easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

zawose

monogamian

salone

witnessfortheprosecution

unoceanic

wifie

wipawadee

zaloris

zeuxian

pizero

unmachinable

wuchereria

variolation

zeugmatography

zoothome

yamatos

unfluvial

enrobes


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: ullumque
cipher variations:
vmmvnrvf wnnwoswg xooxptxh yppyquyi zqqzrvzj
arraswak bssbtxbl cttcuycm duudvzdn evvewaeo
fwwfxbfp gxxgycgq hyyhzdhr izziaeis jaajbfjt
kbbkcgku lccldhlv mddmeimw neenfjnx offogkoy
pggphlpz qhhqimqa riirjnrb sjjskosc tkktlptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: ullumque
Cipher: foofnjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: ullumque
Cipher: BAABB ABABA ABABA BAABB ABABB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: ullumque
cipher variations:
vmmvnrvfjiijlxjnxeexjdxvlaalhjldzwwzfpzlnssndvntpkkpzhpjdggdxndr
rccrvtrzfyyftzfhtuutrftphqqhplhxwnnwoswgkjjkmykoyffykeywmbbmikme
axxagqamottoewouqllqaiqkehheyoessddswusagzzguagiuvvusguqirriqmiy
xooxptxhlkklnzlpzggzlfzxnccnjlnfbyybhrbnpuupfxpvrmmrbjrlfiifzpft
teetxvtbhaahvbhjvwwvthvrjssjrnjzyppyquyimllmoamqahhamgayoddokmog
czzciscoqvvqgyqwsnnscksmgjjgaqguuffuywucibbiwcikwxxwuiwskttksoka
zqqzrvzjnmmnpbnrbiibnhbzpeeplnphdaadjtdprwwrhzrxtootdltnhkkhbrhv
vggvzxvdjccjxdjlxyyxvjxtluultplbarraswakonnoqcoscjjcoicaqffqmoqi
ebbekueqsxxsiasyuppuemuoillicsiwwhhwaywekddkyekmyzzywkyumvvmuqmc
bssbtxblpooprdptdkkdpjdbrggrnprjfccflvfrtyytjbtzvqqvfnvpjmmjdtjx
xiixbzxfleelzflnzaazxlzvnwwnvrndcttcuycmqppqsequelleqkecshhsoqsk
gddgmwgsuzzukcuawrrwgowqknnkeukyyjjycaygmffmagmoabbaymawoxxowsoe
duudvzdnrqqrtfrvfmmfrlfdtiitprtlheehnxhtvaavldvbxssxhpxrloolfvlz
zkkzdbzhnggnbhnpbccbznbxpyypxtpfevvewaeosrrsugswgnngsmgeujjuqsum
iffioyiuwbbwmewcyttyiqysmppmgwmaallaecaiohhocioqcddcaocyqzzqyuqg
fwwfxbfptsstvhtxhoohtnhfvkkvrtvnjggjpzjvxccxnfxdzuuzjrztnqqnhxnb
bmmbfdbjpiipdjprdeedbpdzraarzvrhgxxgycgquttuwiuyippiuoigwllwsuwo
khhkqakwyddyogyeavvaksauorroiyoccnncgeckqjjqekqseffecqeasbbsawsi
hyyhzdhrvuuvxjvzjqqjvpjhxmmxtvxpliilrblxzeezphzfbwwbltbvpsspjzpd
doodhfdlrkkrflrtfggfdrfbtcctbxtjizziaeiswvvwykwakrrkwqkiynnyuwyq
mjjmscmyaffaqiagcxxcmucwqttqkaqeeppeigemsllsgmsughhgesgcudducyuk
jaajbfjtxwwxzlxblsslxrljzoozvxzrnkkntdnzbggbrjbhdyydnvdxruurlbrf
fqqfjhfntmmthntvhiihfthdveevdzvlkbbkcgkuyxxyamycmttmysmkappawyas
olloueoachhcskciezzeoweysvvsmcsggrrgkigounnuiouwijjiguiewffweawm
lccldhlvzyyzbnzdnuunztnlbqqbxzbtpmmpvfpbdiidtldjfaafpxfztwwtndth
hsshljhpvoovjpvxjkkjhvjfxggxfbxnmddmeimwazzacoaeovvoauomcrrcyacu
qnnqwgqcejjeumekgbbgqygauxxuoeuiittimkiqwppwkqwykllkiwkgyhhygcyo
neenfjnxbaabdpbfpwwpbvpndssdzbdvroorxhrdfkkfvnflhcchrzhbvyyvpfvj
juujnljrxqqxlrxzlmmljxlhziizhdzpoffogkoycbbceqcgqxxqcwqoetteacew
sppsyisegllgwogmiddisaicwzzwqgwkkvvkomksyrrymsyamnnmkymiajjaieaq
pggphlpzdccdfrdhryyrdxrpfuufbdfxtqqtzjtfhmmhxphnjeejtbjdxaaxrhxl
lwwlpnltzsszntzbnoonlznjbkkbjfbrqhhqimqaeddegseiszzseysqgvvgcegy
urruakuginniyqiokffkuckeybbysiymmxxmqomuattaouacoppomaokcllckgcs
riirjnrbfeefhtfjtaatfztrhwwhdfhzvssvblvhjoojzrjplgglvdlfzccztjzn
nyynrpnvbuubpvbdpqqpnbpldmmdlhdtsjjskoscgffgiugkubbugausixxiegia
wttwcmwikppkaskqmhhmwemgaddaukaoozzosqowcvvcqwceqrrqocqmennemieu
tkktlptdhgghjvhlvccvhbvtjyyjfhjbxuuxdnxjlqqlbtlrniinxfnhbeebvlbp
paaptrpxdwwdrxdfrssrpdrnfoofnjfvullumqueihhikwimwddwicwukzzkgikc
yvvyeoykmrrmcumsojjoygoicffcwmcqqbbqusqyexxesyegsttsqesogppgokgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: ullumque
Cipher: hyyhzdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: ullumque
Cipher: 5413135423145451

Extended Methods:
Method #1

Plaintext: ullumque
method variations:
zqqzrvzkevvewaepkaakbfkupffpglpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
u l l u m q u e 
5 1 1 5 2 1 5 5 
4 3 3 4 3 4 4 1 
They are then read out in rows:
5115215543343441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: ullumque
Cipher: evbzossd

Read more ...
Method #3

Plaintext: ullumque
method variations:
dcxicyyv cxicyyvd xicyyvdc
icyyvdcx cyyvdcxi yyvdcxic
yvdcxicy vdcxicyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: ullumque

