easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

assonantal

presenter

megachiroptera

mongrelism

sugiura

darnay

uerbaque

undenounced

celeravistis

spiros

baruk

ulciscor

vacaveris

sweepiest

declararesque

salivon

trmac

premonetary


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: uersareque
cipher variations:
vfstbsfrvf wgtuctgswg xhuvduhtxh yivweviuyi zjwxfwjvzj
akxygxkwak blyzhylxbl cmzaizmycm dnabjanzdn eobckboaeo
fpcdlcpbfp gqdemdqcgq hrefnerdhr isfgofseis jtghpgtfjt
kuhiqhugku lvijrivhlv mwjksjwimw nxkltkxjnx oylmulykoy
pzmnvmzlpz qanownamqa rbopxobnrb scpqypcosc tdqrzqdptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: uersareque
Cipher: fvihzivjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: uersareque
Cipher: BAABB AABAA BAAAA BAAAB AAAAA BAAAA AABAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: uersareque
cipher variations:
vfstbsfrvfjnadbanxjnxvinbivdxvldqxbqdjldzlyhbylpzlntgrbgtvntpjwlbwjhpjdrevberndr
rzmfbmztrzfhupbuhzfhtpczbcpftphxkjbkxlhxwgtuctgswgkobecboykoywjocjweywmerycrekme
amziczmqamouhschuwouqkxmcxkiqkesfwcfsoessangcnausagivqcviagiuqdacdqguqiylkclymiy
xhuvduhtxhlpcfdcpzlpzxkpdkxfzxnfszdsflnfbnajdanrbnpvitdivxpvrlyndyljrlftgxdgtpft
tbohdobvtbhjwrdwjbhjvrebderhvrjzmldmznjzyivweviuyimqdgedqamqaylqelygayogtaetgmog
cobkeboscoqwjuejwyqwsmzoezmksmguhyehuqguucpiepcwucikxsexkcikwsfcefsiwskanmenaoka
zjwxfwjvzjnrehferbnrbzmrfmzhbzphubfuhnphdpclfcptdprxkvfkxzrxtnapfanltnhvizfivrhv
vdqjfqdxvdjlytfyldjlxtgdfgtjxtlbonfobplbakxygxkwakosfigfscoscansgnaicaqivcgvioqi
eqdmgdqueqsylwglyasyuobqgbomuoiwjagjwsiwwerkgreywekmzugzmekmyuheghukyumcpogpcqmc
blyzhylxblptgjhgtdptdbothobjdbrjwdhwjprjfrenhervfrtzmxhmzbtzvpcrhcpnvpjxkbhkxtjx
xfslhsfzxflnavhanflnzvifhivlzvndqphqdrndcmzaizmycmquhkihuequecpuipckecskxeixkqsk
gsfoifswgsuanyinacuawqdsidqowqkylcilyukyygtmitgaygmobwibogmoawjgijwmawoerqiresoe
dnabjanzdnrviljivfrvfdqvjqdlfdtlyfjylrtlhtgpjgtxhtvbozjobdvbxretjerpxrlzmdjmzvlz
zhunjuhbzhnpcxjcphnpbxkhjkxnbxpfsrjsftpfeobckboaeoswjmkjwgswgerwkremgeumzgkzmsum
iuhqkhuyiuwcpakpcewcysfukfsqysmaneknawmaaivokvicaioqdykdqioqcyliklyocyqgtsktguqg
fpcdlcpbfptxknlkxhtxhfsxlsfnhfvnahlantvnjvirlivzjvxdqblqdfxdztgvlgtrztnboflobxnb
bjwplwjdbjprezlerjprdzmjlmzpdzrhutluhvrhgqdemdqcgquylomlyiuyigtymtgoigwobimbouwo
kwjsmjwakwyercmregyeauhwmhusauocpgmpcyocckxqmxkeckqsfamfskqseankmnaqeasivumviwsi
hrefnerdhrvzmpnmzjvzjhuznuhpjhxpcjncpvxplxktnkxblxzfsdnsfhzfbvixnivtbvpdqhnqdzpd
dlyrnylfdlrtgbngtlrtfbolnobrfbtjwvnwjxtjisfgofseiswanqonakwakivaoviqkiyqdkodqwyq
myluolycmyagteotgiagcwjyojwucwqerioreaqeemzsozmgemsuhcohumsugcpmopcsgcukxwoxkyuk
jtghpgtfjtxborpoblxbljwbpwjrljzrelperxzrnzmvpmzdnzbhufpuhjbhdxkzpkxvdxrfsjpsfbrf
fnatpanhfntvidpivntvhdqnpqdthdvlyxpylzvlkuhiqhugkuycpsqpcmycmkxcqxksmkasfmqfsyas
oanwqnaeoacivgqvikcieylaqlyweysgtkqtgcsggobuqboigouwjeqjwouwieroqreuiewmzyqzmawm
lvijrivhlvzdqtrqdnzdnlydryltnlbtgnrgtzbtpboxrobfpbdjwhrwjldjfzmbrmzxfzthulruhdth
hpcvrcpjhpvxkfrkxpvxjfsprsfvjfxnazranbxnmwjksjwimwaerusreoaeomzeszmuomcuhoshuacu
qcpyspcgqcekxisxkmekgancsnaygauivmsvieuiiqdwsdqkiqwylgslyqwykgtqstgwkgyobasbocyo
nxkltkxjnxbfsvtsfpbfpnaftanvpndviptivbdvrdqztqdhrdflyjtylnflhbodtobzhbvjwntwjfvj
jrexterljrxzmhtmzrxzlhurtuhxlhzpcbtcpdzpoylmulykoycgtwutgqcgqobgubowqoewjqujwcew
seraureisegmzkuzmogmicpeupcaicwkxouxkgwkksfyufsmksyaniunasyamivsuviymiaqdcudqeaq
pzmnvmzlpzdhuxvuhrdhrpchvcpxrpfxkrvkxdfxtfsbvsfjtfhnalvanphnjdqfvqdbjdxlypvylhxl
ltgzvgtnltzbojvobtzbnjwtvwjznjbredverfbrqanownamqaeivywviseisqdiwdqysqgylswlyegy
ugtcwtgkugiobmwboqiokergwreckeymzqwzmiymmuhawhuomuacpkwpcuacokxuwxkaokcsfewfsgcs
rbopxobnrbfjwzxwjtfjtrejxerztrhzmtxmzfhzvhudxuhlvhjpcnxcprjplfshxsfdlfznarxanjzn
nvibxivpnvbdqlxqdvbdplyvxylbpldtgfxgthdtscpqypcoscgkxayxkugkusfkyfsausianuynagia
wiveyvimwikqdoydqskqmgtiytgemgaobsybokaoowjcyjwqowcermyrewceqmzwyzmcqmeuhgyhuieu
tdqrzqdptdhlybzylvhlvtglzgtbvtjbovzobhjbxjwfzwjnxjlrepzertlrnhujzuhfnhbpctzcplbp
pxkdzkxrpxdfsnzsfxdfrnaxzandrnfvihzivjfvuersarequeimzcazmwimwuhmahucwukcpwapcikc
ykxgaxkoykmsfqafsumsoivkavigoicqduadqmcqqylealysqyegtoatgyegsobyaboesogwjiajwkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: uersareque
Cipher: hrefnerdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: uersareque
Cipher: 54512434112451145451

Extended Methods:
Method #1

Plaintext: uersareque
method variations:
zkwxfwkvzkepbclbpaepkughqgufkupzmnvmzlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
u e r s a r e q u e 
5 5 2 3 1 2 5 1 5 5 
4 1 4 4 1 4 1 4 4 1 
They are then read out in rows:
55231251554144141441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: uersareque
Cipher: zmfezdtqqd

Read more ...
Method #3

Plaintext: uersareque
method variations:
yfodfyayyv fodfyayyvy odfyayyvyf
dfyayyvyfo fyayyvyfod yayyvyfodf
ayyvyfodfy yyvyfodfya yvyfodfyay
vyfodfyayy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: uersareque

