt uiauqctn uiauqnct uiauqntc
uiauqtnc uiauqtcn uiaucqnt uiaucqtn uiaucnqt uiaucntq uiauctnq uiauctqn uiauncqt uiaunctq uiaunqct
uiaunqtc uiauntqc uiauntcq uiautcnq uiautcqn uiautncq uiautnqc uiautqnc uiautqcn uianquct uianqutc
uianqcut uianqctu uianqtcu uianqtuc uianuqct uianuqtc uianucqt uianuctq uianutcq uianutqc uiancuqt
uiancutq uiancqut uiancqtu uianctqu uianctuq uiantucq uiantuqc uiantcuq uiantcqu uiantqcu uiantquc
uiatqunc uiatqucn uiatqnuc uiatqncu uiatqcnu uiatqcun uiatuqnc uiatuqcn uiatunqc uiatuncq uiatucnq
uiatucqn uiatnuqc uiatnucq uiatnquc uiatnqcu uiatncqu uiatncuq uiatcunq uiatcuqn uiatcnuq uiatcnqu
uiatcqnu uiatcqun uicaqunt uicaqutn uicaqnut uicaqntu uicaqtnu uicaqtun uicauqnt uicauqtn uicaunqt
uicauntq uicautnq uicautqn uicanuqt uicanutq uicanqut uicanqtu uicantqu uicantuq uicatunq uicatuqn
uicatnuq uicatnqu uicatqnu uicatqun uicqaunt uicqautn uicqanut uicqantu uicqatnu uicqatun uicquant
uicquatn uicqunat uicqunta uicqutna uicqutan uicqnuat uicqnuta uicqnaut uicqnatu uicqntau uicqntua
uicqtuna uicqtuan uicqtnua uicqtnau uicqtanu uicqtaun uicuqant uicuqatn uicuqnat uicuqnta uicuqtna
uicuqtan uicuaqnt uicuaqtn uicuanqt uicuantq uicuatnq uicuatqn uicunaqt uicunatq uicunqat uicunqta
uicuntqa uicuntaq uicutanq uicutaqn uicutnaq uicutnqa uicutqna uicutqan uicnquat uicnquta uicnqaut
uicnqatu uicnqtau uicnqtua uicnuqat uicnuqta uicnuaqt uicnuatq uicnutaq uicnutqa uicnauqt uicnautq
uicnaqut uicnaqtu uicnatqu uicnatuq uicntuaq uicntuqa uicntauq uicntaqu uicntqau uicntqua uictquna
uictquan uictqnua uictqnau uictqanu uictqaun uictuqna uictuqan uictunqa uictunaq uictuanq uictuaqn
uictnuqa uictnuaq uictnqua uictnqau uictnaqu uictnauq uictaunq uictauqn uictanuq uictanqu uictaqnu
uictaqun uiqcaunt uiqcautn uiqcanut uiqcantu uiqcatnu uiqcatun uiqcuant uiqcuatn uiqcunat uiqcunta
uiqcutna uiqcutan uiqcnuat uiqcnuta uiqcnaut uiqcnatu uiqcntau uiqcntua uiqctuna uiqctuan uiqctnua
uiqctnau uiqctanu uiqctaun uiqacunt uiqacutn uiqacnut uiqacntu uiqactnu uiqactun uiqaucnt uiqauctn
uiqaunct uiqauntc uiqautnc uiqautcn uiqanuct uiqanutc uiqancut uiqanctu uiqantcu uiqantuc uiqatunc
uiqatucn uiqatnuc uiqatncu uiqatcnu uiqatcun uiquacnt uiquactn uiquanct uiquantc uiquatnc uiquatcn
uiqucant uiqucatn uiqucnat uiqucnta uiquctna uiquctan uiquncat uiquncta uiqunact uiqunatc uiquntac
uiquntca uiqutcna uiqutcan uiqutnca uiqutnac uiqutanc uiqutacn uiqnauct uiqnautc uiqnacut uiqnactu
uiqnatcu uiqnatuc uiqnuact uiqnuatc uiqnucat uiqnucta uiqnutca uiqnutac uiqncuat uiqncuta uiqncaut