first 5040 cipher variations(40320 total)
ullumque ullumqeu ullumuqe ullumueq ullumeuq ullumequ ulluqmue ulluqmeu ulluqume ulluquem ulluqeum
ulluqemu ulluuqme ulluuqem ulluumqe ulluumeq ulluuemq ulluueqm ulluequm ullueqmu ullueuqm ullueumq
ulluemuq ulluemqu ullmuque ullmuqeu ullmuuqe ullmuueq ullmueuq ullmuequ ullmquue ullmqueu ullmquue
ullmqueu ullmqeuu ullmqeuu ullmuque ullmuqeu ullmuuqe ullmuueq ullmueuq ullmuequ ullmequu ullmequu
ullmeuqu ullmeuuq ullmeuuq ullmeuqu ullqmuue ullqmueu ullqmuue ullqmueu ullqmeuu ullqmeuu ullqumue
ullqumeu ullquume ullquuem ullqueum ullquemu ullquume ullquuem ullqumue ullqumeu ullquemu ullqueum
ullqeuum ullqeumu ullqeuum ullqeumu ullqemuu ullqemuu ullumque ullumqeu ullumuqe ullumueq ullumeuq
ullumequ ulluqmue ulluqmeu ulluqume ulluquem ulluqeum ulluqemu ulluuqme ulluuqem ulluumqe ulluumeq
ulluuemq ulluueqm ulluequm ullueqmu ullueuqm ullueumq ulluemuq ulluemqu ullemquu ullemquu ullemuqu
ullemuuq ullemuuq ullemuqu ulleqmuu ulleqmuu ullequmu ullequum ullequum ullequmu ulleuqmu ulleuqum
ulleumqu ulleumuq ulleuumq ulleuuqm ulleuqum ulleuqmu ulleuuqm ulleuumq ulleumuq ulleumqu ululmque
ululmqeu ululmuqe ululmueq ululmeuq ululmequ ululqmue ululqmeu ululqume ululquem ululqeum ululqemu
ululuqme ululuqem ululumqe ululumeq ululuemq ululueqm ululequm ululeqmu ululeuqm ululeumq ululemuq
ululemqu ulumlque ulumlqeu ulumluqe ulumlueq ulumleuq ulumlequ ulumqlue ulumqleu ulumqule ulumquel
ulumqeul ulumqelu ulumuqle ulumuqel ulumulqe ulumuleq ulumuelq ulumueql ulumequl ulumeqlu ulumeuql
ulumeulq ulumeluq ulumelqu uluqmlue uluqmleu uluqmule uluqmuel uluqmeul uluqmelu uluqlmue uluqlmeu
uluqlume uluqluem uluqleum uluqlemu uluqulme uluqulem uluqumle uluqumel uluqueml uluquelm uluqelum
uluqelmu uluqeulm uluqeuml uluqemul uluqemlu uluumqle uluumqel uluumlqe uluumleq uluumelq uluumeql
uluuqmle uluuqmel uluuqlme uluuqlem uluuqelm uluuqeml uluulqme uluulqem uluulmqe uluulmeq uluulemq
uluuleqm uluueqlm uluueqml uluuelqm uluuelmq uluuemlq uluuemql uluemqul uluemqlu uluemuql uluemulq
uluemluq uluemlqu ulueqmul ulueqmlu uluequml uluequlm ulueqlum ulueqlmu ulueuqml ulueuqlm ulueumql
ulueumlq ulueulmq ulueulqm uluelqum uluelqmu ulueluqm uluelumq uluelmuq uluelmqu ulmulque ulmulqeu
ulmuluqe ulmulueq ulmuleuq ulmulequ ulmuqlue ulmuqleu ulmuqule ulmuquel ulmuqeul ulmuqelu ulmuuqle
ulmuuqel ulmuulqe ulmuuleq ulmuuelq ulmuueql ulmuequl ulmueqlu ulmueuql ulmueulq ulmueluq ulmuelqu
ulmluque ulmluqeu ulmluuqe ulmluueq ulmlueuq ulmluequ ulmlquue ulmlqueu ulmlquue ulmlqueu ulmlqeuu
ulmlqeuu ulmluque ulmluqeu ulmluuqe ulmluueq ulmlueuq ulmluequ ulmlequu ulmlequu ulmleuqu ulmleuuq
ulmleuuq ulmleuqu ulmqluue ulmqlueu ulmqluue ulmqlueu ulmqleuu ulmqleuu ulmqulue ulmquleu ulmquule
ulmquuel ulmqueul ulmquelu ulmquule ulmquuel ulmqulue ulmquleu ulmquelu ulmqueul ulmqeuul ulmqeulu
ulmqeuul ulmqeulu ulmqeluu ulmqeluu ulmulque ulmulqeu ulmuluqe ulmulueq ulmuleuq ulmulequ ulmuqlue
ulmuqleu ulmuqule ulmuquel ulmuqeul ulmuqelu ulmuuqle ulmuuqel ulmuulqe ulmuuleq ulmuuelq ulmuueql
ulmuequl ulmueqlu ulmueuql ulmueulq ulmueluq ulmuelqu ulmelquu ulmelquu ulmeluqu ulmeluuq ulmeluuq
ulmeluqu ulmeqluu ulmeqluu ulmequlu ulmequul ulmequul ulmequlu ulmeuqlu ulmeuqul ulmeulqu ulmeuluq
ulmeuulq ulmeuuql ulmeuqul ulmeuqlu ulmeuuql ulmeuulq ulmeuluq ulmeulqu ulqumlue ulqumleu ulqumule
ulqumuel ulqumeul ulqumelu ulqulmue ulqulmeu ulqulume ulquluem ulquleum ulqulemu ulquulme ulquulem
ulquumle ulquumel ulquueml ulquuelm ulquelum ulquelmu ulqueulm ulqueuml ulquemul ulquemlu ulqmulue
ulqmuleu ulqmuule ulqmuuel ulqmueul ulqmuelu ulqmluue ulqmlueu ulqmluue ulqmlueu ulqmleuu ulqmleuu
ulqmulue ulqmuleu ulqmuule ulqmuuel ulqmueul ulqmuelu ulqmeluu ulqmeluu ulqmeulu ulqmeuul ulqmeuul
ulqmeulu ulqlmuue ulqlmueu ulqlmuue ulqlmueu ulqlmeuu ulqlmeuu ulqlumue ulqlumeu ulqluume ulqluuem
ulqlueum ulqluemu ulqluume ulqluuem ulqlumue ulqlumeu ulqluemu ulqlueum ulqleuum ulqleumu ulqleuum
ulqleumu ulqlemuu ulqlemuu ulqumlue ulqumleu ulqumule ulqumuel ulqumeul ulqumelu ulqulmue ulqulmeu
ulqulume ulquluem ulquleum ulqulemu ulquulme ulquulem ulquumle ulquumel ulquueml ulquuelm ulquelum
ulquelmu ulqueulm ulqueuml ulquemul ulquemlu ulqemluu ulqemluu ulqemulu ulqemuul ulqemuul ulqemulu
ulqelmuu ulqelmuu ulqelumu ulqeluum ulqeluum ulqelumu ulqeulmu ulqeulum ulqeumlu ulqeumul ulqeuuml
ulqeuulm ulqeulum ulqeulmu ulqeuulm ulqeuuml ulqeumul ulqeumlu uluumqle uluumqel uluumlqe uluumleq
uluumelq uluumeql uluuqmle uluuqmel uluuqlme uluuqlem uluuqelm uluuqeml uluulqme uluulqem uluulmqe
uluulmeq uluulemq uluuleqm uluueqlm uluueqml uluuelqm uluuelmq uluuemlq uluuemql ulumuqle ulumuqel
ulumulqe ulumuleq ulumuelq ulumueql ulumqule ulumquel ulumqlue ulumqleu ulumqelu ulumqeul ulumlque
ulumlqeu ulumluqe ulumlueq ulumleuq ulumlequ ulumeqlu ulumequl ulumelqu ulumeluq ulumeulq ulumeuql
uluqmule uluqmuel uluqmlue uluqmleu uluqmelu uluqmeul uluqumle uluqumel uluqulme uluqulem uluquelm
uluqueml uluqlume uluqluem uluqlmue uluqlmeu uluqlemu uluqleum uluqeulm uluqeuml uluqelum uluqelmu
uluqemlu uluqemul ululmque ululmqeu ululmuqe ululmueq ululmeuq ululmequ ululqmue ululqmeu ululqume
ululquem ululqeum ululqemu ululuqme ululuqem ululumqe ululumeq ululuemq ululueqm ululequm ululeqmu
ululeuqm ululeumq ululemuq ululemqu uluemqlu uluemqul uluemlqu uluemluq uluemulq uluemuql ulueqmlu
ulueqmul ulueqlmu ulueqlum uluequlm uluequml uluelqmu uluelqum uluelmqu uluelmuq uluelumq ulueluqm
ulueuqlm ulueuqml ulueulqm ulueulmq ulueumlq ulueumql uleumqul uleumqlu uleumuql uleumulq uleumluq
uleumlqu uleuqmul uleuqmlu uleuquml uleuqulm uleuqlum uleuqlmu uleuuqml uleuuqlm uleuumql uleuumlq
uleuulmq uleuulqm uleulqum uleulqmu uleuluqm uleulumq uleulmuq uleulmqu ulemuqul ulemuqlu ulemuuql
ulemuulq ulemuluq ulemulqu ulemquul ulemqulu ulemquul ulemqulu ulemqluu ulemqluu ulemuqul ulemuqlu
ulemuuql ulemuulq ulemuluq ulemulqu ulemlquu ulemlquu ulemluqu ulemluuq ulemluuq ulemluqu uleqmuul
uleqmulu uleqmuul uleqmulu uleqmluu uleqmluu ulequmul ulequmlu ulequuml ulequulm ulequlum ulequlmu
ulequuml ulequulm ulequmul ulequmlu ulequlmu ulequlum uleqluum uleqlumu uleqluum uleqlumu uleqlmuu
uleqlmuu uleumqul uleumqlu uleumuql uleumulq uleumluq uleumlqu uleuqmul uleuqmlu uleuquml uleuqulm
uleuqlum uleuqlmu uleuuqml uleuuqlm uleuumql uleuumlq uleuulmq uleuulqm uleulqum uleulqmu uleuluqm
uleulumq uleulmuq uleulmqu ulelmquu ulelmquu ulelmuqu ulelmuuq ulelmuuq ulelmuqu ulelqmuu ulelqmuu
ulelqumu ulelquum ulelquum ulelqumu uleluqmu uleluqum ulelumqu ulelumuq uleluumq uleluuqm uleluqum