first 5040 cipher variations(3628800 total)
uersareque uersareqeu uersareuqe uersareueq uersareeuq uersareequ uersarqeue uersarqeeu uersarquee uersarquee uersarqeue
uersarqeeu uersaruqee uersaruqee uersarueqe uersarueeq uersarueeq uersarueqe uersareque uersareqeu uersareuqe uersareueq
uersareeuq uersareequ uersaerque uersaerqeu uersaeruqe uersaerueq uersaereuq uersaerequ uersaeqrue uersaeqreu uersaequre
uersaequer uersaeqeur uersaeqeru uersaeuqre uersaeuqer uersaeurqe uersaeureq uersaeuerq uersaeueqr uersaeequr uersaeeqru
uersaeeuqr uersaeeurq uersaeeruq uersaeerqu uersaqerue uersaqereu uersaqeure uersaqeuer uersaqeeur uersaqeeru uersaqreue
uersaqreeu uersaqruee uersaqruee uersaqreue uersaqreeu uersaquree uersaquree uersaquere uersaqueer uersaqueer uersaquere
uersaqerue uersaqereu uersaqeure uersaqeuer uersaqeeur uersaqeeru uersaueqre uersaueqer uersauerqe uersauereq uersaueerq
uersaueeqr uersauqere uersauqeer uersauqree uersauqree uersauqere uersauqeer uersaurqee uersaurqee uersaureqe uersaureeq
uersaureeq uersaureqe uersaueqre uersaueqer uersauerqe uersauereq uersaueerq uersaueeqr uersaeequr uersaeeqru uersaeeuqr
uersaeeurq uersaeeruq uersaeerqu uersaeqeur uersaeqeru uersaequer uersaequre uersaeqrue uersaeqreu uersaeuqer uersaeuqre
uersaeueqr uersaeuerq uersaeureq uersaeurqe uersaerque uersaerqeu uersaeruqe uersaerueq uersaereuq uersaerequ uersraeque
uersraeqeu uersraeuqe uersraeueq uersraeeuq uersraeequ uersraqeue uersraqeeu uersraquee uersraquee uersraqeue uersraqeeu
uersrauqee uersrauqee uersraueqe uersraueeq uersraueeq uersraueqe uersraeque uersraeqeu uersraeuqe uersraeueq uersraeeuq
uersraeequ uersreaque uersreaqeu uersreauqe uersreaueq uersreaeuq uersreaequ uersreqaue uersreqaeu uersrequae uersrequea
uersreqeua uersreqeau uersreuqae uersreuqea uersreuaqe uersreuaeq uersreueaq uersreueqa uersreequa uersreeqau uersreeuqa
uersreeuaq uersreeauq uersreeaqu uersrqeaue uersrqeaeu uersrqeuae uersrqeuea uersrqeeua uersrqeeau uersrqaeue uersrqaeeu
uersrqauee uersrqauee uersrqaeue uersrqaeeu uersrquaee uersrquaee uersrqueae uersrqueea uersrqueea uersrqueae uersrqeaue
uersrqeaeu uersrqeuae uersrqeuea uersrqeeua uersrqeeau uersrueqae uersrueqea uersrueaqe uersrueaeq uersrueeaq uersrueeqa
uersruqeae uersruqeea uersruqaee uersruqaee uersruqeae uersruqeea uersruaqee uersruaqee uersruaeqe uersruaeeq uersruaeeq
uersruaeqe uersrueqae uersrueqea uersrueaqe uersrueaeq uersrueeaq uersrueeqa uersreequa uersreeqau uersreeuqa uersreeuaq
uersreeauq uersreeaqu uersreqeua uersreqeau uersrequea uersrequae uersreqaue uersreqaeu uersreuqea uersreuqae uersreueqa
uersreueaq uersreuaeq uersreuaqe uersreaque uersreaqeu uersreauqe uersreaueq uersreaeuq uersreaequ uerseraque uerseraqeu
uerserauqe uerseraueq uerseraeuq uerseraequ uerserqaue uerserqaeu uerserquae uerserquea uerserqeua uerserqeau uerseruqae
uerseruqea uerseruaqe uerseruaeq uerserueaq uerserueqa uerserequa uersereqau uersereuqa uersereuaq uersereauq uersereaqu
uersearque uersearqeu uersearuqe uersearueq uerseareuq uersearequ uerseaqrue uerseaqreu uerseaqure uerseaquer uerseaqeur
uerseaqeru uerseauqre uerseauqer uerseaurqe uerseaureq uerseauerq uerseaueqr uerseaequr uerseaeqru uerseaeuqr uerseaeurq
uerseaeruq uerseaerqu uerseqarue uerseqareu uerseqaure uerseqauer uerseqaeur uerseqaeru uerseqraue uerseqraeu uerseqruae
uerseqruea uerseqreua uerseqreau uersequrae uersequrea uersequare uersequaer uersequear uersequera uerseqerua uerseqerau
uerseqeura uerseqeuar uerseqeaur uerseqearu uerseuaqre uerseuaqer uerseuarqe uerseuareq uerseuaerq uerseuaeqr uerseuqare
uerseuqaer uerseuqrae uerseuqrea uerseuqera uerseuqear uerseurqae uerseurqea uerseuraqe uerseuraeq uerseureaq uerseureqa
uerseueqra uerseueqar uerseuerqa uerseueraq uerseuearq uerseueaqr uerseeaqur uerseeaqru uerseeauqr uerseeaurq uerseearuq
uerseearqu uerseeqaur uerseeqaru uerseequar uerseequra uerseeqrua uerseeqrau uerseeuqar uerseeuqra uerseeuaqr uerseeuarq
uerseeuraq uerseeurqa uerseerqua uerseerqau uerseeruqa uerseeruaq uerseerauq uerseeraqu uersqreaue uersqreaeu uersqreuae
uersqreuea uersqreeua uersqreeau uersqraeue uersqraeeu uersqrauee uersqrauee uersqraeue uersqraeeu uersqruaee uersqruaee
uersqrueae uersqrueea uersqrueea uersqrueae uersqreaue uersqreaeu uersqreuae uersqreuea uersqreeua uersqreeau uersqeraue
uersqeraeu uersqeruae uersqeruea uersqereua uersqereau uersqearue uersqeareu uersqeaure uersqeauer uersqeaeur uersqeaeru
uersqeuare uersqeuaer uersqeurae uersqeurea uersqeuera uersqeuear uersqeeaur uersqeearu uersqeeuar uersqeeura uersqeerua
uersqeerau uersqaerue uersqaereu uersqaeure uersqaeuer uersqaeeur uersqaeeru uersqareue uersqareeu uersqaruee uersqaruee
uersqareue uersqareeu uersqauree uersqauree uersqauere uersqaueer uersqaueer uersqauere uersqaerue uersqaereu uersqaeure
uersqaeuer uersqaeeur uersqaeeru uersqueare uersqueaer uersquerae uersquerea uersqueera uersqueear uersquaere uersquaeer
uersquaree uersquaree uersquaere uersquaeer uersquraee uersquraee uersqureae uersqureea uersqureea uersqureae uersqueare
uersqueaer uersquerae uersquerea uersqueera uersqueear uersqeeaur uersqeearu uersqeeuar uersqeeura uersqeerua uersqeerau
uersqeaeur uersqeaeru uersqeauer uersqeaure uersqearue uersqeareu uersqeuaer uersqeuare uersqeuear uersqeuera uersqeurea
uersqeurae uersqeraue uersqeraeu uersqeruae uersqeruea uersqereua uersqereau uersureqae uersureqea uersureaqe uersureaeq
uersureeaq uersureeqa uersurqeae uersurqeea uersurqaee uersurqaee uersurqeae uersurqeea uersuraqee uersuraqee uersuraeqe
uersuraeeq uersuraeeq uersuraeqe uersureqae uersureqea uersureaqe uersureaeq uersureeaq uersureeqa uersuerqae uersuerqea
uersueraqe uersueraeq uersuereaq uersuereqa uersueqrae uersueqrea uersueqare uersueqaer uersueqear uersueqera uersueaqre
uersueaqer uersuearqe uersueareq uersueaerq uersueaeqr uersueeqar uersueeqra uersueeaqr uersueearq uersueeraq uersueerqa
uersuqerae uersuqerea uersuqeare uersuqeaer uersuqeear uersuqeera uersuqreae uersuqreea uersuqraee uersuqraee uersuqreae
uersuqreea uersuqaree uersuqaree uersuqaere uersuqaeer uersuqaeer uersuqaere uersuqerae uersuqerea uersuqeare uersuqeaer
uersuqeear uersuqeera uersuaeqre uersuaeqer uersuaerqe uersuaereq uersuaeerq uersuaeeqr uersuaqere uersuaqeer uersuaqree
uersuaqree uersuaqere uersuaqeer uersuarqee uersuarqee uersuareqe uersuareeq uersuareeq uersuareqe uersuaeqre uersuaeqer
uersuaerqe uersuaereq uersuaeerq uersuaeeqr uersueeqar uersueeqra uersueeaqr uersueearq uersueeraq uersueerqa uersueqear
uersueqera uersueqaer uersueqare uersueqrae uersueqrea uersueaqer uersueaqre uersueaeqr uersueaerq uersueareq uersuearqe
uersuerqae uersuerqea uersueraqe uersueraeq uersuereaq uersuereqa uerserequa uersereqau uersereuqa uersereuaq uersereauq
uersereaqu uerserqeua uerserqeau uerserquea uerserquae uerserqaue uerserqaeu uerseruqea uerseruqae uerserueqa uerserueaq
uerseruaeq uerseruaqe uerseraque uerseraqeu uerserauqe uerseraueq uerseraeuq uerseraequ uerseerqua uerseerqau uerseeruqa
uerseeruaq uerseerauq uerseeraqu uerseeqrua uerseeqrau uerseequra uerseequar uerseeqaur uerseeqaru uerseeuqra uerseeuqar
uerseeurqa uerseeuraq uerseeuarq uerseeuaqr uerseeaqur uerseeaqru uerseeauqr uerseeaurq uerseearuq uerseearqu uerseqerua
uerseqerau uerseqeura uerseqeuar uerseqeaur uerseqearu uerseqreua uerseqreau uerseqruea uerseqruae uerseqraue uerseqraeu
uersequrea uersequrae uersequera uersequear uersequaer uersequare uerseqarue uerseqareu uerseqaure uerseqauer uerseqaeur
uerseqaeru uerseueqra uerseueqar uerseuerqa uerseueraq uerseuearq uerseueaqr uerseuqera uerseuqear uerseuqrea uerseuqrae
uerseuqare uerseuqaer uerseurqea uerseurqae uerseureqa uerseureaq uerseuraeq uerseuraqe uerseuaqre uerseuaqer uerseuarqe
uerseuareq uerseuaerq uerseuaeqr uerseaequr uerseaeqru uerseaeuqr uerseaeurq uerseaeruq uerseaerqu uerseaqeur uerseaqeru
uerseaquer uerseaqure uerseaqrue uerseaqreu uerseauqer uerseauqre uerseaueqr uerseauerq uerseaureq uerseaurqe uersearque