uiqncatu uiqnctau uiqnctua uiqntuca uiqntuac uiqntcua uiqntcau uiqntacu uiqntauc uiqtaunc uiqtaucn
uiqtanuc uiqtancu uiqtacnu uiqtacun uiqtuanc uiqtuacn uiqtunac uiqtunca uiqtucna uiqtucan uiqtnuac
uiqtnuca uiqtnauc uiqtnacu uiqtncau uiqtncua uiqtcuna uiqtcuan uiqtcnua uiqtcnau uiqtcanu uiqtcaun
uiucqant uiucqatn uiucqnat uiucqnta uiucqtna uiucqtan uiucaqnt uiucaqtn uiucanqt uiucantq uiucatnq
uiucatqn uiucnaqt uiucnatq uiucnqat uiucnqta uiucntqa uiucntaq uiuctanq uiuctaqn uiuctnaq uiuctnqa
uiuctqna uiuctqan uiuqcant uiuqcatn uiuqcnat uiuqcnta uiuqctna uiuqctan uiuqacnt uiuqactn uiuqanct
uiuqantc uiuqatnc uiuqatcn uiuqnact uiuqnatc uiuqncat uiuqncta uiuqntca uiuqntac uiuqtanc uiuqtacn
uiuqtnac uiuqtnca uiuqtcna uiuqtcan uiuaqcnt uiuaqctn uiuaqnct uiuaqntc uiuaqtnc uiuaqtcn uiuacqnt
uiuacqtn uiuacnqt uiuacntq uiuactnq uiuactqn uiuancqt uiuanctq uiuanqct uiuanqtc uiuantqc uiuantcq
uiuatcnq uiuatcqn uiuatncq uiuatnqc uiuatqnc uiuatqcn uiunqact uiunqatc uiunqcat uiunqcta uiunqtca
uiunqtac uiunaqct uiunaqtc uiunacqt uiunactq uiunatcq uiunatqc uiuncaqt uiuncatq uiuncqat uiuncqta
uiunctqa uiunctaq uiuntacq uiuntaqc uiuntcaq uiuntcqa uiuntqca uiuntqac uiutqanc uiutqacn uiutqnac
uiutqnca uiutqcna uiutqcan uiutaqnc uiutaqcn uiutanqc uiutancq uiutacnq uiutacqn uiutnaqc uiutnacq
uiutnqac uiutnqca uiutncqa uiutncaq uiutcanq uiutcaqn uiutcnaq uiutcnqa uiutcqna uiutcqan uincquat
uincquta uincqaut uincqatu uincqtau uincqtua uincuqat uincuqta uincuaqt uincuatq uincutaq uincutqa
uincauqt uincautq uincaqut uincaqtu uincatqu uincatuq uinctuaq uinctuqa uinctauq uinctaqu uinctqau
uinctqua uinqcuat uinqcuta uinqcaut uinqcatu uinqctau uinqctua uinqucat uinqucta uinquact uinquatc
uinqutac uinqutca uinqauct uinqautc uinqacut uinqactu uinqatcu uinqatuc uinqtuac uinqtuca uinqtauc
uinqtacu uinqtcau uinqtcua uinuqcat uinuqcta uinuqact uinuqatc uinuqtac uinuqtca uinucqat uinucqta
uinucaqt uinucatq uinuctaq uinuctqa uinuacqt uinuactq uinuaqct uinuaqtc uinuatqc uinuatcq uinutcaq
uinutcqa uinutacq uinutaqc uinutqac uinutqca uinaquct uinaqutc uinaqcut uinaqctu uinaqtcu uinaqtuc
uinauqct uinauqtc uinaucqt uinauctq uinautcq uinautqc uinacuqt uinacutq uinacqut uinacqtu uinactqu
uinactuq uinatucq uinatuqc uinatcuq uinatcqu uinatqcu uinatquc uintquac uintquca uintqauc uintqacu
uintqcau uintqcua uintuqac uintuqca uintuaqc uintuacq uintucaq uintucqa uintauqc uintaucq uintaquc
uintaqcu uintacqu uintacuq uintcuaq uintcuqa uintcauq uintcaqu uintcqau uintcqua uitcquna uitcquan
uitcqnua uitcqnau uitcqanu uitcqaun uitcuqna uitcuqan uitcunqa uitcunaq uitcuanq uitcuaqn uitcnuqa