uleluqmu uleluuqm uleluumq ulelumuq ulelumqu ullumque ullumqeu ullumuqe ullumueq ullumeuq ullumequ
ulluqmue ulluqmeu ulluqume ulluquem ulluqeum ulluqemu ulluuqme ulluuqem ulluumqe ulluumeq ulluuemq
ulluueqm ulluequm ullueqmu ullueuqm ullueumq ulluemuq ulluemqu ullmuque ullmuqeu ullmuuqe ullmuueq
ullmueuq ullmuequ ullmquue ullmqueu ullmquue ullmqueu ullmqeuu ullmqeuu ullmuque ullmuqeu ullmuuqe
ullmuueq ullmueuq ullmuequ ullmequu ullmequu ullmeuqu ullmeuuq ullmeuuq ullmeuqu ullqmuue ullqmueu
ullqmuue ullqmueu ullqmeuu ullqmeuu ullqumue ullqumeu ullquume ullquuem ullqueum ullquemu ullquume
ullquuem ullqumue ullqumeu ullquemu ullqueum ullqeuum ullqeumu ullqeuum ullqeumu ullqemuu ullqemuu
ullumque ullumqeu ullumuqe ullumueq ullumeuq ullumequ ulluqmue ulluqmeu ulluqume ulluquem ulluqeum
ulluqemu ulluuqme ulluuqem ulluumqe ulluumeq ulluuemq ulluueqm ulluequm ullueqmu ullueuqm ullueumq
ulluemuq ulluemqu ullemquu ullemquu ullemuqu ullemuuq ullemuuq ullemuqu ulleqmuu ulleqmuu ullequmu
ullequum ullequum ullequmu ulleuqmu ulleuqum ulleumqu ulleumuq ulleuumq ulleuuqm ulleuqum ulleuqmu
ulleuuqm ulleuumq ulleumuq ulleumqu ululmque ululmqeu ululmuqe ululmueq ululmeuq ululmequ ululqmue
ululqmeu ululqume ululquem ululqeum ululqemu ululuqme ululuqem ululumqe ululumeq ululuemq ululueqm
ululequm ululeqmu ululeuqm ululeumq ululemuq ululemqu ulumlque ulumlqeu ulumluqe ulumlueq ulumleuq
ulumlequ ulumqlue ulumqleu ulumqule ulumquel ulumqeul ulumqelu ulumuqle ulumuqel ulumulqe ulumuleq
ulumuelq ulumueql ulumequl ulumeqlu ulumeuql ulumeulq ulumeluq ulumelqu uluqmlue uluqmleu uluqmule
uluqmuel uluqmeul uluqmelu uluqlmue uluqlmeu uluqlume uluqluem uluqleum uluqlemu uluqulme uluqulem
uluqumle uluqumel uluqueml uluquelm uluqelum uluqelmu uluqeulm uluqeuml uluqemul uluqemlu uluumqle
uluumqel uluumlqe uluumleq uluumelq uluumeql uluuqmle uluuqmel uluuqlme uluuqlem uluuqelm uluuqeml
uluulqme uluulqem uluulmqe uluulmeq uluulemq uluuleqm uluueqlm uluueqml uluuelqm uluuelmq uluuemlq
uluuemql uluemqul uluemqlu uluemuql uluemulq uluemluq uluemlqu ulueqmul ulueqmlu uluequml uluequlm
ulueqlum ulueqlmu ulueuqml ulueuqlm ulueumql ulueumlq ulueulmq ulueulqm uluelqum uluelqmu ulueluqm
uluelumq uluelmuq uluelmqu ulmulque ulmulqeu ulmuluqe ulmulueq ulmuleuq ulmulequ ulmuqlue ulmuqleu
ulmuqule ulmuquel ulmuqeul ulmuqelu ulmuuqle ulmuuqel ulmuulqe ulmuuleq ulmuuelq ulmuueql ulmuequl
ulmueqlu ulmueuql ulmueulq ulmueluq ulmuelqu ulmluque ulmluqeu ulmluuqe ulmluueq ulmlueuq ulmluequ
ulmlquue ulmlqueu ulmlquue ulmlqueu ulmlqeuu ulmlqeuu ulmluque ulmluqeu ulmluuqe ulmluueq ulmlueuq
ulmluequ ulmlequu ulmlequu ulmleuqu ulmleuuq ulmleuuq ulmleuqu ulmqluue ulmqlueu ulmqluue ulmqlueu
ulmqleuu ulmqleuu ulmqulue ulmquleu ulmquule ulmquuel ulmqueul ulmquelu ulmquule ulmquuel ulmqulue
ulmquleu ulmquelu ulmqueul ulmqeuul ulmqeulu ulmqeuul ulmqeulu ulmqeluu ulmqeluu ulmulque ulmulqeu
ulmuluqe ulmulueq ulmuleuq ulmulequ ulmuqlue ulmuqleu ulmuqule ulmuquel ulmuqeul ulmuqelu ulmuuqle
ulmuuqel ulmuulqe ulmuuleq ulmuuelq ulmuueql ulmuequl ulmueqlu ulmueuql ulmueulq ulmueluq ulmuelqu
ulmelquu ulmelquu ulmeluqu ulmeluuq ulmeluuq ulmeluqu ulmeqluu ulmeqluu ulmequlu ulmequul ulmequul
ulmequlu ulmeuqlu ulmeuqul ulmeulqu ulmeuluq ulmeuulq ulmeuuql ulmeuqul ulmeuqlu ulmeuuql ulmeuulq
ulmeuluq ulmeulqu ulqumlue ulqumleu ulqumule ulqumuel ulqumeul ulqumelu ulqulmue ulqulmeu ulqulume
ulquluem ulquleum ulqulemu ulquulme ulquulem ulquumle ulquumel ulquueml ulquuelm ulquelum ulquelmu
ulqueulm ulqueuml ulquemul ulquemlu ulqmulue ulqmuleu ulqmuule ulqmuuel ulqmueul ulqmuelu ulqmluue
ulqmlueu ulqmluue ulqmlueu ulqmleuu ulqmleuu ulqmulue ulqmuleu ulqmuule ulqmuuel ulqmueul ulqmuelu
ulqmeluu ulqmeluu ulqmeulu ulqmeuul ulqmeuul ulqmeulu ulqlmuue ulqlmueu ulqlmuue ulqlmueu ulqlmeuu
ulqlmeuu ulqlumue ulqlumeu ulqluume ulqluuem ulqlueum ulqluemu ulqluume ulqluuem ulqlumue ulqlumeu
ulqluemu ulqlueum ulqleuum ulqleumu ulqleuum ulqleumu ulqlemuu ulqlemuu ulqumlue ulqumleu ulqumule
ulqumuel ulqumeul ulqumelu ulqulmue ulqulmeu ulqulume ulquluem ulquleum ulqulemu ulquulme ulquulem
ulquumle ulquumel ulquueml ulquuelm ulquelum ulquelmu ulqueulm ulqueuml ulquemul ulquemlu ulqemluu
ulqemluu ulqemulu ulqemuul ulqemuul ulqemulu ulqelmuu ulqelmuu ulqelumu ulqeluum ulqeluum ulqelumu
ulqeulmu ulqeulum ulqeumlu ulqeumul ulqeuuml ulqeuulm ulqeulum ulqeulmu ulqeuulm ulqeuuml ulqeumul
ulqeumlu uluumqle uluumqel uluumlqe uluumleq uluumelq uluumeql uluuqmle uluuqmel uluuqlme uluuqlem
uluuqelm uluuqeml uluulqme uluulqem uluulmqe uluulmeq uluulemq uluuleqm uluueqlm uluueqml uluuelqm
uluuelmq uluuemlq uluuemql ulumuqle ulumuqel ulumulqe ulumuleq ulumuelq ulumueql ulumqule ulumquel
ulumqlue ulumqleu ulumqelu ulumqeul ulumlque ulumlqeu ulumluqe ulumlueq ulumleuq ulumlequ ulumeqlu
ulumequl ulumelqu ulumeluq ulumeulq ulumeuql uluqmule uluqmuel uluqmlue uluqmleu uluqmelu uluqmeul
uluqumle uluqumel uluqulme uluqulem uluquelm uluqueml uluqlume uluqluem uluqlmue uluqlmeu uluqlemu
uluqleum uluqeulm uluqeuml uluqelum uluqelmu uluqemlu uluqemul ululmque ululmqeu ululmuqe ululmueq
ululmeuq ululmequ ululqmue ululqmeu ululqume ululquem ululqeum ululqemu ululuqme ululuqem ululumqe
ululumeq ululuemq ululueqm ululequm ululeqmu ululeuqm ululeumq ululemuq ululemqu uluemqlu uluemqul
uluemlqu uluemluq uluemulq uluemuql ulueqmlu ulueqmul ulueqlmu ulueqlum uluequlm uluequml uluelqmu
uluelqum uluelmqu uluelmuq uluelumq ulueluqm ulueuqlm ulueuqml ulueulqm ulueulmq ulueumlq ulueumql
uleumqul uleumqlu uleumuql uleumulq uleumluq uleumlqu uleuqmul uleuqmlu uleuquml uleuqulm uleuqlum
uleuqlmu uleuuqml uleuuqlm uleuumql uleuumlq uleuulmq uleuulqm uleulqum uleulqmu uleuluqm uleulumq
uleulmuq uleulmqu ulemuqul ulemuqlu ulemuuql ulemuulq ulemuluq ulemulqu ulemquul ulemqulu ulemquul
ulemqulu ulemqluu ulemqluu ulemuqul ulemuqlu ulemuuql ulemuulq ulemuluq ulemulqu ulemlquu ulemlquu
ulemluqu ulemluuq ulemluuq ulemluqu uleqmuul uleqmulu uleqmuul uleqmulu uleqmluu uleqmluu ulequmul
ulequmlu ulequuml ulequulm ulequlum ulequlmu ulequuml ulequulm ulequmul ulequmlu ulequlmu ulequlum
uleqluum uleqlumu uleqluum uleqlumu uleqlmuu uleqlmuu uleumqul uleumqlu uleumuql uleumulq uleumluq
uleumlqu uleuqmul uleuqmlu uleuquml uleuqulm uleuqlum uleuqlmu uleuuqml uleuuqlm uleuumql uleuumlq
uleuulmq uleuulqm uleulqum uleulqmu uleuluqm uleulumq uleulmuq uleulmqu ulelmquu ulelmquu ulelmuqu
ulelmuuq ulelmuuq ulelmuqu ulelqmuu ulelqmuu ulelqumu ulelquum ulelquum ulelqumu uleluqmu uleluqum
ulelumqu ulelumuq uleluumq uleluuqm uleluqum uleluqmu uleluuqm uleluumq ulelumuq ulelumqu uullmque