uersearqeu uersearuqe uersearueq uerseareuq uersearequ uerasreque uerasreqeu uerasreuqe uerasreueq uerasreeuq uerasreequ
uerasrqeue uerasrqeeu uerasrquee uerasrquee uerasrqeue uerasrqeeu uerasruqee uerasruqee uerasrueqe uerasrueeq uerasrueeq
uerasrueqe uerasreque uerasreqeu uerasreuqe uerasreueq uerasreeuq uerasreequ ueraserque ueraserqeu ueraseruqe ueraserueq
uerasereuq ueraserequ ueraseqrue ueraseqreu uerasequre uerasequer ueraseqeur ueraseqeru ueraseuqre ueraseuqer ueraseurqe
ueraseureq ueraseuerq ueraseueqr ueraseequr ueraseeqru ueraseeuqr ueraseeurq ueraseeruq ueraseerqu uerasqerue uerasqereu
uerasqeure uerasqeuer uerasqeeur uerasqeeru uerasqreue uerasqreeu uerasqruee uerasqruee uerasqreue uerasqreeu uerasquree
uerasquree uerasquere uerasqueer uerasqueer uerasquere uerasqerue uerasqereu uerasqeure uerasqeuer uerasqeeur uerasqeeru
uerasueqre uerasueqer uerasuerqe uerasuereq uerasueerq uerasueeqr uerasuqere uerasuqeer uerasuqree uerasuqree uerasuqere
uerasuqeer uerasurqee uerasurqee uerasureqe uerasureeq uerasureeq uerasureqe uerasueqre uerasueqer uerasuerqe uerasuereq
uerasueerq uerasueeqr ueraseequr ueraseeqru ueraseeuqr ueraseeurq ueraseeruq ueraseerqu ueraseqeur ueraseqeru uerasequer
uerasequre ueraseqrue ueraseqreu ueraseuqer ueraseuqre ueraseueqr ueraseuerq ueraseureq ueraseurqe ueraserque ueraserqeu
ueraseruqe ueraserueq uerasereuq ueraserequ uerarseque uerarseqeu uerarseuqe uerarseueq uerarseeuq uerarseequ uerarsqeue
uerarsqeeu uerarsquee uerarsquee uerarsqeue uerarsqeeu uerarsuqee uerarsuqee uerarsueqe uerarsueeq uerarsueeq uerarsueqe
uerarseque uerarseqeu uerarseuqe uerarseueq uerarseeuq uerarseequ ueraresque ueraresqeu ueraresuqe ueraresueq uerareseuq
ueraresequ uerareqsue uerareqseu uerarequse uerareques uerareqeus uerareqesu uerareuqse uerareuqes uerareusqe uerareuseq
uerareuesq uerareueqs uerareequs uerareeqsu uerareeuqs uerareeusq uerareesuq uerareesqu uerarqesue uerarqeseu uerarqeuse
uerarqeues uerarqeeus uerarqeesu uerarqseue uerarqseeu uerarqsuee uerarqsuee uerarqseue uerarqseeu uerarqusee uerarqusee
uerarquese uerarquees uerarquees uerarquese uerarqesue uerarqeseu uerarqeuse uerarqeues uerarqeeus uerarqeesu uerarueqse
uerarueqes ueraruesqe uerarueseq uerarueesq uerarueeqs ueraruqese ueraruqees ueraruqsee ueraruqsee ueraruqese ueraruqees
uerarusqee uerarusqee ueraruseqe ueraruseeq ueraruseeq ueraruseqe uerarueqse uerarueqes ueraruesqe uerarueseq uerarueesq
uerarueeqs uerareequs uerareeqsu uerareeuqs uerareeusq uerareesuq uerareesqu uerareqeus uerareqesu uerareques uerarequse
uerareqsue uerareqseu uerareuqes uerareuqse uerareueqs uerareuesq uerareuseq uerareusqe ueraresque ueraresqeu ueraresuqe
ueraresueq uerareseuq ueraresequ ueraersque ueraersqeu ueraersuqe ueraersueq ueraerseuq ueraersequ ueraerqsue ueraerqseu
ueraerquse ueraerques ueraerqeus ueraerqesu ueraeruqse ueraeruqes ueraerusqe ueraeruseq ueraeruesq ueraerueqs ueraerequs
ueraereqsu ueraereuqs ueraereusq ueraeresuq ueraeresqu ueraesrque ueraesrqeu ueraesruqe ueraesrueq ueraesreuq ueraesrequ
ueraesqrue ueraesqreu ueraesqure ueraesquer ueraesqeur ueraesqeru ueraesuqre ueraesuqer ueraesurqe ueraesureq ueraesuerq
ueraesueqr ueraesequr ueraeseqru ueraeseuqr ueraeseurq ueraeseruq ueraeserqu ueraeqsrue ueraeqsreu ueraeqsure ueraeqsuer
ueraeqseur ueraeqseru ueraeqrsue ueraeqrseu ueraeqruse ueraeqrues ueraeqreus ueraeqresu ueraequrse ueraequres ueraequsre
ueraequser ueraequesr ueraequers ueraeqerus ueraeqersu ueraeqeurs ueraeqeusr ueraeqesur ueraeqesru ueraeusqre ueraeusqer
ueraeusrqe ueraeusreq ueraeuserq ueraeuseqr ueraeuqsre ueraeuqser ueraeuqrse ueraeuqres ueraeuqers ueraeuqesr ueraeurqse
ueraeurqes ueraeursqe ueraeurseq ueraeuresq ueraeureqs ueraeueqrs ueraeueqsr ueraeuerqs ueraeuersq ueraeuesrq ueraeuesqr
ueraeesqur ueraeesqru ueraeesuqr ueraeesurq ueraeesruq ueraeesrqu ueraeeqsur ueraeeqsru ueraeequsr ueraeequrs ueraeeqrus
ueraeeqrsu ueraeeuqsr ueraeeuqrs ueraeeusqr ueraeeusrq ueraeeursq ueraeeurqs ueraeerqus ueraeerqsu ueraeeruqs ueraeerusq
ueraeersuq ueraeersqu ueraqresue ueraqreseu ueraqreuse ueraqreues ueraqreeus ueraqreesu ueraqrseue ueraqrseeu ueraqrsuee
ueraqrsuee ueraqrseue ueraqrseeu ueraqrusee ueraqrusee ueraqruese ueraqruees ueraqruees ueraqruese ueraqresue ueraqreseu
ueraqreuse ueraqreues ueraqreeus ueraqreesu ueraqersue ueraqerseu ueraqeruse ueraqerues ueraqereus ueraqeresu ueraqesrue
ueraqesreu ueraqesure ueraqesuer ueraqeseur ueraqeseru ueraqeusre ueraqeuser ueraqeurse ueraqeures ueraqeuers ueraqeuesr
ueraqeesur ueraqeesru ueraqeeusr ueraqeeurs ueraqeerus ueraqeersu ueraqserue ueraqsereu ueraqseure ueraqseuer ueraqseeur
ueraqseeru ueraqsreue ueraqsreeu ueraqsruee ueraqsruee ueraqsreue ueraqsreeu ueraqsuree ueraqsuree ueraqsuere ueraqsueer
ueraqsueer ueraqsuere ueraqserue ueraqsereu ueraqseure ueraqseuer ueraqseeur ueraqseeru ueraquesre ueraqueser ueraquerse
ueraqueres ueraqueers ueraqueesr ueraqusere ueraquseer ueraqusree ueraqusree ueraqusere ueraquseer ueraqursee ueraqursee
ueraqurese ueraqurees ueraqurees ueraqurese ueraquesre ueraqueser ueraquerse ueraqueres ueraqueers ueraqueesr ueraqeesur
ueraqeesru ueraqeeusr ueraqeeurs ueraqeerus ueraqeersu ueraqeseur ueraqeseru ueraqesuer ueraqesure ueraqesrue ueraqesreu
ueraqeuser ueraqeusre ueraqeuesr ueraqeuers ueraqeures ueraqeurse ueraqersue ueraqerseu ueraqeruse ueraqerues ueraqereus
ueraqeresu ueraureqse ueraureqes uerauresqe ueraureseq ueraureesq ueraureeqs ueraurqese ueraurqees ueraurqsee ueraurqsee
ueraurqese ueraurqees ueraursqee ueraursqee ueraurseqe ueraurseeq ueraurseeq ueraurseqe ueraureqse ueraureqes uerauresqe
ueraureseq ueraureesq ueraureeqs uerauerqse uerauerqes uerauersqe uerauerseq ueraueresq uerauereqs ueraueqrse ueraueqres
ueraueqsre ueraueqser ueraueqesr ueraueqers uerauesqre uerauesqer uerauesrqe uerauesreq ueraueserq ueraueseqr ueraueeqsr
ueraueeqrs ueraueesqr ueraueesrq ueraueersq ueraueerqs uerauqerse uerauqeres uerauqesre uerauqeser uerauqeesr uerauqeers
uerauqrese uerauqrees uerauqrsee uerauqrsee uerauqrese uerauqrees uerauqsree uerauqsree uerauqsere uerauqseer uerauqseer
uerauqsere uerauqerse uerauqeres uerauqesre uerauqeser uerauqeesr uerauqeers uerauseqre uerauseqer uerauserqe uerausereq
uerauseerq uerauseeqr uerausqere uerausqeer uerausqree uerausqree uerausqere uerausqeer uerausrqee uerausrqee uerausreqe
uerausreeq uerausreeq uerausreqe uerauseqre uerauseqer uerauserqe uerausereq uerauseerq uerauseeqr ueraueeqsr ueraueeqrs
ueraueesqr ueraueesrq ueraueersq ueraueerqs ueraueqesr ueraueqers ueraueqser ueraueqsre ueraueqrse ueraueqres uerauesqer
uerauesqre ueraueseqr ueraueserq uerauesreq uerauesrqe uerauerqse uerauerqes uerauersqe uerauerseq ueraueresq uerauereqs
ueraerequs ueraereqsu ueraereuqs ueraereusq ueraeresuq ueraeresqu ueraerqeus ueraerqesu ueraerques ueraerquse ueraerqsue
ueraerqseu ueraeruqes ueraeruqse ueraerueqs ueraeruesq ueraeruseq ueraerusqe ueraersque ueraersqeu ueraersuqe ueraersueq
ueraerseuq ueraersequ ueraeerqus ueraeerqsu ueraeeruqs ueraeerusq ueraeersuq ueraeersqu ueraeeqrus ueraeeqrsu ueraeequrs
ueraeequsr ueraeeqsur ueraeeqsru ueraeeuqrs ueraeeuqsr ueraeeurqs ueraeeursq ueraeeusrq ueraeeusqr ueraeesqur ueraeesqru
ueraeesuqr ueraeesurq ueraeesruq ueraeesrqu ueraeqerus ueraeqersu ueraeqeurs ueraeqeusr ueraeqesur ueraeqesru ueraeqreus
ueraeqresu ueraeqrues ueraeqruse ueraeqrsue ueraeqrseu ueraequres ueraequrse ueraequers ueraequesr ueraequser ueraequsre
ueraeqsrue ueraeqsreu ueraeqsure ueraeqsuer ueraeqseur ueraeqseru ueraeueqrs ueraeueqsr ueraeuerqs ueraeuersq ueraeuesrq
ueraeuesqr ueraeuqers ueraeuqesr ueraeuqres ueraeuqrse ueraeuqsre ueraeuqser ueraeurqes ueraeurqse ueraeureqs ueraeuresq
ueraeurseq ueraeursqe ueraeusqre ueraeusqer ueraeusrqe ueraeusreq ueraeuserq ueraeuseqr ueraesequr ueraeseqru ueraeseuqr
ueraeseurq ueraeseruq ueraeserqu ueraesqeur ueraesqeru ueraesquer ueraesqure ueraesqrue ueraesqreu ueraesuqer ueraesuqre
ueraesueqr ueraesuerq ueraesureq ueraesurqe ueraesrque ueraesrqeu ueraesruqe ueraesrueq ueraesreuq ueraesrequ uerraseque