uitcnuaq uitcnqua uitcnqau uitcnaqu uitcnauq uitcaunq uitcauqn uitcanuq uitcanqu uitcaqnu uitcaqun
uitqcuna uitqcuan uitqcnua uitqcnau uitqcanu uitqcaun uitqucna uitqucan uitqunca uitqunac uitquanc
uitquacn uitqnuca uitqnuac uitqncua uitqncau uitqnacu uitqnauc uitqaunc uitqaucn uitqanuc uitqancu
uitqacnu uitqacun uituqcna uituqcan uituqnca uituqnac uituqanc uituqacn uitucqna uitucqan uitucnqa
uitucnaq uitucanq uitucaqn uituncqa uituncaq uitunqca uitunqac uitunaqc uitunacq uituacnq uituacqn
uituancq uituanqc uituaqnc uituaqcn uitnquca uitnquac uitnqcua uitnqcau uitnqacu uitnqauc uitnuqca
uitnuqac uitnucqa uitnucaq uitnuacq uitnuaqc uitncuqa uitncuaq uitncqua uitncqau uitncaqu uitncauq
uitnaucq uitnauqc uitnacuq uitnacqu uitnaqcu uitnaquc uitaqunc uitaqucn uitaqnuc uitaqncu uitaqcnu
uitaqcun uitauqnc uitauqcn uitaunqc uitauncq uitaucnq uitaucqn uitanuqc uitanucq uitanquc uitanqcu
uitancqu uitancuq uitacunq uitacuqn uitacnuq uitacnqu uitacqnu uitacqun utacquin utacquni utacqiun
utacqinu utacqniu utacqnui utacuqin utacuqni utacuiqn utacuinq utacuniq utacunqi utaciuqn utaciunq
utaciqun utaciqnu utacinqu utacinuq utacnuiq utacnuqi utacniuq utacniqu utacnqiu utacnqui utaqcuin
utaqcuni utaqciun utaqcinu utaqcniu utaqcnui utaqucin utaqucni utaquicn utaquinc utaqunic utaqunci
utaqiucn utaqiunc utaqicun utaqicnu utaqincu utaqinuc utaqnuic utaqnuci utaqniuc utaqnicu utaqnciu
utaqncui utauqcin utauqcni utauqicn utauqinc utauqnic utauqnci utaucqin utaucqni utauciqn utaucinq
utaucniq utaucnqi utauicqn utauicnq utauiqcn utauiqnc utauinqc utauincq utaunciq utauncqi utaunicq
utauniqc utaunqic utaunqci utaiqucn utaiqunc utaiqcun utaiqcnu utaiqncu utaiqnuc utaiuqcn utaiuqnc
utaiucqn utaiucnq utaiuncq utaiunqc utaicuqn utaicunq utaicqun utaicqnu utaicnqu utaicnuq utainucq
utainuqc utaincuq utaincqu utainqcu utainquc utanquic utanquci utanqiuc utanqicu utanqciu utanqcui
utanuqic utanuqci utanuiqc utanuicq utanuciq utanucqi utaniuqc utaniucq utaniquc utaniqcu utanicqu
utanicuq utancuiq utancuqi utanciuq utanciqu utancqiu utancqui utcaquin utcaquni utcaqiun utcaqinu
utcaqniu utcaqnui utcauqin utcauqni utcauiqn utcauinq utcauniq utcaunqi utcaiuqn utcaiunq utcaiqun
utcaiqnu utcainqu utcainuq utcanuiq utcanuqi utcaniuq utcaniqu utcanqiu utcanqui utcqauin utcqauni
utcqaiun utcqainu utcqaniu utcqanui utcquain utcquani utcquian utcquina utcqunia utcqunai utcqiuan
utcqiuna utcqiaun utcqianu utcqinau utcqinua utcqnuia utcqnuai utcqniua utcqniau utcqnaiu utcqnaui