uullmqeu uullmuqe uullmueq uullmeuq uullmequ uullqmue uullqmeu uullqume uullquem uullqeum uullqemu
uulluqme uulluqem uullumqe uullumeq uulluemq uullueqm uullequm uulleqmu uulleuqm uulleumq uullemuq
uullemqu uulmlque uulmlqeu uulmluqe uulmlueq uulmleuq uulmlequ uulmqlue uulmqleu uulmqule uulmquel
uulmqeul uulmqelu uulmuqle uulmuqel uulmulqe uulmuleq uulmuelq uulmueql uulmequl uulmeqlu uulmeuql
uulmeulq uulmeluq uulmelqu uulqmlue uulqmleu uulqmule uulqmuel uulqmeul uulqmelu uulqlmue uulqlmeu
uulqlume uulqluem uulqleum uulqlemu uulqulme uulqulem uulqumle uulqumel uulqueml uulquelm uulqelum
uulqelmu uulqeulm uulqeuml uulqemul uulqemlu uulumqle uulumqel uulumlqe uulumleq uulumelq uulumeql
uuluqmle uuluqmel uuluqlme uuluqlem uuluqelm uuluqeml uululqme uululqem uululmqe uululmeq uululemq
uululeqm uulueqlm uulueqml uuluelqm uuluelmq uuluemlq uuluemql uulemqul uulemqlu uulemuql uulemulq
uulemluq uulemlqu uuleqmul uuleqmlu uulequml uulequlm uuleqlum uuleqlmu uuleuqml uuleuqlm uuleumql
uuleumlq uuleulmq uuleulqm uulelqum uulelqmu uuleluqm uulelumq uulelmuq uulelmqu uullmque uullmqeu
uullmuqe uullmueq uullmeuq uullmequ uullqmue uullqmeu uullqume uullquem uullqeum uullqemu uulluqme
uulluqem uullumqe uullumeq uulluemq uullueqm uullequm uulleqmu uulleuqm uulleumq uullemuq uullemqu
uulmlque uulmlqeu uulmluqe uulmlueq uulmleuq uulmlequ uulmqlue uulmqleu uulmqule uulmquel uulmqeul
uulmqelu uulmuqle uulmuqel uulmulqe uulmuleq uulmuelq uulmueql uulmequl uulmeqlu uulmeuql uulmeulq
uulmeluq uulmelqu uulqmlue uulqmleu uulqmule uulqmuel uulqmeul uulqmelu uulqlmue uulqlmeu uulqlume
uulqluem uulqleum uulqlemu uulqulme uulqulem uulqumle uulqumel uulqueml uulquelm uulqelum uulqelmu
uulqeulm uulqeuml uulqemul uulqemlu uulumqle uulumqel uulumlqe uulumleq uulumelq uulumeql uuluqmle
uuluqmel uuluqlme uuluqlem uuluqelm uuluqeml uululqme uululqem uululmqe uululmeq uululemq uululeqm
uulueqlm uulueqml uuluelqm uuluelmq uuluemlq uuluemql uulemqul uulemqlu uulemuql uulemulq uulemluq
uulemlqu uuleqmul uuleqmlu uulequml uulequlm uuleqlum uuleqlmu uuleuqml uuleuqlm uuleumql uuleumlq
uuleulmq uuleulqm uulelqum uulelqmu uuleluqm uulelumq uulelmuq uulelmqu uumllque uumllqeu uumlluqe
uumllueq uumlleuq uumllequ uumlqlue uumlqleu uumlqule uumlquel uumlqeul uumlqelu uumluqle uumluqel
uumlulqe uumluleq uumluelq uumlueql uumlequl uumleqlu uumleuql uumleulq uumleluq uumlelqu uumllque
uumllqeu uumlluqe uumllueq uumlleuq uumllequ uumlqlue uumlqleu uumlqule uumlquel uumlqeul uumlqelu
uumluqle uumluqel uumlulqe uumluleq uumluelq uumlueql uumlequl uumleqlu uumleuql uumleulq uumleluq
uumlelqu uumqllue uumqlleu uumqlule uumqluel uumqleul uumqlelu uumqllue uumqlleu uumqlule uumqluel
uumqleul uumqlelu uumqulle uumqulel uumqulle uumqulel uumquell uumquell uumqelul uumqellu uumqeull
uumqeull uumqelul uumqellu uumulqle uumulqel uumullqe uumulleq uumulelq uumuleql uumuqlle uumuqlel
uumuqlle uumuqlel uumuqell uumuqell uumulqle uumulqel uumullqe uumulleq uumulelq uumuleql uumueqll
uumueqll uumuelql uumuellq uumuellq uumuelql uumelqul uumelqlu uumeluql uumelulq uumelluq uumellqu
uumeqlul uumeqllu uumequll uumequll uumeqlul uumeqllu uumeuqll uumeuqll uumeulql uumeullq uumeullq
uumeulql uumelqul uumelqlu uumeluql uumelulq uumelluq uumellqu uuqlmlue uuqlmleu uuqlmule uuqlmuel
uuqlmeul uuqlmelu uuqllmue uuqllmeu uuqllume uuqlluem uuqlleum uuqllemu uuqlulme uuqlulem uuqlumle
uuqlumel uuqlueml uuqluelm uuqlelum uuqlelmu uuqleulm uuqleuml uuqlemul uuqlemlu uuqmllue uuqmlleu
uuqmlule uuqmluel uuqmleul uuqmlelu uuqmllue uuqmlleu uuqmlule uuqmluel uuqmleul uuqmlelu uuqmulle
uuqmulel uuqmulle uuqmulel uuqmuell uuqmuell uuqmelul uuqmellu uuqmeull uuqmeull uuqmelul uuqmellu
uuqlmlue uuqlmleu uuqlmule uuqlmuel uuqlmeul uuqlmelu uuqllmue uuqllmeu uuqllume uuqlluem uuqlleum
uuqllemu uuqlulme uuqlulem uuqlumle uuqlumel uuqlueml uuqluelm uuqlelum uuqlelmu uuqleulm uuqleuml
uuqlemul uuqlemlu uuqumlle uuqumlel uuqumlle uuqumlel uuqumell uuqumell uuqulmle uuqulmel uuqullme
uuqullem uuqulelm uuquleml uuqullme uuqullem uuqulmle uuqulmel uuquleml uuqulelm uuquellm uuquelml
uuquellm uuquelml uuquemll uuquemll uuqemlul uuqemllu uuqemull uuqemull uuqemlul uuqemllu uuqelmul
uuqelmlu uuqeluml uuqelulm uuqellum uuqellmu uuqeulml uuqeullm uuqeumll uuqeumll uuqeulml uuqeullm
uuqellum uuqellmu uuqelulm uuqeluml uuqelmul uuqelmlu uuulmqle uuulmqel uuulmlqe uuulmleq uuulmelq
uuulmeql uuulqmle uuulqmel uuulqlme uuulqlem uuulqelm uuulqeml uuullqme uuullqem uuullmqe uuullmeq
uuullemq uuulleqm uuuleqlm uuuleqml uuulelqm uuulelmq uuulemlq uuulemql uuumlqle uuumlqel uuumllqe
uuumlleq uuumlelq uuumleql uuumqlle uuumqlel uuumqlle uuumqlel uuumqell uuumqell uuumlqle uuumlqel
uuumllqe uuumlleq uuumlelq uuumleql uuumeqll uuumeqll uuumelql uuumellq uuumellq uuumelql uuuqmlle
uuuqmlel uuuqmlle uuuqmlel uuuqmell uuuqmell uuuqlmle uuuqlmel uuuqllme uuuqllem uuuqlelm uuuqleml
uuuqllme uuuqllem uuuqlmle uuuqlmel uuuqleml uuuqlelm uuuqellm uuuqelml uuuqellm uuuqelml uuuqemll
uuuqemll uuulmqle uuulmqel uuulmlqe uuulmleq uuulmelq uuulmeql uuulqmle uuulqmel uuulqlme uuulqlem
uuulqelm uuulqeml uuullqme uuullqem uuullmqe uuullmeq uuullemq uuulleqm uuuleqlm uuuleqml uuulelqm
uuulelmq uuulemlq uuulemql uuuemqll uuuemqll uuuemlql uuuemllq uuuemllq uuuemlql uuueqmll uuueqmll
uuueqlml uuueqllm uuueqllm uuueqlml uuuelqml uuuelqlm uuuelmql uuuelmlq uuuellmq uuuellqm uuuelqlm
uuuelqml uuuellqm uuuellmq uuuelmlq uuuelmql uuelmqul uuelmqlu uuelmuql uuelmulq uuelmluq uuelmlqu
uuelqmul uuelqmlu uuelquml uuelqulm uuelqlum uuelqlmu uueluqml uueluqlm uuelumql uuelumlq uuelulmq
uuelulqm uuellqum uuellqmu uuelluqm uuellumq uuellmuq uuellmqu uuemlqul uuemlqlu uuemluql uuemlulq
uuemlluq uuemllqu uuemqlul uuemqllu uuemqull uuemqull uuemqlul uuemqllu uuemuqll uuemuqll uuemulql
uuemullq uuemullq uuemulql uuemlqul uuemlqlu uuemluql uuemlulq uuemlluq uuemllqu uueqmlul uueqmllu
uueqmull uueqmull uueqmlul uueqmllu uueqlmul uueqlmlu uueqluml uueqlulm uueqllum uueqllmu uuequlml
uuequllm uuequmll uuequmll uuequlml uuequllm uueqllum uueqllmu uueqlulm uueqluml uueqlmul uueqlmlu
uueumqll uueumqll uueumlql uueumllq uueumllq uueumlql uueuqmll uueuqmll uueuqlml uueuqllm uueuqllm
uueuqlml uueulqml uueulqlm uueulmql uueulmlq uueullmq uueullqm uueulqlm uueulqml uueullqm uueullmq
uueulmlq uueulmql uuelmqul uuelmqlu uuelmuql uuelmulq uuelmluq uuelmlqu uuelqmul uuelqmlu uuelquml
uuelqulm uuelqlum uuelqlmu uueluqml uueluqlm uuelumql uuelumlq uuelulmq uuelulqm uuellqum uuellqmu