uerraseqeu uerraseuqe uerraseueq uerraseeuq uerraseequ uerrasqeue uerrasqeeu uerrasquee uerrasquee uerrasqeue uerrasqeeu
uerrasuqee uerrasuqee uerrasueqe uerrasueeq uerrasueeq uerrasueqe uerraseque uerraseqeu uerraseuqe uerraseueq uerraseeuq
uerraseequ uerraesque uerraesqeu uerraesuqe uerraesueq uerraeseuq uerraesequ uerraeqsue uerraeqseu uerraequse uerraeques
uerraeqeus uerraeqesu uerraeuqse uerraeuqes uerraeusqe uerraeuseq uerraeuesq uerraeueqs uerraeequs uerraeeqsu uerraeeuqs
uerraeeusq uerraeesuq uerraeesqu uerraqesue uerraqeseu uerraqeuse uerraqeues uerraqeeus uerraqeesu uerraqseue uerraqseeu
uerraqsuee uerraqsuee uerraqseue uerraqseeu uerraqusee uerraqusee uerraquese uerraquees uerraquees uerraquese uerraqesue
uerraqeseu uerraqeuse uerraqeues uerraqeeus uerraqeesu uerraueqse uerraueqes uerrauesqe uerraueseq uerraueesq uerraueeqs
uerrauqese uerrauqees uerrauqsee uerrauqsee uerrauqese uerrauqees uerrausqee uerrausqee uerrauseqe uerrauseeq uerrauseeq
uerrauseqe uerraueqse uerraueqes uerrauesqe uerraueseq uerraueesq uerraueeqs uerraeequs uerraeeqsu uerraeeuqs uerraeeusq
uerraeesuq uerraeesqu uerraeqeus uerraeqesu uerraeques uerraequse uerraeqsue uerraeqseu uerraeuqes uerraeuqse uerraeueqs
uerraeuesq uerraeuseq uerraeusqe uerraesque uerraesqeu uerraesuqe uerraesueq uerraeseuq uerraesequ uerrsaeque uerrsaeqeu
uerrsaeuqe uerrsaeueq uerrsaeeuq uerrsaeequ uerrsaqeue uerrsaqeeu uerrsaquee uerrsaquee uerrsaqeue uerrsaqeeu uerrsauqee
uerrsauqee uerrsaueqe uerrsaueeq uerrsaueeq uerrsaueqe uerrsaeque uerrsaeqeu uerrsaeuqe uerrsaeueq uerrsaeeuq uerrsaeequ
uerrseaque uerrseaqeu uerrseauqe uerrseaueq uerrseaeuq uerrseaequ uerrseqaue uerrseqaeu uerrsequae uerrsequea uerrseqeua
uerrseqeau uerrseuqae uerrseuqea uerrseuaqe uerrseuaeq uerrseueaq uerrseueqa uerrseequa uerrseeqau uerrseeuqa uerrseeuaq
uerrseeauq uerrseeaqu uerrsqeaue uerrsqeaeu uerrsqeuae uerrsqeuea uerrsqeeua uerrsqeeau uerrsqaeue uerrsqaeeu uerrsqauee
uerrsqauee uerrsqaeue uerrsqaeeu uerrsquaee uerrsquaee uerrsqueae uerrsqueea uerrsqueea uerrsqueae uerrsqeaue uerrsqeaeu
uerrsqeuae uerrsqeuea uerrsqeeua uerrsqeeau uerrsueqae uerrsueqea uerrsueaqe uerrsueaeq uerrsueeaq uerrsueeqa uerrsuqeae
uerrsuqeea uerrsuqaee uerrsuqaee uerrsuqeae uerrsuqeea uerrsuaqee uerrsuaqee uerrsuaeqe uerrsuaeeq uerrsuaeeq uerrsuaeqe
uerrsueqae uerrsueqea uerrsueaqe uerrsueaeq uerrsueeaq uerrsueeqa uerrseequa uerrseeqau uerrseeuqa uerrseeuaq uerrseeauq
uerrseeaqu uerrseqeua uerrseqeau uerrsequea uerrsequae uerrseqaue uerrseqaeu uerrseuqea uerrseuqae uerrseueqa uerrseueaq
uerrseuaeq uerrseuaqe uerrseaque uerrseaqeu uerrseauqe uerrseaueq uerrseaeuq uerrseaequ uerresaque uerresaqeu uerresauqe
uerresaueq uerresaeuq uerresaequ uerresqaue uerresqaeu uerresquae uerresquea uerresqeua uerresqeau uerresuqae uerresuqea
uerresuaqe uerresuaeq uerresueaq uerresueqa uerresequa uerreseqau uerreseuqa uerreseuaq uerreseauq uerreseaqu uerreasque
uerreasqeu uerreasuqe uerreasueq uerreaseuq uerreasequ uerreaqsue uerreaqseu uerreaquse uerreaques uerreaqeus uerreaqesu
uerreauqse uerreauqes uerreausqe uerreauseq uerreauesq uerreaueqs uerreaequs uerreaeqsu uerreaeuqs uerreaeusq uerreaesuq
uerreaesqu uerreqasue uerreqaseu uerreqause uerreqaues uerreqaeus uerreqaesu uerreqsaue uerreqsaeu uerreqsuae uerreqsuea
uerreqseua uerreqseau uerrequsae uerrequsea uerrequase uerrequaes uerrequeas uerrequesa uerreqesua uerreqesau uerreqeusa
uerreqeuas uerreqeaus uerreqeasu uerreuaqse uerreuaqes uerreuasqe uerreuaseq uerreuaesq uerreuaeqs uerreuqase uerreuqaes
uerreuqsae uerreuqsea uerreuqesa uerreuqeas uerreusqae uerreusqea uerreusaqe uerreusaeq uerreuseaq uerreuseqa uerreueqsa
uerreueqas uerreuesqa uerreuesaq uerreueasq uerreueaqs uerreeaqus uerreeaqsu uerreeauqs uerreeausq uerreeasuq uerreeasqu
uerreeqaus uerreeqasu uerreequas uerreequsa uerreeqsua uerreeqsau uerreeuqas uerreeuqsa uerreeuaqs uerreeuasq uerreeusaq
uerreeusqa uerreesqua uerreesqau uerreesuqa uerreesuaq uerreesauq uerreesaqu uerrqseaue uerrqseaeu uerrqseuae uerrqseuea
uerrqseeua uerrqseeau uerrqsaeue uerrqsaeeu uerrqsauee uerrqsauee uerrqsaeue uerrqsaeeu uerrqsuaee uerrqsuaee uerrqsueae
uerrqsueea uerrqsueea uerrqsueae uerrqseaue uerrqseaeu uerrqseuae uerrqseuea uerrqseeua uerrqseeau uerrqesaue uerrqesaeu
uerrqesuae uerrqesuea uerrqeseua uerrqeseau uerrqeasue uerrqeaseu uerrqeause uerrqeaues uerrqeaeus uerrqeaesu uerrqeuase
uerrqeuaes uerrqeusae uerrqeusea uerrqeuesa uerrqeueas uerrqeeaus uerrqeeasu uerrqeeuas uerrqeeusa uerrqeesua uerrqeesau
uerrqaesue uerrqaeseu uerrqaeuse uerrqaeues uerrqaeeus uerrqaeesu uerrqaseue uerrqaseeu uerrqasuee uerrqasuee uerrqaseue
uerrqaseeu uerrqausee uerrqausee uerrqauese uerrqauees uerrqauees uerrqauese uerrqaesue uerrqaeseu uerrqaeuse uerrqaeues
uerrqaeeus uerrqaeesu uerrquease uerrqueaes uerrquesae uerrquesea uerrqueesa uerrqueeas uerrquaese uerrquaees uerrquasee
uerrquasee uerrquaese uerrquaees uerrqusaee uerrqusaee uerrquseae uerrquseea uerrquseea uerrquseae uerrquease uerrqueaes
uerrquesae uerrquesea uerrqueesa uerrqueeas uerrqeeaus uerrqeeasu uerrqeeuas uerrqeeusa uerrqeesua uerrqeesau uerrqeaeus
uerrqeaesu uerrqeaues uerrqeause uerrqeasue uerrqeaseu uerrqeuaes uerrqeuase uerrqeueas uerrqeuesa uerrqeusea uerrqeusae
uerrqesaue uerrqesaeu uerrqesuae uerrqesuea uerrqeseua uerrqeseau uerruseqae uerruseqea uerruseaqe uerruseaeq uerruseeaq
uerruseeqa uerrusqeae uerrusqeea uerrusqaee uerrusqaee uerrusqeae uerrusqeea uerrusaqee uerrusaqee uerrusaeqe uerrusaeeq
uerrusaeeq uerrusaeqe uerruseqae uerruseqea uerruseaqe uerruseaeq uerruseeaq uerruseeqa uerruesqae uerruesqea uerruesaqe
uerruesaeq uerrueseaq uerrueseqa uerrueqsae uerrueqsea uerrueqase uerrueqaes uerrueqeas uerrueqesa uerrueaqse uerrueaqes
uerrueasqe uerrueaseq uerrueaesq uerrueaeqs uerrueeqas uerrueeqsa uerrueeaqs uerrueeasq uerrueesaq uerrueesqa uerruqesae
uerruqesea uerruqease uerruqeaes uerruqeeas uerruqeesa uerruqseae uerruqseea uerruqsaee uerruqsaee uerruqseae uerruqseea
uerruqasee uerruqasee uerruqaese uerruqaees uerruqaees uerruqaese uerruqesae uerruqesea uerruqease uerruqeaes uerruqeeas
uerruqeesa uerruaeqse uerruaeqes uerruaesqe uerruaeseq uerruaeesq uerruaeeqs uerruaqese uerruaqees uerruaqsee uerruaqsee
uerruaqese uerruaqees uerruasqee uerruasqee uerruaseqe uerruaseeq uerruaseeq uerruaseqe uerruaeqse uerruaeqes uerruaesqe
uerruaeseq uerruaeesq uerruaeeqs uerrueeqas uerrueeqsa uerrueeaqs uerrueeasq uerrueesaq uerrueesqa uerrueqeas uerrueqesa
uerrueqaes uerrueqase uerrueqsae uerrueqsea uerrueaqes uerrueaqse uerrueaeqs uerrueaesq uerrueaseq uerrueasqe uerruesqae
uerruesqea uerruesaqe uerruesaeq uerrueseaq uerrueseqa uerresequa uerreseqau uerreseuqa uerreseuaq uerreseauq uerreseaqu
uerresqeua uerresqeau uerresquea uerresquae uerresqaue uerresqaeu uerresuqea uerresuqae uerresueqa uerresueaq uerresuaeq
uerresuaqe uerresaque uerresaqeu uerresauqe uerresaueq uerresaeuq uerresaequ uerreesqua uerreesqau uerreesuqa uerreesuaq
uerreesauq uerreesaqu uerreeqsua uerreeqsau uerreequsa uerreequas uerreeqaus uerreeqasu uerreeuqsa uerreeuqas uerreeusqa
uerreeusaq uerreeuasq uerreeuaqs uerreeaqus uerreeaqsu uerreeauqs uerreeausq uerreeasuq uerreeasqu uerreqesua uerreqesau
uerreqeusa uerreqeuas uerreqeaus uerreqeasu uerreqseua uerreqseau uerreqsuea uerreqsuae uerreqsaue uerreqsaeu uerrequsea
uerrequsae uerrequesa uerrequeas uerrequaes uerrequase uerreqasue uerreqaseu uerreqause uerreqaues uerreqaeus uerreqaesu
uerreueqsa uerreueqas uerreuesqa uerreuesaq uerreueasq uerreueaqs uerreuqesa uerreuqeas uerreuqsea uerreuqsae uerreuqase
uerreuqaes uerreusqea uerreusqae uerreuseqa uerreuseaq uerreusaeq uerreusaqe uerreuaqse uerreuaqes uerreuasqe uerreuaseq
uerreuaesq uerreuaeqs uerreaequs uerreaeqsu uerreaeuqs uerreaeusq uerreaesuq uerreaesqu uerreaqeus uerreaqesu uerreaques
uerreaquse uerreaqsue uerreaqseu uerreauqes uerreauqse uerreaueqs uerreauesq uerreauseq uerreausqe uerreasque uerreasqeu
