easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

ardeaque

saravia

pigeonweed

armanni

diceramus

steerability

maculavissem

astrolog

overinfluencing

ervan

pulvillus

ricinus

brackenridge

landlordly

impounded

coler

banderol

pseudodictyosphaerium


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: tricar
cipher variations:
usjdbs vtkect wulfdu xvmgev ywnhfw
zxoigx aypjhy bzqkiz carlja dbsmkb
ectnlc fduomd gevpne hfwqof igxrpg
jhysqh kiztri ljausj mkbvtk nlcwul
omdxvm pneywn qofzxo rpgayp sqhbzq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: tricar
Cipher: girxzi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: tricar
Cipher: BAABA BAAAA ABAAA AAABA AAAAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: tricar
cipher variations:
usjdbsgazhbasiplbieqfpbqqyvtbycglxbgawrfbwmehjbe
ymxnbmkunrbuwcdvbciktzbkvtkecthbaicbtjqmcjfrgqcr
rzwuczdhmychbxsgcxnfikcfznyocnlvoscvxdewcdjluacl
wulfduicbjdcukrndkgshrdssaxvdaeinzdicythdyogjldg
aozpdomwptdwyefxdekmvbdmxvmgevjdckedvlsoelhtiset
tbywebfjoaejdzuiezphkmehbpaqepnxquexzfgyeflnwcen
ywnhfwkedlfewmtpfmiujtfuuczxfcgkpbfkeavjfaqilnfi
cqbrfqoyrvfyaghzfgmoxdfozxoigxlfemgfxnuqgnjvkugv
vdaygdhlqcglfbwkgbrjmogjdrcsgrpzswgzbhiaghnpyegp
aypjhymgfnhgyovrhokwlvhwwebzheimrdhmgcxlhcsknphk
esdthsqatxhacijbhioqzfhqbzqkiznhgoihzpwsiplxmwix
xfcaifjnseinhdymidtloqilfteuitrbuyibdjkcijpragir
carljaoihpjiaqxtjqmynxjyygdbjgkotfjoieznjeumprjm
gufvjuscvzjcekldjkqsbhjsdbsmkbpjiqkjbryukrnzoykz
zheckhlpugkpjfaokfvnqsknhvgwkvtdwakdflmeklrtcikt
ectnlcqkjrlkcszvlsoapzlaaifdlimqvhlqkgbplgwortlo
iwhxlwuexblegmnflmsudjlufduomdrlksmldtawmtpbqamb
bjgemjnrwimrlhcqmhxpsumpjxiymxvfycmfhnogmntvekmv
gevpnesmltnmeubxnuqcrbncckhfnkosxjnsmidrniyqtvnq
kyjznywgzdngiophnouwflnwhfwqoftnmuonfvcyovrdscod
dligolptykotnjesojzruworlzkaozxhaeohjpqiopvxgmox
igxrpguonvpogwdzpwsetdpeemjhpmquzlpuokftpkasvxps
malbpayibfpikqrjpqwyhnpyjhysqhvpowqphxeaqxtfueqf
fnkiqnrvamqvplguqlbtwyqtnbmcqbzjcgqjlrskqrxzioqz
kiztriwqpxrqiyfbryugvfrggoljroswbnrwqmhvrmcuxzru
ocndrcakdhrkmstlrsyajpraljausjxrqysrjzgcszvhwgsh
hpmksptxcosxrniwsndvyasvpdoesdbleislntumstzbkqsb
mkbvtkysrztskahdtawixhtiiqnltquydptysojxtoewzbtw
qepftecmfjtmouvntuaclrtcnlcwulztsautlbieubxjyiuj
jromurvzequztpkyupfxacuxrfqgufdngkunpvwouvbdmsud
omdxvmautbvumcjfvcykzjvkkspnvswafrvauqlzvqgybdvy
sgrhvgeohlvoqwxpvwcentvepneywnbvucwvndkgwdzlakwl
ltqowtxbgswbvrmawrhzcewzthsiwhfpimwprxyqwxdfouwf
qofzxocwvdxwoelhxeamblxmmurpxuychtxcwsnbxsiadfxa
uitjxigqjnxqsyzrxyegpvxgrpgaypdxweyxpfmiyfbncmyn
nvsqyvzdiuydxtocytjbegybvjukyjhrkoyrtzasyzfhqwyh
sqhbzqeyxfzyqgnjzgcodnzoowtrzwaejvzeyupdzukcfhzc
wkvlzkislpzsuabtzagirxzitricarfzygazrhokahdpeoap
pxusaxbfkwafzvqeavldgiadxlwmaljtmqatvbcuabhjsyaj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: tricar
Cipher: gevpne