uuelluqm uuellumq uuellmuq uuellmqu umlulque umlulqeu umluluqe umlulueq umluleuq umlulequ umluqlue
umluqleu umluqule umluquel umluqeul umluqelu umluuqle umluuqel umluulqe umluuleq umluuelq umluueql
umluequl umlueqlu umlueuql umlueulq umlueluq umluelqu umlluque umlluqeu umlluuqe umlluueq umllueuq
umlluequ umllquue umllqueu umllquue umllqueu umllqeuu umllqeuu umlluque umlluqeu umlluuqe umlluueq
umllueuq umlluequ umllequu umllequu umlleuqu umlleuuq umlleuuq umlleuqu umlqluue umlqlueu umlqluue
umlqlueu umlqleuu umlqleuu umlqulue umlquleu umlquule umlquuel umlqueul umlquelu umlquule umlquuel
umlqulue umlquleu umlquelu umlqueul umlqeuul umlqeulu umlqeuul umlqeulu umlqeluu umlqeluu umlulque
umlulqeu umluluqe umlulueq umluleuq umlulequ umluqlue umluqleu umluqule umluquel umluqeul umluqelu
umluuqle umluuqel umluulqe umluuleq umluuelq umluueql umluequl umlueqlu umlueuql umlueulq umlueluq
umluelqu umlelquu umlelquu umleluqu umleluuq umleluuq umleluqu umleqluu umleqluu umlequlu umlequul
umlequul umlequlu umleuqlu umleuqul umleulqu umleuluq umleuulq umleuuql umleuqul umleuqlu umleuuql
umleuulq umleuluq umleulqu umullque umullqeu umulluqe umullueq umulleuq umullequ umulqlue umulqleu
umulqule umulquel umulqeul umulqelu umuluqle umuluqel umululqe umululeq umuluelq umulueql umulequl
umuleqlu umuleuql umuleulq umuleluq umulelqu umullque umullqeu umulluqe umullueq umulleuq umullequ
umulqlue umulqleu umulqule umulquel umulqeul umulqelu umuluqle umuluqel umululqe umululeq umuluelq
umulueql umulequl umuleqlu umuleuql umuleulq umuleluq umulelqu umuqllue umuqlleu umuqlule umuqluel
umuqleul umuqlelu umuqllue umuqlleu umuqlule umuqluel umuqleul umuqlelu umuqulle umuqulel umuqulle
umuqulel umuquell umuquell umuqelul umuqellu umuqeull umuqeull umuqelul umuqellu umuulqle umuulqel
umuullqe umuulleq umuulelq umuuleql umuuqlle umuuqlel umuuqlle umuuqlel umuuqell umuuqell umuulqle
umuulqel umuullqe umuulleq umuulelq umuuleql umuueqll umuueqll umuuelql umuuellq umuuellq umuuelql
umuelqul umuelqlu umueluql umuelulq umuelluq umuellqu umueqlul umueqllu umuequll umuequll umueqlul
umueqllu umueuqll umueuqll umueulql umueullq umueullq umueulql umuelqul umuelqlu umueluql umuelulq
umuelluq umuellqu umlulque umlulqeu umluluqe umlulueq umluleuq umlulequ umluqlue umluqleu umluqule
umluquel umluqeul umluqelu umluuqle umluuqel umluulqe umluuleq umluuelq umluueql umluequl umlueqlu
umlueuql umlueulq umlueluq umluelqu umlluque umlluqeu umlluuqe umlluueq umllueuq umlluequ umllquue
umllqueu umllquue umllqueu umllqeuu umllqeuu umlluque umlluqeu umlluuqe umlluueq umllueuq umlluequ
umllequu umllequu umlleuqu umlleuuq umlleuuq umlleuqu umlqluue umlqlueu umlqluue umlqlueu umlqleuu
umlqleuu umlqulue umlquleu umlquule umlquuel umlqueul umlquelu umlquule umlquuel umlqulue umlquleu
umlquelu umlqueul umlqeuul umlqeulu umlqeuul umlqeulu umlqeluu umlqeluu umlulque umlulqeu umluluqe
umlulueq umluleuq umlulequ umluqlue umluqleu umluqule umluquel umluqeul umluqelu umluuqle umluuqel
umluulqe umluuleq umluuelq umluueql umluequl umlueqlu umlueuql umlueulq umlueluq umluelqu umlelquu
umlelquu umleluqu umleluuq umleluuq umleluqu umleqluu umleqluu umlequlu umlequul umlequul umlequlu
umleuqlu umleuqul umleulqu umleuluq umleuulq umleuuql umleuqul umleuqlu umleuuql umleuulq umleuluq
umleulqu umqullue umqulleu umqulule umquluel umquleul umqulelu umqullue umqulleu umqulule umquluel
umquleul umqulelu umquulle umquulel umquulle umquulel umquuell umquuell umquelul umquellu umqueull
umqueull umquelul umquellu umqlulue umqluleu umqluule umqluuel umqlueul umqluelu umqlluue umqllueu
umqlluue umqllueu umqlleuu umqlleuu umqlulue umqluleu umqluule umqluuel umqlueul umqluelu umqleluu
umqleluu umqleulu umqleuul umqleuul umqleulu umqlluue umqllueu umqlluue umqllueu umqlleuu umqlleuu
umqlulue umqluleu umqluule umqluuel umqlueul umqluelu umqluule umqluuel umqlulue umqluleu umqluelu
umqlueul umqleuul umqleulu umqleuul umqleulu umqleluu umqleluu umqullue umqulleu umqulule umquluel
umquleul umqulelu umqullue umqulleu umqulule umquluel umquleul umqulelu umquulle umquulel umquulle
umquulel umquuell umquuell umquelul umquellu umqueull umqueull umquelul umquellu umqelluu umqelluu
umqelulu umqeluul umqeluul umqelulu umqelluu umqelluu umqelulu umqeluul umqeluul umqelulu umqeullu
umqeulul umqeullu umqeulul umqeuull umqeuull umqeulul umqeullu umqeuull umqeuull umqeulul umqeullu
umuulqle umuulqel umuullqe umuulleq umuulelq umuuleql umuuqlle umuuqlel umuuqlle umuuqlel umuuqell
umuuqell umuulqle umuulqel umuullqe umuulleq umuulelq umuuleql umuueqll umuueqll umuuelql umuuellq
umuuellq umuuelql umuluqle umuluqel umululqe umululeq umuluelq umulueql umulqule umulquel umulqlue
umulqleu umulqelu umulqeul umullque umullqeu umulluqe umullueq umulleuq umullequ umuleqlu umulequl
umulelqu umuleluq umuleulq umuleuql umuqlule umuqluel umuqllue umuqlleu umuqlelu umuqleul umuqulle
umuqulel umuqulle umuqulel umuquell umuquell umuqlule umuqluel umuqllue umuqlleu umuqlelu umuqleul
umuqeull umuqeull umuqelul umuqellu umuqellu umuqelul umullque umullqeu umulluqe umullueq umulleuq
umullequ umulqlue umulqleu umulqule umulquel umulqeul umulqelu umuluqle umuluqel umululqe umululeq
umuluelq umulueql umulequl umuleqlu umuleuql umuleulq umuleluq umulelqu umuelqlu umuelqul umuellqu
umuelluq umuelulq umueluql umueqllu umueqlul umueqllu umueqlul umuequll umuequll umuelqlu umuelqul
umuellqu umuelluq umuelulq umueluql umueuqll umueuqll umueulql umueullq umueullq umueulql umeulqul
umeulqlu umeuluql umeululq umeulluq umeullqu umeuqlul umeuqllu umeuqull umeuqull umeuqlul umeuqllu
umeuuqll umeuuqll umeuulql umeuullq umeuullq umeuulql umeulqul umeulqlu umeuluql umeululq umeulluq
umeullqu umeluqul umeluqlu umeluuql umeluulq umeluluq umelulqu umelquul umelqulu umelquul umelqulu
umelqluu umelqluu umeluqul umeluqlu umeluuql umeluulq umeluluq umelulqu umellquu umellquu umelluqu
umelluuq umelluuq umelluqu umeqluul umeqlulu umeqluul umeqlulu umeqlluu umeqlluu umequlul umequllu
umequull umequull umequlul umequllu umequull umequull umequlul umequllu umequllu umequlul umeqluul
umeqlulu umeqluul umeqlulu umeqlluu umeqlluu umeulqul umeulqlu umeuluql umeululq umeulluq umeullqu
umeuqlul umeuqllu umeuqull umeuqull umeuqlul umeuqllu umeuuqll umeuuqll umeuulql umeuullq umeuullq
umeuulql umeulqul umeulqlu umeuluql umeululq umeulluq umeullqu umellquu umellquu umelluqu umelluuq
umelluuq umelluqu umelqluu umelqluu umelqulu umelquul umelquul umelqulu umeluqlu umeluqul umelulqu
umeluluq umeluulq umeluuql umeluqul umeluqlu umeluuql umeluulq umeluluq umelulqu uqlumlue uqlumleu