uerreasuqe uerreasueq uerreaseuq uerreasequ uerearsque uerearsqeu uerearsuqe uerearsueq uerearseuq uerearsequ uerearqsue
uerearqseu uerearquse uerearques uerearqeus uerearqesu uerearuqse uerearuqes uerearusqe uerearuseq uerearuesq uerearueqs
uerearequs uereareqsu uereareuqs uereareusq uerearesuq uerearesqu uereasrque uereasrqeu uereasruqe uereasrueq uereasreuq
uereasrequ uereasqrue uereasqreu uereasqure uereasquer uereasqeur uereasqeru uereasuqre uereasuqer uereasurqe uereasureq
uereasuerq uereasueqr uereasequr uereaseqru uereaseuqr uereaseurq uereaseruq uereaserqu uereaqsrue uereaqsreu uereaqsure
uereaqsuer uereaqseur uereaqseru uereaqrsue uereaqrseu uereaqruse uereaqrues uereaqreus uereaqresu uereaqurse uereaqures
uereaqusre uereaquser uereaquesr uereaquers uereaqerus uereaqersu uereaqeurs uereaqeusr uereaqesur uereaqesru uereausqre
uereausqer uereausrqe uereausreq uereauserq uereauseqr uereauqsre uereauqser uereauqrse uereauqres uereauqers uereauqesr
uereaurqse uereaurqes uereaursqe uereaurseq uereauresq uereaureqs uereaueqrs uereaueqsr uereauerqs uereauersq uereauesrq
uereauesqr uereaesqur uereaesqru uereaesuqr uereaesurq uereaesruq uereaesrqu uereaeqsur uereaeqsru uereaequsr uereaequrs
uereaeqrus uereaeqrsu uereaeuqsr uereaeuqrs uereaeusqr uereaeusrq uereaeursq uereaeurqs uereaerqus uereaerqsu uereaeruqs
uereaerusq uereaersuq uereaersqu uererasque uererasqeu uererasuqe uererasueq uereraseuq uererasequ uereraqsue uereraqseu
uereraquse uereraques uereraqeus uereraqesu uererauqse uererauqes uererausqe uererauseq uererauesq uereraueqs uereraequs
uereraeqsu uereraeuqs uereraeusq uereraesuq uereraesqu uerersaque uerersaqeu uerersauqe uerersaueq uerersaeuq uerersaequ
uerersqaue uerersqaeu uerersquae uerersquea uerersqeua uerersqeau uerersuqae uerersuqea uerersuaqe uerersuaeq uerersueaq
uerersueqa uerersequa uererseqau uererseuqa uererseuaq uererseauq uererseaqu uererqsaue uererqsaeu uererqsuae uererqsuea
uererqseua uererqseau uererqasue uererqaseu uererqause uererqaues uererqaeus uererqaesu uererquase uererquaes uererqusae
uererqusea uererquesa uererqueas uererqeaus uererqeasu uererqeuas uererqeusa uererqesua uererqesau uererusqae uererusqea
uererusaqe uererusaeq uereruseaq uereruseqa uereruqsae uereruqsea uereruqase uereruqaes uereruqeas uereruqesa uereruaqse
uereruaqes uereruasqe uereruaseq uereruaesq uereruaeqs uererueqas uererueqsa uererueaqs uererueasq uereruesaq uereruesqa
uereresqua uereresqau uereresuqa uereresuaq uereresauq uereresaqu uerereqsua uerereqsau uererequsa uererequas uerereqaus
uerereqasu uerereuqsa uerereuqas uerereusqa uerereusaq uerereuasq uerereuaqs uerereaqus uerereaqsu uerereauqs uerereausq
uerereasuq uerereasqu ueresraque ueresraqeu ueresrauqe ueresraueq ueresraeuq ueresraequ ueresrqaue ueresrqaeu ueresrquae
ueresrquea ueresrqeua ueresrqeau ueresruqae ueresruqea ueresruaqe ueresruaeq ueresrueaq ueresrueqa ueresrequa ueresreqau
ueresreuqa ueresreuaq ueresreauq ueresreaqu ueresarque ueresarqeu ueresaruqe ueresarueq ueresareuq ueresarequ ueresaqrue
ueresaqreu ueresaqure ueresaquer ueresaqeur ueresaqeru ueresauqre ueresauqer ueresaurqe ueresaureq ueresauerq ueresaueqr
ueresaequr ueresaeqru ueresaeuqr ueresaeurq ueresaeruq ueresaerqu ueresqarue ueresqareu ueresqaure ueresqauer ueresqaeur
ueresqaeru ueresqraue ueresqraeu ueresqruae ueresqruea ueresqreua ueresqreau ueresqurae ueresqurea ueresquare ueresquaer
ueresquear ueresquera ueresqerua ueresqerau ueresqeura ueresqeuar ueresqeaur ueresqearu ueresuaqre ueresuaqer ueresuarqe
ueresuareq ueresuaerq ueresuaeqr ueresuqare ueresuqaer ueresuqrae ueresuqrea ueresuqera ueresuqear ueresurqae ueresurqea
ueresuraqe ueresuraeq ueresureaq ueresureqa ueresueqra ueresueqar ueresuerqa ueresueraq ueresuearq ueresueaqr uereseaqur
uereseaqru uereseauqr uereseaurq ueresearuq ueresearqu uereseqaur uereseqaru ueresequar ueresequra uereseqrua uereseqrau
uereseuqar uereseuqra uereseuaqr uereseuarq uereseuraq uereseurqa uereserqua uereserqau uereseruqa uereseruaq uereserauq
uereseraqu uereqrsaue uereqrsaeu uereqrsuae uereqrsuea uereqrseua uereqrseau uereqrasue uereqraseu uereqrause uereqraues
uereqraeus uereqraesu uereqruase uereqruaes uereqrusae uereqrusea uereqruesa uereqrueas uereqreaus uereqreasu uereqreuas
uereqreusa uereqresua uereqresau uereqsraue uereqsraeu uereqsruae uereqsruea uereqsreua uereqsreau uereqsarue uereqsareu
uereqsaure uereqsauer uereqsaeur uereqsaeru uereqsuare uereqsuaer uereqsurae uereqsurea uereqsuera uereqsuear uereqseaur
uereqsearu uereqseuar uereqseura uereqserua uereqserau uereqasrue uereqasreu uereqasure uereqasuer uereqaseur uereqaseru
uereqarsue uereqarseu uereqaruse uereqarues uereqareus uereqaresu uereqaurse uereqaures uereqausre uereqauser uereqauesr
uereqauers uereqaerus uereqaersu uereqaeurs uereqaeusr uereqaesur uereqaesru uerequsare uerequsaer uerequsrae uerequsrea
uerequsera uerequsear uerequasre uerequaser uerequarse uerequares uerequaers uerequaesr uerequrase uerequraes uereqursae
uereqursea uerequresa uerequreas uerequears uerequeasr uerequeras uerequersa uerequesra uerequesar uereqesaur uereqesaru
uereqesuar uereqesura uereqesrua uereqesrau uereqeasur uereqeasru uereqeausr uereqeaurs uereqearus uereqearsu uereqeuasr
uereqeuars uereqeusar uereqeusra uereqeursa uereqeuras uereqeraus uereqerasu uereqeruas uereqerusa uereqersua uereqersau
uereursqae uereursqea uereursaqe uereursaeq uereurseaq uereurseqa uereurqsae uereurqsea uereurqase uereurqaes uereurqeas
uereurqesa uereuraqse uereuraqes uereurasqe uereuraseq uereuraesq uereuraeqs uereureqas uereureqsa uereureaqs uereureasq
uereuresaq uereuresqa uereusrqae uereusrqea uereusraqe uereusraeq uereusreaq uereusreqa uereusqrae uereusqrea uereusqare
uereusqaer uereusqear uereusqera uereusaqre uereusaqer uereusarqe uereusareq uereusaerq uereusaeqr uereuseqar uereuseqra
uereuseaqr uereusearq uereuseraq uereuserqa uereuqsrae uereuqsrea uereuqsare uereuqsaer uereuqsear uereuqsera uereuqrsae
uereuqrsea uereuqrase uereuqraes uereuqreas uereuqresa uereuqarse uereuqares uereuqasre uereuqaser uereuqaesr uereuqaers
uereuqeras uereuqersa uereuqears uereuqeasr uereuqesar uereuqesra uereuasqre uereuasqer uereuasrqe uereuasreq uereuaserq
uereuaseqr uereuaqsre uereuaqser uereuaqrse uereuaqres uereuaqers uereuaqesr uereuarqse uereuarqes uereuarsqe uereuarseq
uereuaresq uereuareqs uereuaeqrs uereuaeqsr uereuaerqs uereuaersq uereuaesrq uereuaesqr uereuesqar uereuesqra uereuesaqr
uereuesarq uereuesraq uereuesrqa uereueqsar uereueqsra uereueqasr uereueqars uereueqras uereueqrsa uereueaqsr uereueaqrs
uereueasqr uereueasrq uereuearsq uereuearqs uereuerqas uereuerqsa uereueraqs uereuerasq uereuersaq uereuersqa uereersqua
uereersqau uereersuqa uereersuaq uereersauq uereersaqu uereerqsua uereerqsau uereerqusa uereerquas uereerqaus uereerqasu
uereeruqsa uereeruqas uereerusqa uereerusaq uereeruasq uereeruaqs uereeraqus uereeraqsu uereerauqs uereerausq uereerasuq
uereerasqu uereesrqua uereesrqau uereesruqa uereesruaq uereesrauq uereesraqu uereesqrua uereesqrau uereesqura uereesquar
uereesqaur uereesqaru uereesuqra uereesuqar uereesurqa uereesuraq uereesuarq uereesuaqr uereesaqur uereesaqru uereesauqr
uereesaurq uereesaruq uereesarqu uereeqsrua uereeqsrau uereeqsura uereeqsuar uereeqsaur uereeqsaru uereeqrsua uereeqrsau
uereeqrusa uereeqruas uereeqraus uereeqrasu uereeqursa uereequras uereequsra uereequsar uereequasr uereequars uereeqarus
uereeqarsu uereeqaurs uereeqausr uereeqasur uereeqasru uereeusqra uereeusqar uereeusrqa uereeusraq uereeusarq uereeusaqr
uereeuqsra uereeuqsar uereeuqrsa uereeuqras uereeuqars uereeuqasr uereeurqsa uereeurqas uereeursqa uereeursaq uereeurasq
uereeuraqs uereeuaqrs uereeuaqsr uereeuarqs uereeuarsq uereeuasrq uereeuasqr uereeasqur uereeasqru uereeasuqr uereeasurq
uereeasruq uereeasrqu uereeaqsur uereeaqsru uereeaqusr uereeaqurs uereeaqrus uereeaqrsu uereeauqsr uereeauqrs uereeausqr
uereeausrq uereeaursq uereeaurqs uereearqus uereearqsu uereearuqs uereearusq uereearsuq uereearsqu uerqaresue uerqareseu
