easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

laridae

katrae

kulikova

pirtleville

swilling

proportional

ansate

deleads

amplificatory

tilborgh

archdeaconess

exaudiret

pollina

lepidomelane

heroogony

joensuu

unattentive

hpsscab


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: uganda
cipher variations:
vhboeb wicpfc xjdqgd ykerhe zlfsif
amgtjg bnhukh coivli dpjwmj eqkxnk
frlyol gsmzpm htnaqn iuobro jvpcsp
kwqdtq lxreur mysfvs nztgwt oauhxu
pbviyv qcwjzw rdxkax seylby tfzmcz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: uganda
Cipher: ftzmwz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: uganda
Cipher: BAABB AABBA AAAAA ABBAA AAABB AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: uganda
cipher variations:
vhboebjtbokbxfboqblrbowbzdbocbnpboibpnboubdzboab
rlbogbfxbombtjbosbhvboybwicpfckucplcygcprcmscpxc
aecpdcoqcpjcqocpvceacpbcsmcphcgycpncukcptciwcpzc
xjdqgdlvdqmdzhdqsdntdqydbfdqedprdqkdrpdqwdfbdqcd
tndqidhzdqodvldqudjxdqadykerhemwerneaierteouerze
cgerfeqserlesqerxegcerdeuoerjeiaerpewmervekyerbe
zlfsifnxfsofbjfsufpvfsafdhfsgfrtfsmftrfsyfhdfsef
vpfskfjbfsqfxnfswflzfscfamgtjgoygtpgckgtvgqwgtbg
eigthgsugtngusgtzgiegtfgwqgtlgkcgtrgyogtxgmagtdg
bnhukhpzhuqhdlhuwhrxhuchfjhuihtvhuohvthuahjfhugh
xrhumhldhushzphuyhnbhuehcoivliqaivriemivxisyivdi
gkivjiuwivpiwuivbikgivhiysivnimeivtiaqivziocivfi
dpjwmjrbjwsjfnjwyjtzjwejhljwkjvxjwqjxvjwcjlhjwij
ztjwojnfjwujbrjwajpdjwgjeqkxnksckxtkgokxzkuakxfk
imkxlkwykxrkywkxdkmikxjkaukxpkogkxvkcskxbkqekxhk
frlyoltdlyulhplyalvblygljnlymlxzlyslzxlyelnjlykl
bvlyqlphlywldtlyclrflyilgsmzpmuemzvmiqmzbmwcmzhm
komznmyamztmaymzfmokmzlmcwmzrmqimzxmeumzdmsgmzjm
htnaqnvfnawnjrnacnxdnainlpnaonzbnaunbznagnplnamn
dxnasnrjnaynfvnaenthnakniuobrowgobxoksobdoyeobjo
mqobpoacobvocaobhoqmobnoeyobtoskobzogwobfouioblo
jvpcspxhpcypltpcepzfpckpnrpcqpbdpcwpdbpciprnpcop
fzpcuptlpcaphxpcgpvjpcmpkwqdtqyiqdzqmuqdfqagqdlq
osqdrqceqdxqecqdjqsoqdpqgaqdvqumqdbqiyqdhqwkqdnq
lxreurzjrearnvregrbhremrptresrdfreyrfdrekrtpreqr
hbrewrvnrecrjzreirxlreormysfvsaksfbsowsfhscisfns
qusftsegsfzsgesflsuqsfrsicsfxswosfdskasfjsymsfps
nztgwtbltgctpxtgitdjtgotrvtgutfhtgathftgmtvrtgst
jdtgytxptgetlbtgktzntgqtoauhxucmuhduqyuhjuekuhpu
swuhvugiuhbuiguhnuwsuhtukeuhzuyquhfumcuhluaouhru
pbviyvdnvievrzvikvflviqvtxviwvhjvicvjhviovxtviuv
lfviavzrvigvndvimvbpvisvqcwjzweowjfwsawjlwgmwjrw
uywjxwikwjdwkiwjpwyuwjvwmgwjbwaswjhwoewjnwcqwjtw
rdxkaxfpxkgxtbxkmxhnxksxvzxkyxjlxkexljxkqxzvxkwx
nhxkcxbtxkixpfxkoxdrxkuxseylbygqylhyucylnyioylty
waylzykmylfymkylryawylxyoiyldycuyljyqgylpyesylvy
tfzmczhrzmizvdzmozjpzmuzxbzmazlnzmgznlzmszbxzmyz
pjzmezdvzmkzrhzmqzftzmwzugandaisanjaweanpakqanva
ycanbamoanhaomantacyanzaqkanfaewanlasianraguanxa