uqlumule uqlumuel uqlumeul uqlumelu uqlulmue uqlulmeu uqlulume uqluluem uqluleum uqlulemu uqluulme
uqluulem uqluumle uqluumel uqluueml uqluuelm uqluelum uqluelmu uqlueulm uqlueuml uqluemul uqluemlu
uqlmulue uqlmuleu uqlmuule uqlmuuel uqlmueul uqlmuelu uqlmluue uqlmlueu uqlmluue uqlmlueu uqlmleuu
uqlmleuu uqlmulue uqlmuleu uqlmuule uqlmuuel uqlmueul uqlmuelu uqlmeluu uqlmeluu uqlmeulu uqlmeuul
uqlmeuul uqlmeulu uqllmuue uqllmueu uqllmuue uqllmueu uqllmeuu uqllmeuu uqllumue uqllumeu uqlluume
uqlluuem uqllueum uqlluemu uqlluume uqlluuem uqllumue uqllumeu uqlluemu uqllueum uqlleuum uqlleumu
uqlleuum uqlleumu uqllemuu uqllemuu uqlumlue uqlumleu uqlumule uqlumuel uqlumeul uqlumelu uqlulmue
uqlulmeu uqlulume uqluluem uqluleum uqlulemu uqluulme uqluulem uqluumle uqluumel uqluueml uqluuelm
uqluelum uqluelmu uqlueulm uqlueuml uqluemul uqluemlu uqlemluu uqlemluu uqlemulu uqlemuul uqlemuul
uqlemulu uqlelmuu uqlelmuu uqlelumu uqleluum uqleluum uqlelumu uqleulmu uqleulum uqleumlu uqleumul
uqleuuml uqleuulm uqleulum uqleulmu uqleuulm uqleuuml uqleumul uqleumlu uqulmlue uqulmleu uqulmule
uqulmuel uqulmeul uqulmelu uqullmue uqullmeu uqullume uqulluem uqulleum uqullemu uqululme uqululem
uqulumle uqulumel uqulueml uquluelm uqulelum uqulelmu uquleulm uquleuml uqulemul uqulemlu uqumllue
uqumlleu uqumlule uqumluel uqumleul uqumlelu uqumllue uqumlleu uqumlule uqumluel uqumleul uqumlelu
uqumulle uqumulel uqumulle uqumulel uqumuell uqumuell uqumelul uqumellu uqumeull uqumeull uqumelul
uqumellu uqulmlue uqulmleu uqulmule uqulmuel uqulmeul uqulmelu uqullmue uqullmeu uqullume uqulluem
uqulleum uqullemu uqululme uqululem uqulumle uqulumel uqulueml uquluelm uqulelum uqulelmu uquleulm
uquleuml uqulemul uqulemlu uquumlle uquumlel uquumlle uquumlel uquumell uquumell uquulmle uquulmel
uquullme uquullem uquulelm uquuleml uquullme uquullem uquulmle uquulmel uquuleml uquulelm uquuellm
uquuelml uquuellm uquuelml uquuemll uquuemll uquemlul uquemllu uquemull uquemull uquemlul uquemllu
uquelmul uquelmlu uqueluml uquelulm uquellum uquellmu uqueulml uqueullm uqueumll uqueumll uqueulml
uqueullm uquellum uquellmu uquelulm uqueluml uquelmul uquelmlu uqmullue uqmulleu uqmulule uqmuluel
uqmuleul uqmulelu uqmullue uqmulleu uqmulule uqmuluel uqmuleul uqmulelu uqmuulle uqmuulel uqmuulle
uqmuulel uqmuuell uqmuuell uqmuelul uqmuellu uqmueull uqmueull uqmuelul uqmuellu uqmlulue uqmluleu
uqmluule uqmluuel uqmlueul uqmluelu uqmlluue uqmllueu uqmlluue uqmllueu uqmlleuu uqmlleuu uqmlulue
uqmluleu uqmluule uqmluuel uqmlueul uqmluelu uqmleluu uqmleluu uqmleulu uqmleuul uqmleuul uqmleulu
uqmlluue uqmllueu uqmlluue uqmllueu uqmlleuu uqmlleuu uqmlulue uqmluleu uqmluule uqmluuel uqmlueul
uqmluelu uqmluule uqmluuel uqmlulue uqmluleu uqmluelu uqmlueul uqmleuul uqmleulu uqmleuul uqmleulu
uqmleluu uqmleluu uqmullue uqmulleu uqmulule uqmuluel uqmuleul uqmulelu uqmullue uqmulleu uqmulule
uqmuluel uqmuleul uqmulelu uqmuulle uqmuulel uqmuulle uqmuulel uqmuuell uqmuuell uqmuelul uqmuellu
uqmueull uqmueull uqmuelul uqmuellu uqmelluu uqmelluu uqmelulu uqmeluul uqmeluul uqmelulu uqmelluu
uqmelluu uqmelulu uqmeluul uqmeluul uqmelulu uqmeullu uqmeulul uqmeullu uqmeulul uqmeuull uqmeuull
uqmeulul uqmeullu uqmeuull uqmeuull uqmeulul uqmeullu uqlumlue uqlumleu uqlumule uqlumuel uqlumeul
uqlumelu uqlulmue uqlulmeu uqlulume uqluluem uqluleum uqlulemu uqluulme uqluulem uqluumle uqluumel
uqluueml uqluuelm uqluelum uqluelmu uqlueulm uqlueuml uqluemul uqluemlu uqlmulue uqlmuleu uqlmuule
uqlmuuel uqlmueul uqlmuelu uqlmluue uqlmlueu uqlmluue uqlmlueu uqlmleuu uqlmleuu uqlmulue uqlmuleu
uqlmuule uqlmuuel uqlmueul uqlmuelu uqlmeluu uqlmeluu uqlmeulu uqlmeuul uqlmeuul uqlmeulu uqllmuue
uqllmueu uqllmuue uqllmueu uqllmeuu uqllmeuu uqllumue uqllumeu uqlluume uqlluuem uqllueum uqlluemu
uqlluume uqlluuem uqllumue uqllumeu uqlluemu uqllueum uqlleuum uqlleumu uqlleuum uqlleumu uqllemuu
uqllemuu uqlumlue uqlumleu uqlumule uqlumuel uqlumeul uqlumelu uqlulmue uqlulmeu uqlulume uqluluem
uqluleum uqlulemu uqluulme uqluulem uqluumle uqluumel uqluueml uqluuelm uqluelum uqluelmu uqlueulm
uqlueuml uqluemul uqluemlu uqlemluu uqlemluu uqlemulu uqlemuul uqlemuul uqlemulu uqlelmuu uqlelmuu
uqlelumu uqleluum uqleluum uqlelumu uqleulmu uqleulum uqleumlu uqleumul uqleuuml uqleuulm uqleulum
uqleulmu uqleuulm uqleuuml uqleumul uqleumlu uquumlle uquumlel uquumlle uquumlel uquumell uquumell
uquulmle uquulmel uquullme uquullem uquulelm uquuleml uquullme uquullem uquulmle uquulmel uquuleml
uquulelm uquuellm uquuelml uquuellm uquuelml uquuemll uquuemll uqumulle uqumulel uqumulle uqumulel
uqumuell uqumuell uqumlule uqumluel uqumllue uqumlleu uqumlelu uqumleul uqumllue uqumlleu uqumlule
uqumluel uqumleul uqumlelu uqumellu uqumelul uqumellu uqumelul uqumeull uqumeull uqulmule uqulmuel
uqulmlue uqulmleu uqulmelu uqulmeul uqulumle uqulumel uqululme uqululem uquluelm uqulueml uqullume
uqulluem uqullmue uqullmeu uqullemu uqulleum uquleulm uquleuml uqulelum uqulelmu uqulemlu uqulemul
uqulmlue uqulmleu uqulmule uqulmuel uqulmeul uqulmelu uqullmue uqullmeu uqullume uqulluem uqulleum
uqullemu uqululme uqululem uqulumle uqulumel uqulueml uquluelm uqulelum uqulelmu uquleulm uquleuml
uqulemul uqulemlu uquemllu uquemlul uquemllu uquemlul uquemull uquemull uquelmlu uquelmul uquellmu
uquellum uquelulm uqueluml uquellmu uquellum uquelmlu uquelmul uqueluml uquelulm uqueullm uqueulml
uqueullm uqueulml uqueumll uqueumll uqeumlul uqeumllu uqeumull uqeumull uqeumlul uqeumllu uqeulmul
uqeulmlu uqeuluml uqeululm uqeullum uqeullmu uqeuulml uqeuullm uqeuumll uqeuumll uqeuulml uqeuullm
uqeullum uqeullmu uqeululm uqeuluml uqeulmul uqeulmlu uqemulul uqemullu uqemuull uqemuull uqemulul
uqemullu uqemluul uqemlulu uqemluul uqemlulu uqemlluu uqemlluu uqemulul uqemullu uqemuull uqemuull
uqemulul uqemullu uqemlluu uqemlluu uqemlulu uqemluul uqemluul uqemlulu uqelmuul uqelmulu uqelmuul
uqelmulu uqelmluu uqelmluu uqelumul uqelumlu uqeluuml uqeluulm uqelulum uqelulmu uqeluuml uqeluulm
uqelumul uqelumlu uqelulmu uqelulum uqelluum uqellumu uqelluum uqellumu uqellmuu uqellmuu uqeumlul
uqeumllu uqeumull uqeumull uqeumlul uqeumllu uqeulmul uqeulmlu uqeuluml uqeululm uqeullum uqeullmu
uqeuulml uqeuullm uqeuumll uqeuumll uqeuulml uqeuullm uqeullum uqeullmu uqeululm uqeuluml uqeulmul
uqeulmlu uqelmluu uqelmluu uqelmulu uqelmuul uqelmuul uqelmulu uqellmuu uqellmuu uqellumu uqelluum
uqelluum uqellumu uqelulmu uqelulum uqelumlu uqelumul uqeluuml uqeluulm uqelulum uqelulmu uqeluulm
uqeluuml uqelumul uqelumlu uulumqle uulumqel uulumlqe uulumleq uulumelq uulumeql uuluqmle uuluqmel