uerqareuse uerqareues uerqareeus uerqareesu uerqarseue uerqarseeu uerqarsuee uerqarsuee uerqarseue uerqarseeu uerqarusee
uerqarusee uerqaruese uerqaruees uerqaruees uerqaruese uerqaresue uerqareseu uerqareuse uerqareues uerqareeus uerqareesu
uerqaersue uerqaerseu uerqaeruse uerqaerues uerqaereus uerqaeresu uerqaesrue uerqaesreu uerqaesure uerqaesuer uerqaeseur
uerqaeseru uerqaeusre uerqaeuser uerqaeurse uerqaeures uerqaeuers uerqaeuesr uerqaeesur uerqaeesru uerqaeeusr uerqaeeurs
uerqaeerus uerqaeersu uerqaserue uerqasereu uerqaseure uerqaseuer uerqaseeur uerqaseeru uerqasreue uerqasreeu uerqasruee
uerqasruee uerqasreue uerqasreeu uerqasuree uerqasuree uerqasuere uerqasueer uerqasueer uerqasuere uerqaserue uerqasereu
uerqaseure uerqaseuer uerqaseeur uerqaseeru uerqauesre uerqaueser uerqauerse uerqaueres uerqaueers uerqaueesr uerqausere
uerqauseer uerqausree uerqausree uerqausere uerqauseer uerqaursee uerqaursee uerqaurese uerqaurees uerqaurees uerqaurese
uerqauesre uerqaueser uerqauerse uerqaueres uerqaueers uerqaueesr uerqaeesur uerqaeesru uerqaeeusr uerqaeeurs uerqaeerus
uerqaeersu uerqaeseur uerqaeseru uerqaesuer uerqaesure uerqaesrue uerqaesreu uerqaeuser uerqaeusre uerqaeuesr uerqaeuers
uerqaeures uerqaeurse uerqaersue uerqaerseu uerqaeruse uerqaerues uerqaereus uerqaeresu uerqraesue uerqraeseu uerqraeuse
uerqraeues uerqraeeus uerqraeesu uerqraseue uerqraseeu uerqrasuee uerqrasuee uerqraseue uerqraseeu uerqrausee uerqrausee
uerqrauese uerqrauees uerqrauees uerqrauese uerqraesue uerqraeseu uerqraeuse uerqraeues uerqraeeus uerqraeesu uerqreasue
uerqreaseu uerqreause uerqreaues uerqreaeus uerqreaesu uerqresaue uerqresaeu uerqresuae uerqresuea uerqreseua uerqreseau
uerqreusae uerqreusea uerqreuase uerqreuaes uerqreueas uerqreuesa uerqreesua uerqreesau uerqreeusa uerqreeuas uerqreeaus
uerqreeasu uerqrseaue uerqrseaeu uerqrseuae uerqrseuea uerqrseeua uerqrseeau uerqrsaeue uerqrsaeeu uerqrsauee uerqrsauee
uerqrsaeue uerqrsaeeu uerqrsuaee uerqrsuaee uerqrsueae uerqrsueea uerqrsueea uerqrsueae uerqrseaue uerqrseaeu uerqrseuae
uerqrseuea uerqrseeua uerqrseeau uerqruesae uerqruesea uerqruease uerqrueaes uerqrueeas uerqrueesa uerqruseae uerqruseea
uerqrusaee uerqrusaee uerqruseae uerqruseea uerqruasee uerqruasee uerqruaese uerqruaees uerqruaees uerqruaese uerqruesae
uerqruesea uerqruease uerqrueaes uerqrueeas uerqrueesa uerqreesua uerqreesau uerqreeusa uerqreeuas uerqreeaus uerqreeasu
uerqreseua uerqreseau uerqresuea uerqresuae uerqresaue uerqresaeu uerqreusea uerqreusae uerqreuesa uerqreueas uerqreuaes
uerqreuase uerqreasue uerqreaseu uerqreause uerqreaues uerqreaeus uerqreaesu uerqerasue uerqeraseu uerqerause uerqeraues
uerqeraeus uerqeraesu uerqersaue uerqersaeu uerqersuae uerqersuea uerqerseua uerqerseau uerqerusae uerqerusea uerqeruase
uerqeruaes uerqerueas uerqeruesa uerqeresua uerqeresau uerqereusa uerqereuas uerqereaus uerqereasu uerqearsue uerqearseu
uerqearuse uerqearues uerqeareus uerqearesu uerqeasrue uerqeasreu uerqeasure uerqeasuer uerqeaseur uerqeaseru uerqeausre
uerqeauser uerqeaurse uerqeaures uerqeauers uerqeauesr uerqeaesur uerqeaesru uerqeaeusr uerqeaeurs uerqeaerus uerqeaersu
uerqesarue uerqesareu uerqesaure uerqesauer uerqesaeur uerqesaeru uerqesraue uerqesraeu uerqesruae uerqesruea uerqesreua
uerqesreau uerqesurae uerqesurea uerqesuare uerqesuaer uerqesuear uerqesuera uerqeserua uerqeserau uerqeseura uerqeseuar
uerqeseaur uerqesearu uerqeuasre uerqeuaser uerqeuarse uerqeuares uerqeuaers uerqeuaesr uerqeusare uerqeusaer uerqeusrae
uerqeusrea uerqeusera uerqeusear uerqeursae uerqeursea uerqeurase uerqeuraes uerqeureas uerqeuresa uerqeuesra uerqeuesar
uerqeuersa uerqeueras uerqeuears uerqeueasr uerqeeasur uerqeeasru uerqeeausr uerqeeaurs uerqeearus uerqeearsu uerqeesaur
uerqeesaru uerqeesuar uerqeesura uerqeesrua uerqeesrau uerqeeusar uerqeeusra uerqeeuasr uerqeeuars uerqeeuras uerqeeursa
uerqeersua uerqeersau uerqeerusa uerqeeruas uerqeeraus uerqeerasu uerqsreaue uerqsreaeu uerqsreuae uerqsreuea uerqsreeua
uerqsreeau uerqsraeue uerqsraeeu uerqsrauee uerqsrauee uerqsraeue uerqsraeeu uerqsruaee uerqsruaee uerqsrueae uerqsrueea
uerqsrueea uerqsrueae uerqsreaue uerqsreaeu uerqsreuae uerqsreuea uerqsreeua uerqsreeau uerqseraue uerqseraeu uerqseruae
uerqseruea uerqsereua uerqsereau uerqsearue uerqseareu uerqseaure uerqseauer uerqseaeur uerqseaeru uerqseuare uerqseuaer
uerqseurae uerqseurea uerqseuera uerqseuear uerqseeaur uerqseearu uerqseeuar uerqseeura uerqseerua uerqseerau uerqsaerue
uerqsaereu uerqsaeure uerqsaeuer uerqsaeeur uerqsaeeru uerqsareue uerqsareeu uerqsaruee uerqsaruee uerqsareue uerqsareeu
uerqsauree uerqsauree uerqsauere uerqsaueer uerqsaueer uerqsauere uerqsaerue uerqsaereu uerqsaeure uerqsaeuer uerqsaeeur
uerqsaeeru uerqsueare uerqsueaer uerqsuerae uerqsuerea uerqsueera uerqsueear uerqsuaere uerqsuaeer uerqsuaree uerqsuaree
uerqsuaere uerqsuaeer uerqsuraee uerqsuraee uerqsureae uerqsureea uerqsureea uerqsureae uerqsueare uerqsueaer uerqsuerae
uerqsuerea uerqsueera uerqsueear uerqseeaur uerqseearu uerqseeuar uerqseeura uerqseerua uerqseerau uerqseaeur uerqseaeru
uerqseauer uerqseaure uerqsearue uerqseareu uerqseuaer uerqseuare uerqseuear uerqseuera uerqseurea uerqseurae uerqseraue
uerqseraeu uerqseruae uerqseruea uerqsereua uerqsereau uerquresae uerquresea uerqurease uerqureaes uerqureeas uerqureesa
uerqurseae uerqurseea uerqursaee uerqursaee uerqurseae uerqurseea uerqurasee uerqurasee uerquraese uerquraees uerquraees
uerquraese uerquresae uerquresea uerqurease uerqureaes uerqureeas uerqureesa uerquersae uerquersea uerquerase uerqueraes
uerquereas uerqueresa uerquesrae uerquesrea uerquesare uerquesaer uerquesear uerquesera uerqueasre uerqueaser uerquearse
uerqueares uerqueaers uerqueaesr uerqueesar uerqueesra uerqueeasr uerqueears uerqueeras uerqueersa uerquserae uerquserea
uerquseare uerquseaer uerquseear uerquseera uerqusreae uerqusreea uerqusraee uerqusraee uerqusreae uerqusreea uerqusaree
uerqusaree uerqusaere uerqusaeer uerqusaeer uerqusaere uerquserae uerquserea uerquseare uerquseaer uerquseear uerquseera
uerquaesre uerquaeser uerquaerse uerquaeres uerquaeers uerquaeesr uerquasere uerquaseer uerquasree uerquasree uerquasere
uerquaseer uerquarsee uerquarsee uerquarese uerquarees uerquarees uerquarese uerquaesre uerquaeser uerquaerse uerquaeres
uerquaeers uerquaeesr uerqueesar uerqueesra uerqueeasr uerqueears uerqueeras uerqueersa uerquesear uerquesera uerquesaer
uerquesare uerquesrae uerquesrea uerqueaser uerqueasre uerqueaesr uerqueaers uerqueares uerquearse uerquersae uerquersea
uerquerase uerqueraes uerquereas uerqueresa uerqeresua uerqeresau uerqereusa uerqereuas uerqereaus uerqereasu uerqerseua
uerqerseau uerqersuea uerqersuae uerqersaue uerqersaeu uerqerusea uerqerusae uerqeruesa uerqerueas uerqeruaes uerqeruase
uerqerasue uerqeraseu uerqerause uerqeraues uerqeraeus uerqeraesu uerqeersua uerqeersau uerqeerusa uerqeeruas uerqeeraus
uerqeerasu uerqeesrua uerqeesrau uerqeesura uerqeesuar uerqeesaur uerqeesaru uerqeeusra uerqeeusar uerqeeursa uerqeeuras
uerqeeuars uerqeeuasr uerqeeasur uerqeeasru uerqeeausr uerqeeaurs uerqeearus uerqeearsu uerqeserua uerqeserau uerqeseura
uerqeseuar uerqeseaur uerqesearu uerqesreua uerqesreau uerqesruea uerqesruae uerqesraue uerqesraeu uerqesurea uerqesurae
uerqesuera uerqesuear uerqesuaer uerqesuare uerqesarue uerqesareu uerqesaure uerqesauer uerqesaeur uerqesaeru uerqeuesra
uerqeuesar uerqeuersa uerqeueras uerqeuears uerqeueasr uerqeusera uerqeusear uerqeusrea uerqeusrae uerqeusare uerqeusaer
uerqeursea uerqeursae uerqeuresa uerqeureas uerqeuraes uerqeurase uerqeuasre uerqeuaser uerqeuarse uerqeuares uerqeuaers
uerqeuaesr uerqeaesur uerqeaesru uerqeaeusr uerqeaeurs uerqeaerus uerqeaersu uerqeaseur uerqeaseru uerqeasuer uerqeasure
uerqeasrue uerqeasreu uerqeauser uerqeausre uerqeauesr uerqeauers uerqeaures uerqeaurse uerqearsue uerqearseu uerqearuse