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: tricar
Cipher: 442442311124

Extended Methods:
Method #1

Plaintext: tricar
method variations:
ywohfwdbtnlbigysqgomdxvm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
t r i c a r 
4 2 4 3 1 2 
4 4 2 1 1 4 
They are then read out in rows:
424312442114
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: tricar
Cipher: ioftbq

Read more ...
Method #3

Plaintext: tricar
method variations:
itmaft tmafti maftit
aftitm ftitma titmaf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: tricar

all 720 cipher variations:
tricar tricra triacr triarc trirac trirca trciar trcira trcair trcari trcrai
trcria tracir tracri traicr trairc traric trarci trrcai trrcia trraci trraic
trriac trrica tircar tircra tiracr tirarc tirrac tirrca ticrar ticrra ticarr
ticarr ticrar ticrra tiacrr tiacrr tiarcr tiarrc tiarrc tiarcr tircar tircra
tiracr tirarc tirrac tirrca tcirar tcirra tciarr tciarr tcirar tcirra tcriar
tcrira tcrair tcrari tcrrai tcrria tcarir tcarri tcairr tcairr tcarir tcarri
tcrrai tcrria tcrari tcrair tcriar tcrira taicrr taicrr taircr tairrc tairrc
taircr tacirr tacirr tacrir tacrri tacrri tacrir tarcir tarcri taricr tarirc
tarric tarrci tarcri tarcir tarrci tarric tarirc taricr tricar tricra triacr
triarc trirac trirca trciar trcira trcair trcari trcrai trcria tracir tracri
traicr trairc traric trarci trrcai trrcia trraci trraic trriac trrica rticar
rticra rtiacr rtiarc rtirac rtirca rtciar rtcira rtcair rtcari rtcrai rtcria
rtacir rtacri rtaicr rtairc rtaric rtarci rtrcai rtrcia rtraci rtraic rtriac
rtrica ritcar ritcra ritacr ritarc ritrac ritrca rictar rictra ricatr ricart
ricrat ricrta riactr riacrt riatcr riatrc riartc riarct rircat rircta riract
riratc rirtac rirtca rcitar rcitra rciatr rciart rcirat rcirta rctiar rctira
rctair rctari rctrai rctria rcatir rcatri rcaitr rcairt rcarit rcarti rcrtai
rcrtia rcrati rcrait rcriat rcrita raictr raicrt raitcr raitrc rairtc rairct
racitr racirt ractir ractri racrti racrit ratcir ratcri raticr ratirc ratric
ratrci rarcti rarcit rartci rartic raritc rarict rricat rricta rriact rriatc
rritac rritca rrciat rrcita rrcait rrcati rrctai rrctia rracit rracti rraict
rraitc rratic rratci rrtcai rrtcia rrtaci rrtaic rrtiac rrtica irtcar irtcra
irtacr irtarc irtrac irtrca irctar irctra ircatr ircart ircrat ircrta iractr
iracrt iratcr iratrc irartc irarct irrcat irrcta irract irratc irrtac irrtca
itrcar itrcra itracr itrarc itrrac itrrca itcrar itcrra itcarr itcarr itcrar
itcrra itacrr itacrr itarcr itarrc itarrc itarcr itrcar itrcra itracr itrarc
itrrac itrrca ictrar ictrra ictarr ictarr ictrar ictrra icrtar icrtra icratr
icrart icrrat icrrta icartr icarrt icatrr icatrr icartr icarrt icrrat icrrta
icrart icratr icrtar icrtra iatcrr iatcrr iatrcr iatrrc iatrrc iatrcr iactrr