uuluqlme uuluqlem uuluqelm uuluqeml uululqme uululqem uululmqe uululmeq uululemq uululeqm uulueqlm
uulueqml uuluelqm uuluelmq uuluemlq uuluemql uulmuqle uulmuqel uulmulqe uulmuleq uulmuelq uulmueql
uulmqule uulmquel uulmqlue uulmqleu uulmqelu uulmqeul uulmlque uulmlqeu uulmluqe uulmlueq uulmleuq
uulmlequ uulmeqlu uulmequl uulmelqu uulmeluq uulmeulq uulmeuql uulqmule uulqmuel uulqmlue uulqmleu
uulqmelu uulqmeul uulqumle uulqumel uulqulme uulqulem uulquelm uulqueml uulqlume uulqluem uulqlmue
uulqlmeu uulqlemu uulqleum uulqeulm uulqeuml uulqelum uulqelmu uulqemlu uulqemul uullmque uullmqeu
uullmuqe uullmueq uullmeuq uullmequ uullqmue uullqmeu uullqume uullquem uullqeum uullqemu uulluqme
uulluqem uullumqe uullumeq uulluemq uullueqm uullequm uulleqmu uulleuqm uulleumq uullemuq uullemqu
uulemqlu uulemqul uulemlqu uulemluq uulemulq uulemuql uuleqmlu uuleqmul uuleqlmu uuleqlum uulequlm
uulequml uulelqmu uulelqum uulelmqu uulelmuq uulelumq uuleluqm uuleuqlm uuleuqml uuleulqm uuleulmq
uuleumlq uuleumql uuulmqle uuulmqel uuulmlqe uuulmleq uuulmelq uuulmeql uuulqmle uuulqmel uuulqlme
uuulqlem uuulqelm uuulqeml uuullqme uuullqem uuullmqe uuullmeq uuullemq uuulleqm uuuleqlm uuuleqml
uuulelqm uuulelmq uuulemlq uuulemql uuumlqle uuumlqel uuumllqe uuumlleq uuumlelq uuumleql uuumqlle
uuumqlel uuumqlle uuumqlel uuumqell uuumqell uuumlqle uuumlqel uuumllqe uuumlleq uuumlelq uuumleql
uuumeqll uuumeqll uuumelql uuumellq uuumellq uuumelql uuuqmlle uuuqmlel uuuqmlle uuuqmlel uuuqmell
uuuqmell uuuqlmle uuuqlmel uuuqllme uuuqllem uuuqlelm uuuqleml uuuqllme uuuqllem uuuqlmle uuuqlmel
uuuqleml uuuqlelm uuuqellm uuuqelml uuuqellm uuuqelml uuuqemll uuuqemll uuulmqle uuulmqel uuulmlqe
uuulmleq uuulmelq uuulmeql uuulqmle uuulqmel uuulqlme uuulqlem uuulqelm uuulqeml uuullqme uuullqem
uuullmqe uuullmeq uuullemq uuulleqm uuuleqlm uuuleqml uuulelqm uuulelmq uuulemlq uuulemql uuuemqll
uuuemqll uuuemlql uuuemllq uuuemllq uuuemlql uuueqmll uuueqmll uuueqlml uuueqllm uuueqllm uuueqlml
uuuelqml uuuelqlm uuuelmql uuuelmlq uuuellmq uuuellqm uuuelqlm uuuelqml uuuellqm uuuellmq uuuelmlq
uuuelmql uumulqle uumulqel uumullqe uumulleq uumulelq uumuleql uumuqlle uumuqlel uumuqlle uumuqlel
uumuqell uumuqell uumulqle uumulqel uumullqe uumulleq uumulelq uumuleql uumueqll uumueqll uumuelql
uumuellq uumuellq uumuelql uumluqle uumluqel uumlulqe uumluleq uumluelq uumlueql uumlqule uumlquel
uumlqlue uumlqleu uumlqelu uumlqeul uumllque uumllqeu uumlluqe uumllueq uumlleuq uumllequ uumleqlu
uumlequl uumlelqu uumleluq uumleulq uumleuql uumqlule uumqluel uumqllue uumqlleu uumqlelu uumqleul
uumqulle uumqulel uumqulle uumqulel uumquell uumquell uumqlule uumqluel uumqllue uumqlleu uumqlelu
uumqleul uumqeull uumqeull uumqelul uumqellu uumqellu uumqelul uumllque uumllqeu uumlluqe uumllueq
uumlleuq uumllequ uumlqlue uumlqleu uumlqule uumlquel uumlqeul uumlqelu uumluqle uumluqel uumlulqe
uumluleq uumluelq uumlueql uumlequl uumleqlu uumleuql uumleulq uumleluq uumlelqu uumelqlu uumelqul
uumellqu uumelluq uumelulq uumeluql uumeqllu uumeqlul uumeqllu uumeqlul uumequll uumequll uumelqlu
uumelqul uumellqu uumelluq uumelulq uumeluql uumeuqll uumeuqll uumeulql uumeullq uumeullq uumeulql
uuqumlle uuqumlel uuqumlle uuqumlel uuqumell uuqumell uuqulmle uuqulmel uuqullme uuqullem uuqulelm
uuquleml uuqullme uuqullem uuqulmle uuqulmel uuquleml uuqulelm uuquellm uuquelml uuquellm uuquelml
uuquemll uuquemll uuqmulle uuqmulel uuqmulle uuqmulel uuqmuell uuqmuell uuqmlule uuqmluel uuqmllue
uuqmlleu uuqmlelu uuqmleul uuqmllue uuqmlleu uuqmlule uuqmluel uuqmleul uuqmlelu uuqmellu uuqmelul
uuqmellu uuqmelul uuqmeull uuqmeull uuqlmule uuqlmuel uuqlmlue uuqlmleu uuqlmelu uuqlmeul uuqlumle
uuqlumel uuqlulme uuqlulem uuqluelm uuqlueml uuqllume uuqlluem uuqllmue uuqllmeu uuqllemu uuqlleum
uuqleulm uuqleuml uuqlelum uuqlelmu uuqlemlu uuqlemul uuqlmlue uuqlmleu uuqlmule uuqlmuel uuqlmeul
uuqlmelu uuqllmue uuqllmeu uuqllume uuqlluem uuqlleum uuqllemu uuqlulme uuqlulem uuqlumle uuqlumel
uuqlueml uuqluelm uuqlelum uuqlelmu uuqleulm uuqleuml uuqlemul uuqlemlu uuqemllu uuqemlul uuqemllu
uuqemlul uuqemull uuqemull uuqelmlu uuqelmul uuqellmu uuqellum uuqelulm uuqeluml uuqellmu uuqellum
uuqelmlu uuqelmul uuqeluml uuqelulm uuqeullm uuqeulml uuqeullm uuqeulml uuqeumll uuqeumll uulumqle
uulumqel uulumlqe uulumleq uulumelq uulumeql uuluqmle uuluqmel uuluqlme uuluqlem uuluqelm uuluqeml
uululqme uululqem uululmqe uululmeq uululemq uululeqm uulueqlm uulueqml uuluelqm uuluelmq uuluemlq
uuluemql uulmuqle uulmuqel uulmulqe uulmuleq uulmuelq uulmueql uulmqule uulmquel uulmqlue uulmqleu
uulmqelu uulmqeul uulmlque uulmlqeu uulmluqe uulmlueq uulmleuq uulmlequ uulmeqlu uulmequl uulmelqu
uulmeluq uulmeulq uulmeuql uulqmule uulqmuel uulqmlue uulqmleu uulqmelu uulqmeul uulqumle uulqumel
uulqulme uulqulem uulquelm uulqueml uulqlume uulqluem uulqlmue uulqlmeu uulqlemu uulqleum uulqeulm
uulqeuml uulqelum uulqelmu uulqemlu uulqemul uullmque uullmqeu uullmuqe uullmueq uullmeuq uullmequ
uullqmue uullqmeu uullqume uullquem uullqeum uullqemu uulluqme uulluqem uullumqe uullumeq uulluemq
uullueqm uullequm uulleqmu uulleuqm uulleumq uullemuq uullemqu uulemqlu uulemqul uulemlqu uulemluq
uulemulq uulemuql uuleqmlu uuleqmul uuleqlmu uuleqlum uulequlm uulequml uulelqmu uulelqum uulelmqu
uulelmuq uulelumq uuleluqm uuleuqlm uuleuqml uuleulqm uuleulmq uuleumlq uuleumql uueumqll uueumqll
uueumlql uueumllq uueumllq uueumlql uueuqmll uueuqmll uueuqlml uueuqllm uueuqllm uueuqlml uueulqml
uueulqlm uueulmql uueulmlq uueullmq uueullqm uueulqlm uueulqml uueullqm uueullmq uueulmlq uueulmql
uuemuqll uuemuqll uuemulql uuemullq uuemullq uuemulql uuemqull uuemqull uuemqlul uuemqllu uuemqllu
uuemqlul uuemlqul uuemlqlu uuemluql uuemlulq uuemlluq uuemllqu uuemlqlu uuemlqul uuemllqu uuemlluq
uuemlulq uuemluql uueqmull uueqmull uueqmlul uueqmllu uueqmllu uueqmlul uuequmll uuequmll uuequlml
uuequllm uuequllm uuequlml uueqluml uueqlulm uueqlmul uueqlmlu uueqllmu uueqllum uueqlulm uueqluml
uueqllum uueqllmu uueqlmlu uueqlmul uuelmqul uuelmqlu uuelmuql uuelmulq uuelmluq uuelmlqu uuelqmul
uuelqmlu uuelquml uuelqulm uuelqlum uuelqlmu uueluqml uueluqlm uuelumql uuelumlq uuelulmq uuelulqm
uuellqum uuellqmu uuelluqm uuellumq uuellmuq uuellmqu uuelmqlu uuelmqul uuelmlqu uuelmluq uuelmulq
uuelmuql uuelqmlu uuelqmul uuelqlmu uuelqlum uuelqulm uuelquml uuellqmu uuellqum uuellmqu uuellmuq
uuellumq uuelluqm uueluqlm uueluqml uuelulqm uuelulmq uuelumlq uuelumql uelumqul uelumqlu uelumuql