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: uganda
Cipher: htnaqn

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: uganda
Cipher: 542211334111

Extended Methods:
Method #1

Plaintext: uganda
method variations:
zmfsiferlxolkwqctqpbvhyv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
u g a n d a 
5 2 1 3 4 1 
4 2 1 3 1 1 
They are then read out in rows:
521341421311
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: uganda
Cipher: kldila

Read more ...
Method #3

Plaintext: uganda
method variations:
iblsav blsavi lsavib
savibl avibls viblsa

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: uganda

all 720 cipher variations:
uganda uganad ugadna ugadan ugaadn ugaand ugnada ugnaad ugndaa ugndaa ugnada
ugnaad ugdnaa ugdnaa ugdana ugdaan ugdaan ugdana uganda uganad ugadna ugadan
ugaadn ugaand uagnda uagnad uagdna uagdan uagadn uagand uangda uangad uandga
uandag uanadg uanagd uadnga uadnag uadgna uadgan uadagn uadang uaandg uaangd
uaadng uaadgn uaagdn uaagnd unagda unagad unadga unadag unaadg unaagd ungada
ungaad ungdaa ungdaa ungada ungaad undgaa undgaa undaga undaag undaag undaga
unagda unagad unadga unadag unaadg unaagd udanga udanag udagna udagan udaagn
udaang udnaga udnaag udngaa udngaa udnaga udnaag udgnaa udgnaa udgana udgaan
udgaan udgana udanga udanag udagna udagan udaagn udaang uaandg uaangd uaadng
uaadgn uaagdn uaagnd uanadg uanagd uandag uandga uangda uangad uadnag uadnga
uadang uadagn uadgan uadgna uagnda uagnad uagdna uagdan uagadn uagand guanda
guanad guadna guadan guaadn guaand gunada gunaad gundaa gundaa gunada gunaad
gudnaa gudnaa gudana gudaan gudaan gudana guanda guanad guadna guadan guaadn
guaand gaunda gaunad gaudna gaudan gauadn gauand ganuda ganuad gandua gandau
ganadu ganaud gadnua gadnau gaduna gaduan gadaun gadanu gaandu gaanud gaadnu
gaadun gaaudn gaaund gnauda gnauad gnadua gnadau gnaadu gnaaud gnuada gnuaad
gnudaa gnudaa gnuada gnuaad gnduaa gnduaa gndaua gndaau gndaau gndaua gnauda
gnauad gnadua gnadau gnaadu gnaaud gdanua gdanau gdauna gdauan gdaaun gdaanu
gdnaua gdnaau gdnuaa gdnuaa gdnaua gdnaau gdunaa gdunaa gduana gduaan gduaan
gduana gdanua gdanau gdauna gdauan gdaaun gdaanu gaandu gaanud gaadnu gaadun
gaaudn gaaund ganadu ganaud gandau gandua ganuda ganuad gadnau gadnua gadanu
gadaun gaduan gaduna gaunda gaunad gaudna gaudan gauadn gauand agunda agunad
agudna agudan aguadn aguand agnuda agnuad agndua agndau agnadu agnaud agdnua
agdnau agduna agduan agdaun agdanu agandu aganud agadnu agadun agaudn agaund
augnda augnad augdna augdan augadn augand aungda aungad aundga aundag aunadg
aunagd audnga audnag audgna audgan audagn audang auandg auangd auadng auadgn
auagdn auagnd anugda anugad anudga anudag anuadg anuagd anguda anguad angdua
angdau angadu angaud andgua andgau anduga anduag andaug andagu anagdu anagud
anadgu anadug anaudg anaugd adunga adunag adugna adugan aduagn aduang adnuga