utcuqain utcuqani utcuqian utcuqina utcuqnia utcuqnai utcuaqin utcuaqni utcuaiqn utcuainq utcuaniq
utcuanqi utcuiaqn utcuianq utcuiqan utcuiqna utcuinqa utcuinaq utcunaiq utcunaqi utcuniaq utcuniqa
utcunqia utcunqai utciquan utciquna utciqaun utciqanu utciqnau utciqnua utciuqan utciuqna utciuaqn
utciuanq utciunaq utciunqa utciauqn utciaunq utciaqun utciaqnu utcianqu utcianuq utcinuaq utcinuqa
utcinauq utcinaqu utcinqau utcinqua utcnquia utcnquai utcnqiua utcnqiau utcnqaiu utcnqaui utcnuqia
utcnuqai utcnuiqa utcnuiaq utcnuaiq utcnuaqi utcniuqa utcniuaq utcniqua utcniqau utcniaqu utcniauq
utcnauiq utcnauqi utcnaiuq utcnaiqu utcnaqiu utcnaqui utqcauin utqcauni utqcaiun utqcainu utqcaniu
utqcanui utqcuain utqcuani utqcuian utqcuina utqcunia utqcunai utqciuan utqciuna utqciaun utqcianu
utqcinau utqcinua utqcnuia utqcnuai utqcniua utqcniau utqcnaiu utqcnaui utqacuin utqacuni utqaciun
utqacinu utqacniu utqacnui utqaucin utqaucni utqauicn utqauinc utqaunic utqaunci utqaiucn utqaiunc
utqaicun utqaicnu utqaincu utqainuc utqanuic utqanuci utqaniuc utqanicu utqanciu utqancui utquacin
utquacni utquaicn utquainc utquanic utquanci utqucain utqucani utqucian utqucina utqucnia utqucnai
utquican utquicna utquiacn utquianc utquinac utquinca utquncia utquncai utqunica utquniac utqunaic
utqunaci utqiaucn utqiaunc utqiacun utqiacnu utqiancu utqianuc utqiuacn utqiuanc utqiucan utqiucna
utqiunca utqiunac utqicuan utqicuna utqicaun utqicanu utqicnau utqicnua utqinuca utqinuac utqincua
utqincau utqinacu utqinauc utqnauic utqnauci utqnaiuc utqnaicu utqnaciu utqnacui utqnuaic utqnuaci
utqnuiac utqnuica utqnucia utqnucai utqniuac utqniuca utqniauc utqniacu utqnicau utqnicua utqncuia
utqncuai utqnciua utqnciau utqncaiu utqncaui utucqain utucqani utucqian utucqina utucqnia utucqnai
utucaqin utucaqni utucaiqn utucainq utucaniq utucanqi utuciaqn utucianq utuciqan utuciqna utucinqa
utucinaq utucnaiq utucnaqi utucniaq utucniqa utucnqia utucnqai utuqcain utuqcani utuqcian utuqcina
utuqcnia utuqcnai utuqacin utuqacni utuqaicn utuqainc utuqanic utuqanci utuqiacn utuqianc utuqican
utuqicna utuqinca utuqinac utuqnaic utuqnaci utuqniac utuqnica utuqncia utuqncai utuaqcin utuaqcni
utuaqicn utuaqinc utuaqnic utuaqnci utuacqin utuacqni utuaciqn utuacinq utuacniq utuacnqi utuaicqn
utuaicnq utuaiqcn utuaiqnc utuainqc utuaincq utuanciq utuancqi utuanicq utuaniqc utuanqic utuanqci
utuiqacn utuiqanc utuiqcan utuiqcna utuiqnca utuiqnac utuiaqcn utuiaqnc utuiacqn utuiacnq utuiancq