uerqearues uerqeareus uerqearesu ueruareqse ueruareqes ueruaresqe ueruareseq ueruareesq ueruareeqs ueruarqese ueruarqees
ueruarqsee ueruarqsee ueruarqese ueruarqees ueruarsqee ueruarsqee ueruarseqe ueruarseeq ueruarseeq ueruarseqe ueruareqse
ueruareqes ueruaresqe ueruareseq ueruareesq ueruareeqs ueruaerqse ueruaerqes ueruaersqe ueruaerseq ueruaeresq ueruaereqs
ueruaeqrse ueruaeqres ueruaeqsre ueruaeqser ueruaeqesr ueruaeqers ueruaesqre ueruaesqer ueruaesrqe ueruaesreq ueruaeserq
ueruaeseqr ueruaeeqsr ueruaeeqrs ueruaeesqr ueruaeesrq ueruaeersq ueruaeerqs ueruaqerse ueruaqeres ueruaqesre ueruaqeser
ueruaqeesr ueruaqeers ueruaqrese ueruaqrees ueruaqrsee ueruaqrsee ueruaqrese ueruaqrees ueruaqsree ueruaqsree ueruaqsere
ueruaqseer ueruaqseer ueruaqsere ueruaqerse ueruaqeres ueruaqesre ueruaqeser ueruaqeesr ueruaqeers ueruaseqre ueruaseqer
ueruaserqe ueruasereq ueruaseerq ueruaseeqr ueruasqere ueruasqeer ueruasqree ueruasqree ueruasqere ueruasqeer ueruasrqee
ueruasrqee ueruasreqe ueruasreeq ueruasreeq ueruasreqe ueruaseqre ueruaseqer ueruaserqe ueruasereq ueruaseerq ueruaseeqr
ueruaeeqsr ueruaeeqrs ueruaeesqr ueruaeesrq ueruaeersq ueruaeerqs ueruaeqesr ueruaeqers ueruaeqser ueruaeqsre ueruaeqrse
ueruaeqres ueruaesqer ueruaesqre ueruaeseqr ueruaeserq ueruaesreq ueruaesrqe ueruaerqse ueruaerqes ueruaersqe ueruaerseq
ueruaeresq ueruaereqs ueruraeqse ueruraeqes ueruraesqe ueruraeseq ueruraeesq ueruraeeqs ueruraqese ueruraqees ueruraqsee
ueruraqsee ueruraqese ueruraqees uerurasqee uerurasqee ueruraseqe ueruraseeq ueruraseeq ueruraseqe ueruraeqse ueruraeqes
ueruraesqe ueruraeseq ueruraeesq ueruraeeqs uerureaqse uerureaqes uerureasqe uerureaseq uerureaesq uerureaeqs uerureqase
uerureqaes uerureqsae uerureqsea uerureqesa uerureqeas ueruresqae ueruresqea ueruresaqe ueruresaeq uerureseaq uerureseqa
uerureeqsa uerureeqas uerureesqa uerureesaq uerureeasq uerureeaqs uerurqease uerurqeaes uerurqesae uerurqesea uerurqeesa
uerurqeeas uerurqaese uerurqaees uerurqasee uerurqasee uerurqaese uerurqaees uerurqsaee uerurqsaee uerurqseae uerurqseea
uerurqseea uerurqseae uerurqease uerurqeaes uerurqesae uerurqesea uerurqeesa uerurqeeas uerurseqae uerurseqea uerurseaqe
uerurseaeq uerurseeaq uerurseeqa uerursqeae uerursqeea uerursqaee uerursqaee uerursqeae uerursqeea uerursaqee uerursaqee
uerursaeqe uerursaeeq uerursaeeq uerursaeqe uerurseqae uerurseqea uerurseaqe uerurseaeq uerurseeaq uerurseeqa uerureeqsa
uerureeqas uerureesqa uerureesaq uerureeasq uerureeaqs uerureqesa uerureqeas uerureqsea uerureqsae uerureqase uerureqaes
ueruresqea ueruresqae uerureseqa uerureseaq ueruresaeq ueruresaqe uerureaqse uerureaqes uerureasqe uerureaseq uerureaesq
uerureaeqs uerueraqse uerueraqes ueruerasqe uerueraseq uerueraesq uerueraeqs ueruerqase ueruerqaes ueruerqsae ueruerqsea
ueruerqesa ueruerqeas ueruersqae ueruersqea ueruersaqe ueruersaeq ueruerseaq ueruerseqa ueruereqsa ueruereqas uerueresqa
uerueresaq ueruereasq ueruereaqs ueruearqse ueruearqes ueruearsqe ueruearseq ueruearesq uerueareqs uerueaqrse uerueaqres
uerueaqsre uerueaqser uerueaqesr uerueaqers uerueasqre uerueasqer uerueasrqe uerueasreq uerueaserq uerueaseqr uerueaeqsr
uerueaeqrs uerueaesqr uerueaesrq uerueaersq uerueaerqs uerueqarse uerueqares uerueqasre uerueqaser uerueqaesr uerueqaers
uerueqrase uerueqraes uerueqrsae uerueqrsea uerueqresa uerueqreas uerueqsrae uerueqsrea uerueqsare uerueqsaer uerueqsear
uerueqsera uerueqersa uerueqeras uerueqesra uerueqesar uerueqeasr uerueqears ueruesaqre ueruesaqer ueruesarqe ueruesareq
ueruesaerq ueruesaeqr ueruesqare ueruesqaer ueruesqrae ueruesqrea ueruesqera ueruesqear ueruesrqae ueruesrqea ueruesraqe
ueruesraeq ueruesreaq ueruesreqa uerueseqra uerueseqar uerueserqa uerueseraq ueruesearq uerueseaqr uerueeaqsr uerueeaqrs
uerueeasqr uerueeasrq uerueearsq uerueearqs uerueeqasr uerueeqars uerueeqsar uerueeqsra uerueeqrsa uerueeqras uerueesqar
uerueesqra uerueesaqr uerueesarq uerueesraq uerueesrqa uerueerqsa uerueerqas uerueersqa uerueersaq uerueerasq uerueeraqs
ueruqrease ueruqreaes ueruqresae ueruqresea ueruqreesa ueruqreeas ueruqraese ueruqraees ueruqrasee ueruqrasee ueruqraese
ueruqraees ueruqrsaee ueruqrsaee ueruqrseae ueruqrseea ueruqrseea ueruqrseae ueruqrease ueruqreaes ueruqresae ueruqresea
ueruqreesa ueruqreeas ueruqerase ueruqeraes ueruqersae ueruqersea ueruqeresa ueruqereas ueruqearse ueruqeares ueruqeasre
ueruqeaser ueruqeaesr ueruqeaers ueruqesare ueruqesaer ueruqesrae ueruqesrea ueruqesera ueruqesear ueruqeeasr ueruqeears
ueruqeesar ueruqeesra ueruqeersa ueruqeeras ueruqaerse ueruqaeres ueruqaesre ueruqaeser ueruqaeesr ueruqaeers ueruqarese
ueruqarees ueruqarsee ueruqarsee ueruqarese ueruqarees ueruqasree ueruqasree ueruqasere ueruqaseer ueruqaseer ueruqasere
ueruqaerse ueruqaeres ueruqaesre ueruqaeser ueruqaeesr ueruqaeers ueruqseare ueruqseaer ueruqserae ueruqserea ueruqseera
ueruqseear ueruqsaere ueruqsaeer ueruqsaree ueruqsaree ueruqsaere ueruqsaeer ueruqsraee ueruqsraee ueruqsreae ueruqsreea
ueruqsreea ueruqsreae ueruqseare ueruqseaer ueruqserae ueruqserea ueruqseera ueruqseear ueruqeeasr ueruqeears ueruqeesar
ueruqeesra ueruqeersa ueruqeeras ueruqeaesr ueruqeaers ueruqeaser ueruqeasre ueruqearse ueruqeares ueruqesaer ueruqesare
ueruqesear ueruqesera ueruqesrea ueruqesrae ueruqerase ueruqeraes ueruqersae ueruqersea ueruqeresa ueruqereas uerusreqae
uerusreqea uerusreaqe uerusreaeq uerusreeaq uerusreeqa uerusrqeae uerusrqeea uerusrqaee uerusrqaee uerusrqeae uerusrqeea
uerusraqee uerusraqee uerusraeqe uerusraeeq uerusraeeq uerusraeqe uerusreqae uerusreqea uerusreaqe uerusreaeq uerusreeaq
uerusreeqa ueruserqae ueruserqea ueruseraqe ueruseraeq uerusereaq uerusereqa ueruseqrae ueruseqrea ueruseqare ueruseqaer
ueruseqear ueruseqera ueruseaqre ueruseaqer uerusearqe ueruseareq ueruseaerq ueruseaeqr ueruseeqar ueruseeqra ueruseeaqr
ueruseearq ueruseeraq ueruseerqa uerusqerae uerusqerea uerusqeare uerusqeaer uerusqeear uerusqeera uerusqreae uerusqreea
uerusqraee uerusqraee uerusqreae uerusqreea uerusqaree uerusqaree uerusqaere uerusqaeer uerusqaeer uerusqaere uerusqerae
uerusqerea uerusqeare uerusqeaer uerusqeear uerusqeera uerusaeqre uerusaeqer uerusaerqe uerusaereq uerusaeerq uerusaeeqr
uerusaqere uerusaqeer uerusaqree uerusaqree uerusaqere uerusaqeer uerusarqee uerusarqee uerusareqe uerusareeq uerusareeq
uerusareqe uerusaeqre uerusaeqer uerusaerqe uerusaereq uerusaeerq uerusaeeqr ueruseeqar ueruseeqra ueruseeaqr ueruseearq
ueruseeraq ueruseerqa ueruseqear ueruseqera ueruseqaer ueruseqare ueruseqrae ueruseqrea ueruseaqer ueruseaqre ueruseaeqr
ueruseaerq ueruseareq uerusearqe ueruserqae ueruserqea ueruseraqe ueruseraeq uerusereaq uerusereqa ueruereqsa ueruereqas
uerueresqa uerueresaq ueruereasq ueruereaqs ueruerqesa ueruerqeas ueruerqsea ueruerqsae ueruerqase ueruerqaes ueruersqea
ueruersqae ueruerseqa ueruerseaq ueruersaeq ueruersaqe uerueraqse uerueraqes ueruerasqe uerueraseq uerueraesq uerueraeqs
uerueerqsa uerueerqas uerueersqa uerueersaq uerueerasq uerueeraqs uerueeqrsa uerueeqras uerueeqsra uerueeqsar uerueeqasr
uerueeqars uerueesqra uerueesqar uerueesrqa uerueesraq uerueesarq uerueesaqr uerueeaqsr uerueeaqrs uerueeasqr uerueeasrq
uerueearsq uerueearqs uerueqersa uerueqeras uerueqesra uerueqesar uerueqeasr uerueqears uerueqresa uerueqreas uerueqrsea
uerueqrsae uerueqrase uerueqraes uerueqsrea uerueqsrae uerueqsera uerueqsear uerueqsaer uerueqsare uerueqarse uerueqares
uerueqasre uerueqaser uerueqaesr uerueqaers uerueseqra uerueseqar uerueserqa uerueseraq ueruesearq uerueseaqr ueruesqera
ueruesqear ueruesqrea ueruesqrae ueruesqare ueruesqaer ueruesrqea ueruesrqae ueruesreqa ueruesreaq ueruesraeq ueruesraqe
ueruesaqre ueruesaqer ueruesarqe ueruesareq ueruesaerq ueruesaeqr uerueaeqsr uerueaeqrs uerueaesqr uerueaesrq uerueaersq
uerueaerqs uerueaqesr uerueaqers uerueaqser uerueaqsre uerueaqrse uerueaqres uerueasqer uerueasqre uerueaseqr uerueaserq
uerueasreq uerueasrqe ueruearqse ueruearqes ueruearsqe ueruearseq ueruearesq uerueareqs uerearequs uereareqsu uereareuqs