adnuag adngua adngau adnagu adnaug adgnua adgnau adguna adguan adgaun adganu
adangu adanug adagnu adagun adaugn adaung aaundg aaungd aaudng aaudgn aaugdn
aaugnd aanudg aanugd aandug aandgu aangdu aangud aadnug aadngu aadung aadugn
aadgun aadgnu aagndu aagnud aagdnu aagdun aagudn aagund ngauda ngauad ngadua
ngadau ngaadu ngaaud nguada nguaad ngudaa ngudaa nguada nguaad ngduaa ngduaa
ngdaua ngdaau ngdaau ngdaua ngauda ngauad ngadua ngadau ngaadu ngaaud naguda
naguad nagdua nagdau nagadu nagaud naugda naugad naudga naudag nauadg nauagd
naduga naduag nadgua nadgau nadagu nadaug naaudg naaugd naadug naadgu naagdu
naagud nuagda nuagad nuadga nuadag nuaadg nuaagd nugada nugaad nugdaa nugdaa
nugada nugaad nudgaa nudgaa nudaga nudaag nudaag nudaga nuagda nuagad nuadga
nuadag nuaadg nuaagd ndauga ndauag ndagua ndagau ndaagu ndaaug nduaga nduaag
ndugaa ndugaa nduaga nduaag ndguaa ndguaa ndgaua ndgaau ndgaau ndgaua ndauga
ndauag ndagua ndagau ndaagu ndaaug naaudg naaugd naadug naadgu naagdu naagud
nauadg nauagd naudag naudga naugda naugad naduag naduga nadaug nadagu nadgau
nadgua naguda naguad nagdua nagdau nagadu nagaud dganua dganau dgauna dgauan
dgaaun dgaanu dgnaua dgnaau dgnuaa dgnuaa dgnaua dgnaau dgunaa dgunaa dguana
dguaan dguaan dguana dganua dganau dgauna dgauan dgaaun dgaanu dagnua dagnau
daguna daguan dagaun daganu dangua dangau danuga danuag danaug danagu daunga
daunag daugna daugan dauagn dauang daanug daangu daaung daaugn daagun daagnu
dnagua dnagau dnauga dnauag dnaaug dnaagu dngaua dngaau dnguaa dnguaa dngaua
dngaau dnugaa dnugaa dnuaga dnuaag dnuaag dnuaga dnagua dnagau dnauga dnauag
dnaaug dnaagu duanga duanag duagna duagan duaagn duaang dunaga dunaag dungaa
dungaa dunaga dunaag dugnaa dugnaa dugana dugaan dugaan dugana duanga duanag
duagna duagan duaagn duaang daanug daangu daaung daaugn daagun daagnu danaug
danagu danuag danuga dangua dangau daunag daunga dauang dauagn daugan daugna
dagnua dagnau daguna daguan dagaun daganu agandu aganud agadnu agadun agaudn
agaund agnadu agnaud agndau agndua agnuda agnuad agdnau agdnua agdanu agdaun
agduan agduna agunda agunad agudna agudan aguadn aguand aagndu aagnud aagdnu
aagdun aagudn aagund aangdu aangud aandgu aandug aanudg aanugd aadngu aadnug
aadgnu aadgun aadugn aadung aaundg aaungd aaudng aaudgn aaugdn aaugnd anagdu
anagud anadgu anadug anaudg anaugd angadu angaud angdau angdua anguda anguad
andgau andgua andagu andaug anduag anduga anugda anugad anudga anudag anuadg
anuagd adangu adanug adagnu adagun adaugn adaung adnagu adnaug adngau adngua
adnuga adnuag adgnau adgnua adganu adgaun adguan adguna adunga adunag adugna
adugan aduagn aduang auandg auangd auadng auadgn auagdn auagnd aunadg aunagd
aundag aundga aungda aungad audnag audnga audang audagn audgan audgna augnda
augnad augdna augdan augadn augand

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us