utuianqc utuicaqn utuicanq utuicqan utuicqna utuicnqa utuicnaq utuinacq utuinaqc utuincaq utuincqa
utuinqca utuinqac utunqaic utunqaci utunqiac utunqica utunqcia utunqcai utunaqic utunaqci utunaiqc
utunaicq utunaciq utunacqi utuniaqc utuniacq utuniqac utuniqca utunicqa utunicaq utuncaiq utuncaqi
utunciaq utunciqa utuncqia utuncqai uticquan uticquna uticqaun uticqanu uticqnau uticqnua uticuqan
uticuqna uticuaqn uticuanq uticunaq uticunqa uticauqn uticaunq uticaqun uticaqnu uticanqu uticanuq
uticnuaq uticnuqa uticnauq uticnaqu uticnqau uticnqua utiqcuan utiqcuna utiqcaun utiqcanu utiqcnau
utiqcnua utiqucan utiqucna utiquacn utiquanc utiqunac utiqunca utiqaucn utiqaunc utiqacun utiqacnu
utiqancu utiqanuc utiqnuac utiqnuca utiqnauc utiqnacu utiqncau utiqncua utiuqcan utiuqcna utiuqacn
utiuqanc utiuqnac utiuqnca utiucqan utiucqna utiucaqn utiucanq utiucnaq utiucnqa utiuacqn utiuacnq
utiuaqcn utiuaqnc utiuanqc utiuancq utiuncaq utiuncqa utiunacq utiunaqc utiunqac utiunqca utiaqucn
utiaqunc utiaqcun utiaqcnu utiaqncu utiaqnuc utiauqcn utiauqnc utiaucqn utiaucnq utiauncq utiaunqc
utiacuqn utiacunq utiacqun utiacqnu utiacnqu utiacnuq utianucq utianuqc utiancuq utiancqu utianqcu
utianquc utinquac utinquca utinqauc utinqacu utinqcau utinqcua utinuqac utinuqca utinuaqc utinuacq
utinucaq utinucqa utinauqc utinaucq utinaquc utinaqcu utinacqu utinacuq utincuaq utincuqa utincauq
utincaqu utincqau utincqua utncquia utncquai utncqiua utncqiau utncqaiu utncqaui utncuqia utncuqai
utncuiqa utncuiaq utncuaiq utncuaqi utnciuqa utnciuaq utnciqua utnciqau utnciaqu utnciauq utncauiq
utncauqi utncaiuq utncaiqu utncaqiu utncaqui utnqcuia utnqcuai utnqciua utnqciau utnqcaiu utnqcaui
utnqucia utnqucai utnquica utnquiac utnquaic utnquaci utnqiuca utnqiuac utnqicua utnqicau utnqiacu
utnqiauc utnqauic utnqauci utnqaiuc utnqaicu utnqaciu utnqacui utnuqcia utnuqcai utnuqica utnuqiac
utnuqaic utnuqaci utnucqia utnucqai utnuciqa utnuciaq utnucaiq utnucaqi utnuicqa utnuicaq utnuiqca
utnuiqac utnuiaqc utnuiacq utnuaciq utnuacqi utnuaicq utnuaiqc utnuaqic utnuaqci utniquca utniquac
utniqcua utniqcau utniqacu utniqauc utniuqca utniuqac utniucqa utniucaq utniuacq utniuaqc utnicuqa
utnicuaq utnicqua utnicqau utnicaqu utnicauq utniaucq utniauqc utniacuq utniacqu utniaqcu utniaquc
utnaquic utnaquci utnaqiuc utnaqicu utnaqciu utnaqcui utnauqic utnauqci utnauiqc utnauicq utnauciq
utnaucqi utnaiuqc utnaiucq utnaiquc utnaiqcu utnaicqu utnaicuq utnacuiq utnacuqi utnaciuq utnaciqu
utnacqiu utnacqui

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us