iactrr iacrtr iacrrt iacrrt iacrtr iarctr iarcrt iartcr iartrc iarrtc iarrct
iarcrt iarctr iarrct iarrtc iartrc iartcr irtcar irtcra irtacr irtarc irtrac
irtrca irctar irctra ircatr ircart ircrat ircrta iractr iracrt iratcr iratrc
irartc irarct irrcat irrcta irract irratc irrtac irrtca critar critra criatr
criart crirat crirta crtiar crtira crtair crtari crtrai crtria cratir cratri
craitr crairt crarit crarti crrtai crrtia crrati crrait crriat crrita cirtar
cirtra ciratr cirart cirrat cirrta citrar citrra citarr citarr citrar citrra
ciatrr ciatrr ciartr ciarrt ciarrt ciartr cirtar cirtra ciratr cirart cirrat
cirrta ctirar ctirra ctiarr ctiarr ctirar ctirra ctriar ctrira ctrair ctrari
ctrrai ctrria ctarir ctarri ctairr ctairr ctarir ctarri ctrrai ctrria ctrari
ctrair ctriar ctrira caitrr caitrr cairtr cairrt cairrt cairtr catirr catirr
catrir catrri catrri catrir cartir cartri caritr carirt carrit carrti cartri
cartir carrti carrit carirt caritr critar critra criatr criart crirat crirta
crtiar crtira crtair crtari crtrai crtria cratir cratri craitr crairt crarit
crarti crrtai crrtia crrati crrait crriat crrita arictr aricrt aritcr aritrc
arirtc arirct arcitr arcirt arctir arctri arcrti arcrit artcir artcri articr
artirc artric artrci arrcti arrcit arrtci arrtic arritc arrict airctr aircrt
airtcr airtrc airrtc airrct aicrtr aicrrt aictrr aictrr aicrtr aicrrt aitcrr
aitcrr aitrcr aitrrc aitrrc aitrcr airctr aircrt airtcr airtrc airrtc airrct
acirtr acirrt acitrr acitrr acirtr acirrt acritr acrirt acrtir acrtri acrrti
acrrit actrir actrri actirr actirr actrir actrri acrrti acrrit acrtri acrtir
acritr acrirt aticrr aticrr atircr atirrc atirrc atircr atcirr atcirr atcrir
atcrri atcrri atcrir atrcir atrcri atricr atrirc atrric atrrci atrcri atrcir
atrrci atrric atrirc atricr arictr aricrt aritcr aritrc arirtc arirct arcitr
arcirt arctir arctri arcrti arcrit artcir artcri articr artirc artric artrci
arrcti arrcit arrtci arrtic arritc arrict rricat rricta rriact rriatc rritac
rritca rrciat rrcita rrcait rrcati rrctai rrctia rracit rracti rraict rraitc
rratic rratci rrtcai rrtcia rrtaci rrtaic rrtiac rrtica rircat rircta riract
riratc rirtac rirtca ricrat ricrta ricart ricatr rictar rictra riacrt riactr
riarct riartc riatrc riatcr ritcar ritcra ritacr ritarc ritrac ritrca rcirat
rcirta rciart rciatr rcitar rcitra rcriat rcrita rcrait rcrati rcrtai rcrtia
rcarit rcarti rcairt rcaitr rcatir rcatri rctrai rctria rctari rctair rctiar
rctira raicrt raictr rairct rairtc raitrc raitcr racirt racitr racrit racrti
ractri ractir rarcit rarcti rarict raritc rartic rartci ratcri ratcir ratrci
ratric ratirc raticr rticar rticra rtiacr rtiarc rtirac rtirca rtciar rtcira
rtcair rtcari rtcrai rtcria rtacir rtacri rtaicr rtairc rtaric rtarci rtrcai
rtrcia rtraci rtraic rtriac rtrica

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us