uelumulq uelumluq uelumlqu ueluqmul ueluqmlu ueluquml ueluqulm ueluqlum ueluqlmu ueluuqml ueluuqlm
ueluumql ueluumlq ueluulmq ueluulqm uelulqum uelulqmu ueluluqm uelulumq uelulmuq uelulmqu uelmuqul
uelmuqlu uelmuuql uelmuulq uelmuluq uelmulqu uelmquul uelmqulu uelmquul uelmqulu uelmqluu uelmqluu
uelmuqul uelmuqlu uelmuuql uelmuulq uelmuluq uelmulqu uelmlquu uelmlquu uelmluqu uelmluuq uelmluuq
uelmluqu uelqmuul uelqmulu uelqmuul uelqmulu uelqmluu uelqmluu uelqumul uelqumlu uelquuml uelquulm
uelqulum uelqulmu uelquuml uelquulm uelqumul uelqumlu uelqulmu uelqulum uelqluum uelqlumu uelqluum
uelqlumu uelqlmuu uelqlmuu uelumqul uelumqlu uelumuql uelumulq uelumluq uelumlqu ueluqmul ueluqmlu
ueluquml ueluqulm ueluqlum ueluqlmu ueluuqml ueluuqlm ueluumql ueluumlq ueluulmq ueluulqm uelulqum
uelulqmu ueluluqm uelulumq uelulmuq uelulmqu uellmquu uellmquu uellmuqu uellmuuq uellmuuq uellmuqu
uellqmuu uellqmuu uellqumu uellquum uellquum uellqumu uelluqmu uelluqum uellumqu uellumuq uelluumq
uelluuqm uelluqum uelluqmu uelluuqm uelluumq uellumuq uellumqu ueulmqul ueulmqlu ueulmuql ueulmulq
ueulmluq ueulmlqu ueulqmul ueulqmlu ueulquml ueulqulm ueulqlum ueulqlmu ueuluqml ueuluqlm ueulumql
ueulumlq ueululmq ueululqm ueullqum ueullqmu ueulluqm ueullumq ueullmuq ueullmqu ueumlqul ueumlqlu
ueumluql ueumlulq ueumlluq ueumllqu ueumqlul ueumqllu ueumqull ueumqull ueumqlul ueumqllu ueumuqll
ueumuqll ueumulql ueumullq ueumullq ueumulql ueumlqul ueumlqlu ueumluql ueumlulq ueumlluq ueumllqu
ueuqmlul ueuqmllu ueuqmull ueuqmull ueuqmlul ueuqmllu ueuqlmul ueuqlmlu ueuqluml ueuqlulm ueuqllum
ueuqllmu ueuqulml ueuqullm ueuqumll ueuqumll ueuqulml ueuqullm ueuqllum ueuqllmu ueuqlulm ueuqluml
ueuqlmul ueuqlmlu ueuumqll ueuumqll ueuumlql ueuumllq ueuumllq ueuumlql ueuuqmll ueuuqmll ueuuqlml
ueuuqllm ueuuqllm ueuuqlml ueuulqml ueuulqlm ueuulmql ueuulmlq ueuullmq ueuullqm ueuulqlm ueuulqml
ueuullqm ueuullmq ueuulmlq ueuulmql ueulmqul ueulmqlu ueulmuql ueulmulq ueulmluq ueulmlqu ueulqmul
ueulqmlu ueulquml ueulqulm ueulqlum ueulqlmu ueuluqml ueuluqlm ueulumql ueulumlq ueululmq ueululqm
ueullqum ueullqmu ueulluqm ueullumq ueullmuq ueullmqu uemulqul uemulqlu uemuluql uemululq uemulluq
uemullqu uemuqlul uemuqllu uemuqull uemuqull uemuqlul uemuqllu uemuuqll uemuuqll uemuulql uemuullq
uemuullq uemuulql uemulqul uemulqlu uemuluql uemululq uemulluq uemullqu uemluqul uemluqlu uemluuql
uemluulq uemluluq uemlulqu uemlquul uemlqulu uemlquul uemlqulu uemlqluu uemlqluu uemluqul uemluqlu
uemluuql uemluulq uemluluq uemlulqu uemllquu uemllquu uemlluqu uemlluuq uemlluuq uemlluqu uemqluul
uemqlulu uemqluul uemqlulu uemqlluu uemqlluu uemqulul uemqullu uemquull uemquull uemqulul uemqullu
uemquull uemquull uemqulul uemqullu uemqullu uemqulul uemqluul uemqlulu uemqluul uemqlulu uemqlluu
uemqlluu uemulqul uemulqlu uemuluql uemululq uemulluq uemullqu uemuqlul uemuqllu uemuqull uemuqull
uemuqlul uemuqllu uemuuqll uemuuqll uemuulql uemuullq uemuullq uemuulql uemulqul uemulqlu uemuluql
uemululq uemulluq uemullqu uemllquu uemllquu uemlluqu uemlluuq uemlluuq uemlluqu uemlqluu uemlqluu
uemlqulu uemlquul uemlquul uemlqulu uemluqlu uemluqul uemlulqu uemluluq uemluulq uemluuql uemluqul
uemluqlu uemluuql uemluulq uemluluq uemlulqu uequmlul uequmllu uequmull uequmull uequmlul uequmllu
uequlmul uequlmlu uequluml ueqululm uequllum uequllmu uequulml uequullm uequumll uequumll uequulml
uequullm uequllum uequllmu ueqululm uequluml uequlmul uequlmlu ueqmulul ueqmullu ueqmuull ueqmuull
ueqmulul ueqmullu ueqmluul ueqmlulu ueqmluul ueqmlulu ueqmlluu ueqmlluu ueqmulul ueqmullu ueqmuull
ueqmuull ueqmulul ueqmullu ueqmlluu ueqmlluu ueqmlulu ueqmluul ueqmluul ueqmlulu ueqlmuul ueqlmulu
ueqlmuul ueqlmulu ueqlmluu ueqlmluu ueqlumul ueqlumlu ueqluuml ueqluulm ueqlulum ueqlulmu ueqluuml
ueqluulm ueqlumul ueqlumlu ueqlulmu ueqlulum ueqlluum ueqllumu ueqlluum ueqllumu ueqllmuu ueqllmuu
uequmlul uequmllu uequmull uequmull uequmlul uequmllu uequlmul uequlmlu uequluml ueqululm uequllum
uequllmu uequulml uequullm uequumll uequumll uequulml uequullm uequllum uequllmu ueqululm uequluml
uequlmul uequlmlu ueqlmluu ueqlmluu ueqlmulu ueqlmuul ueqlmuul ueqlmulu ueqllmuu ueqllmuu ueqllumu
ueqlluum ueqlluum ueqllumu ueqlulmu ueqlulum ueqlumlu ueqlumul ueqluuml ueqluulm ueqlulum ueqlulmu
ueqluulm ueqluuml ueqlumul ueqlumlu ueuumqll ueuumqll ueuumlql ueuumllq ueuumllq ueuumlql ueuuqmll
ueuuqmll ueuuqlml ueuuqllm ueuuqllm ueuuqlml ueuulqml ueuulqlm ueuulmql ueuulmlq ueuullmq ueuullqm
ueuulqlm ueuulqml ueuullqm ueuullmq ueuulmlq ueuulmql ueumuqll ueumuqll ueumulql ueumullq ueumullq
ueumulql ueumqull ueumqull ueumqlul ueumqllu ueumqllu ueumqlul ueumlqul ueumlqlu ueumluql ueumlulq
ueumlluq ueumllqu ueumlqlu ueumlqul ueumllqu ueumlluq ueumlulq ueumluql ueuqmull ueuqmull ueuqmlul
ueuqmllu ueuqmllu ueuqmlul ueuqumll ueuqumll ueuqulml ueuqullm ueuqullm ueuqulml ueuqluml ueuqlulm
ueuqlmul ueuqlmlu ueuqllmu ueuqllum ueuqlulm ueuqluml ueuqllum ueuqllmu ueuqlmlu ueuqlmul ueulmqul
ueulmqlu ueulmuql ueulmulq ueulmluq ueulmlqu ueulqmul ueulqmlu ueulquml ueulqulm ueulqlum ueulqlmu
ueuluqml ueuluqlm ueulumql ueulumlq ueululmq ueululqm ueullqum ueullqmu ueulluqm ueullumq ueullmuq
ueullmqu ueulmqlu ueulmqul ueulmlqu ueulmluq ueulmulq ueulmuql ueulqmlu ueulqmul ueulqlmu ueulqlum
ueulqulm ueulquml ueullqmu ueullqum ueullmqu ueullmuq ueullumq ueulluqm ueuluqlm ueuluqml ueululqm
ueululmq ueulumlq ueulumql uelumqul uelumqlu uelumuql uelumulq uelumluq uelumlqu ueluqmul ueluqmlu
ueluquml ueluqulm ueluqlum ueluqlmu ueluuqml ueluuqlm ueluumql ueluumlq ueluulmq ueluulqm uelulqum
uelulqmu ueluluqm uelulumq uelulmuq uelulmqu uelmuqul uelmuqlu uelmuuql uelmuulq uelmuluq uelmulqu
uelmquul uelmqulu uelmquul uelmqulu uelmqluu uelmqluu uelmuqul uelmuqlu uelmuuql uelmuulq uelmuluq
uelmulqu uelmlquu uelmlquu uelmluqu uelmluuq uelmluuq uelmluqu uelqmuul uelqmulu uelqmuul uelqmulu
uelqmluu uelqmluu uelqumul uelqumlu uelquuml uelquulm uelqulum uelqulmu uelquuml uelquulm uelqumul
uelqumlu uelqulmu uelqulum uelqluum uelqlumu uelqluum uelqlumu uelqlmuu uelqlmuu uelumqul uelumqlu
uelumuql uelumulq uelumluq uelumlqu ueluqmul ueluqmlu ueluquml ueluqulm ueluqlum ueluqlmu ueluuqml
ueluuqlm ueluumql ueluumlq ueluulmq ueluulqm uelulqum uelulqmu ueluluqm uelulumq uelulmuq uelulmqu
uellmquu uellmquu uellmuqu uellmuuq uellmuuq uellmuqu uellqmuu uellqmuu uellqumu uellquum uellquum
uellqumu uelluqmu uelluqum uellumqu uellumuq uelluumq uelluuqm uelluqum uelluqmu uelluuqm uelluumq
uellumuq uellumqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us