uereareusq uerearesuq uerearesqu uerearqeus uerearqesu uerearques uerearquse uerearqsue uerearqseu uerearuqes uerearuqse
uerearueqs uerearuesq uerearuseq uerearusqe uerearsque uerearsqeu uerearsuqe uerearsueq uerearseuq uerearsequ uereaerqus
uereaerqsu uereaeruqs uereaerusq uereaersuq uereaersqu uereaeqrus uereaeqrsu uereaequrs uereaequsr uereaeqsur uereaeqsru
uereaeuqrs uereaeuqsr uereaeurqs uereaeursq uereaeusrq uereaeusqr uereaesqur uereaesqru uereaesuqr uereaesurq uereaesruq
uereaesrqu uereaqerus uereaqersu uereaqeurs uereaqeusr uereaqesur uereaqesru uereaqreus uereaqresu uereaqrues uereaqruse
uereaqrsue uereaqrseu uereaqures uereaqurse uereaquers uereaquesr uereaquser uereaqusre uereaqsrue uereaqsreu uereaqsure
uereaqsuer uereaqseur uereaqseru uereaueqrs uereaueqsr uereauerqs uereauersq uereauesrq uereauesqr uereauqers uereauqesr
uereauqres uereauqrse uereauqsre uereauqser uereaurqes uereaurqse uereaureqs uereauresq uereaurseq uereaursqe uereausqre
uereausqer uereausrqe uereausreq uereauserq uereauseqr uereasequr uereaseqru uereaseuqr uereaseurq uereaseruq uereaserqu
uereasqeur uereasqeru uereasquer uereasqure uereasqrue uereasqreu uereasuqer uereasuqre uereasueqr uereasuerq uereasureq
uereasurqe uereasrque uereasrqeu uereasruqe uereasrueq uereasreuq uereasrequ uereraequs uereraeqsu uereraeuqs uereraeusq
uereraesuq uereraesqu uereraqeus uereraqesu uereraques uereraquse uereraqsue uereraqseu uererauqes uererauqse uereraueqs
uererauesq uererauseq uererausqe uererasque uererasqeu uererasuqe uererasueq uereraseuq uererasequ uerereaqus uerereaqsu
uerereauqs uerereausq uerereasuq uerereasqu uerereqaus uerereqasu uererequas uererequsa uerereqsua uerereqsau uerereuqas
uerereuqsa uerereuaqs uerereuasq uerereusaq uerereusqa uereresqua uereresqau uereresuqa uereresuaq uereresauq uereresaqu
uererqeaus uererqeasu uererqeuas uererqeusa uererqesua uererqesau uererqaeus uererqaesu uererqaues uererqause uererqasue
uererqaseu uererquaes uererquase uererqueas uererquesa uererqusea uererqusae uererqsaue uererqsaeu uererqsuae uererqsuea
uererqseua uererqseau uererueqas uererueqsa uererueaqs uererueasq uereruesaq uereruesqa uereruqeas uereruqesa uereruqaes
uereruqase uereruqsae uereruqsea uereruaqes uereruaqse uereruaeqs uereruaesq uereruaseq uereruasqe uererusqae uererusqea
uererusaqe uererusaeq uereruseaq uereruseqa uerersequa uererseqau uererseuqa uererseuaq uererseauq uererseaqu uerersqeua
uerersqeau uerersquea uerersquae uerersqaue uerersqaeu uerersuqea uerersuqae uerersueqa uerersueaq uerersuaeq uerersuaqe
uerersaque uerersaqeu uerersauqe uerersaueq uerersaeuq uerersaequ uereeraqus uereeraqsu uereerauqs uereerausq uereerasuq
uereerasqu uereerqaus uereerqasu uereerquas uereerqusa uereerqsua uereerqsau uereeruqas uereeruqsa uereeruaqs uereeruasq
uereerusaq uereerusqa uereersqua uereersqau uereersuqa uereersuaq uereersauq uereersaqu uereearqus uereearqsu uereearuqs
uereearusq uereearsuq uereearsqu uereeaqrus uereeaqrsu uereeaqurs uereeaqusr uereeaqsur uereeaqsru uereeauqrs uereeauqsr
uereeaurqs uereeaursq uereeausrq uereeausqr uereeasqur uereeasqru uereeasuqr uereeasurq uereeasruq uereeasrqu uereeqarus
uereeqarsu uereeqaurs uereeqausr uereeqasur uereeqasru uereeqraus uereeqrasu uereeqruas uereeqrusa uereeqrsua uereeqrsau
uereequras uereeqursa uereequars uereequasr uereequsar uereequsra uereeqsrua uereeqsrau uereeqsura uereeqsuar uereeqsaur
uereeqsaru uereeuaqrs uereeuaqsr uereeuarqs uereeuarsq uereeuasrq uereeuasqr uereeuqars uereeuqasr uereeuqras uereeuqrsa
uereeuqsra uereeuqsar uereeurqas uereeurqsa uereeuraqs uereeurasq uereeursaq uereeursqa uereeusqra uereeusqar uereeusrqa
uereeusraq uereeusarq uereeusaqr uereesaqur uereesaqru uereesauqr uereesaurq uereesaruq uereesarqu uereesqaur uereesqaru
uereesquar uereesqura uereesqrua uereesqrau uereesuqar uereesuqra uereesuaqr uereesuarq uereesuraq uereesurqa uereesrqua
uereesrqau uereesruqa uereesruaq uereesrauq uereesraqu uereqreaus uereqreasu uereqreuas uereqreusa uereqresua uereqresau
uereqraeus uereqraesu uereqraues uereqrause uereqrasue uereqraseu uereqruaes uereqruase uereqrueas uereqruesa uereqrusea
uereqrusae uereqrsaue uereqrsaeu uereqrsuae uereqrsuea uereqrseua uereqrseau uereqeraus uereqerasu uereqeruas uereqerusa
uereqersua uereqersau uereqearus uereqearsu uereqeaurs uereqeausr uereqeasur uereqeasru uereqeuars uereqeuasr uereqeuras
uereqeursa uereqeusra uereqeusar uereqesaur uereqesaru uereqesuar uereqesura uereqesrua uereqesrau uereqaerus uereqaersu
uereqaeurs uereqaeusr uereqaesur uereqaesru uereqareus uereqaresu uereqarues uereqaruse uereqarsue uereqarseu uereqaures
uereqaurse uereqauers uereqauesr uereqauser uereqausre uereqasrue uereqasreu uereqasure uereqasuer uereqaseur uereqaseru
uerequears uerequeasr uerequeras uerequersa uerequesra uerequesar uerequaers uerequaesr uerequares uerequarse uerequasre
uerequaser uerequraes uerequrase uerequreas uerequresa uereqursea uereqursae uerequsare uerequsaer uerequsrae uerequsrea
uerequsera uerequsear uereqseaur uereqsearu uereqseuar uereqseura uereqserua uereqserau uereqsaeur uereqsaeru uereqsauer
uereqsaure uereqsarue uereqsareu uereqsuaer uereqsuare uereqsuear uereqsuera uereqsurea uereqsurae uereqsraue uereqsraeu
uereqsruae uereqsruea uereqsreua uereqsreau uereureqas uereureqsa uereureaqs uereureasq uereuresaq uereuresqa uereurqeas
uereurqesa uereurqaes uereurqase uereurqsae uereurqsea uereuraqes uereuraqse uereuraeqs uereuraesq uereuraseq uereurasqe
uereursqae uereursqea uereursaqe uereursaeq uereurseaq uereurseqa uereuerqas uereuerqsa uereueraqs uereuerasq uereuersaq
uereuersqa uereueqras uereueqrsa uereueqars uereueqasr uereueqsar uereueqsra uereueaqrs uereueaqsr uereuearqs uereuearsq
uereueasrq uereueasqr uereuesqar uereuesqra uereuesaqr uereuesarq uereuesraq uereuesrqa uereuqeras uereuqersa uereuqears
uereuqeasr uereuqesar uereuqesra uereuqreas uereuqresa uereuqraes uereuqrase uereuqrsae uereuqrsea uereuqares uereuqarse
uereuqaers uereuqaesr uereuqaser uereuqasre uereuqsrae uereuqsrea uereuqsare uereuqsaer uereuqsear uereuqsera uereuaeqrs
uereuaeqsr uereuaerqs uereuaersq uereuaesrq uereuaesqr uereuaqers uereuaqesr uereuaqres uereuaqrse uereuaqsre uereuaqser
uereuarqes uereuarqse uereuareqs uereuaresq uereuarseq uereuarsqe uereuasqre uereuasqer uereuasrqe uereuasreq uereuaserq
uereuaseqr uereuseqar uereuseqra uereuseaqr uereusearq uereuseraq uereuserqa uereusqear uereusqera uereusqaer uereusqare
uereusqrae uereusqrea uereusaqer uereusaqre uereusaeqr uereusaerq uereusareq uereusarqe uereusrqae uereusrqea uereusraqe
uereusraeq uereusreaq uereusreqa ueresrequa ueresreqau ueresreuqa ueresreuaq ueresreauq ueresreaqu ueresrqeua ueresrqeau
ueresrquea ueresrquae ueresrqaue ueresrqaeu ueresruqea ueresruqae ueresrueqa ueresrueaq ueresruaeq ueresruaqe ueresraque
ueresraqeu ueresrauqe ueresraueq ueresraeuq ueresraequ uereserqua uereserqau uereseruqa uereseruaq uereserauq uereseraqu
uereseqrua uereseqrau ueresequra ueresequar uereseqaur uereseqaru uereseuqra uereseuqar uereseurqa uereseuraq uereseuarq
uereseuaqr uereseaqur uereseaqru uereseauqr uereseaurq ueresearuq ueresearqu ueresqerua ueresqerau ueresqeura ueresqeuar
ueresqeaur ueresqearu ueresqreua ueresqreau ueresqruea ueresqruae ueresqraue ueresqraeu ueresqurea ueresqurae ueresquera
ueresquear ueresquaer ueresquare ueresqarue ueresqareu ueresqaure ueresqauer ueresqaeur ueresqaeru ueresueqra ueresueqar
ueresuerqa ueresueraq ueresuearq ueresueaqr ueresuqera ueresuqear ueresuqrea ueresuqrae ueresuqare ueresuqaer ueresurqea
ueresurqae ueresureqa ueresureaq ueresuraeq ueresuraqe ueresuaqre ueresuaqer ueresuarqe ueresuareq ueresuaerq ueresuaeqr
ueresaequr ueresaeqru ueresaeuqr ueresaeurq ueresaeruq ueresaerqu ueresaqeur ueresaqeru ueresaquer ueresaqure ueresaqrue
ueresaqreu ueresauqer ueresauqre ueresaueqr ueresauerq ueresaureq ueresaurqe ueresarque ueresarqeu ueresaruqe ueresarueq
ueresareuq ueresarequ

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us