easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

nettesheim

decormier

clintonia

austwell

belemnitic

pressrooms

rosenkrans

hyperionyy

superatne

ramparting

zanger

stickball

mirabatur

classes

sinology

misnumbering

macjoel

crawler


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: tretter
cipher variations:
usfuufs vtgvvgt wuhwwhu xvixxiv ywjyyjw
zxkzzkx aylaaly bzmbbmz canccna dboddob
ecpeepc fdqffqd gerggre hfshhsf igtiitg
jhujjuh kivkkvi ljwllwj mkxmmxk nlynnyl
omzoozm pnappan qobqqbo rpcrrcp sqdssdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: tretter
Cipher: givggvi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: tretter
Cipher: BAABA BAAAA AABAA BAABA BAABA AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: tretter
cipher variations:
usfuufsganggnasivssvieqdeedqqylqqlycgtcctgawjaajwmermmre
ymzyyzmkuhkkhuwcpwwpcikxiixkvtgvvgthbohhobtjwttwjfreffer
rzmrrmzdhudduhbxkbbkxnfsnnsfznazzanlvillivxdqxxqdjlyjjyl
wuhwwhuicpiipcukxuuxkgsfggfssanssnaeiveevicylcclyogtootg
aobaabomwjmmjwyeryyrekmzkkzmxvixxivjdqjjqdvlyvvylhtghhgt
tbottobfjwffwjdzmddmzphuppuhbpcbbcpnxknnkxzfszzsflnallan
ywjyyjwkerkkrewmzwwzmiuhiihuucpuupcgkxggxkeaneenaqivqqvi
cqdccdqoyloolyagtaatgmobmmbozxkzzkxlfsllsfxnaxxanjvijjiv
vdqvvqdhlyhhylfboffobrjwrrwjdredderpzmppmzbhubbuhnpcnncp
aylaalymgtmmtgyobyybokwjkkjwwerwwreimziizmgcpggpcskxssxk
esfeefsqanqqnacivccvioqdoodqbzmbbmznhunnuhzpczzcplxkllkx
xfsxxsfjnajjanhdqhhqdtlyttylftgffgtrborrobdjwddwjprepper
canccnaoivooviaqdaadqmylmmlyygtyytgkobkkboieriireumzuuzm
guhgghuscpsspcekxeexkqsfqqfsdboddobpjwppwjbrebbernzmnnmz
zhuzzuhlpcllcpjfsjjsfvnavvanhvihhivtdqttqdflyffylrtgrrgt
ecpeepcqkxqqxkcsfccfsoanoonaaivaavimqdmmdqkgtkktgwobwwbo
iwjiijwueruuregmzggzmsuhsshufdqffqdrlyrryldtgddgtpboppob
bjwbbwjnrennerlhulluhxpcxxcpjxkjjkxvfsvvsfhnahhantvittiv
gerggresmzsszmeuheehuqcpqqpcckxccxkosfoofsmivmmviyqdyydq
kylkklywgtwwtgiobiibouwjuujwhfshhsftnattanfviffivrdqrrqd
dlyddylptgppgtnjwnnwjzrezzerlzmllmzxhuxxuhjpcjjcpvxkvvkx
igtiitguobuubogwjggjwserssreemzeezmquhqqhuokxooxkasfaafs
manmmnayivyyvikqdkkdqwylwwlyjhujjuhvpcvvcphxkhhkxtfsttsf
fnaffanrvirrivplyppylbtgbbgtnbonnobzjwzzwjlrellerxzmxxmz
kivkkviwqdwwdqiyliilyugtuutggobggboswjssjwqmzqqzmcuhcchu
ocpoopcakxaaxkmsfmmfsyanyynaljwllwjxrexxerjzmjjmzvhuvvuh
hpchhcptxkttkxrnarrandviddivpdqppqdblybbylntgnngtzbozzob
mkxmmxkysfyyfskankknawivwwviiqdiidquyluulysobssboewjeejw
qerqqrecmzcczmouhoohuacpaapcnlynnylztgzzgtlbollobxjwxxwj
jrejjervzmvvmztpcttcpfxkffkxrfsrrsfdnaddanpvippivbdqbbqd
omzoozmauhaahumcpmmpcykxyyxkksfkkfswanwwnauqduudqgylggly
sgtsstgeobeeboqwjqqjwcerccrepnappanbvibbivndqnnqdzlyzzyl
ltgllgtxboxxobvrevverhzmhhmzthuttuhfpcffcprxkrrkxdfsddsf
qobqqbocwjccjwoerooreamzaazmmuhmmhuycpyypcwsfwwfsianiina
uivuuvigqdggdqsylsslyegteetgrpcrrcpdxkddkxpfsppsfbnabban
nvinnivzdqzzqdxtgxxgtjbojjobvjwvvwjhrehhertzmttmzfhuffuh
sqdssdqeyleelyqgtqqtgcobccboowjoojwaeraareyuhyyhukcpkkpc
wkxwwxkisfiifsuanuunagivggvitretterfzmffmzrhurruhdpcddcp
pxkppkxbfsbbsfzvizzivldqllqdxlyxxyljtgjjgtvbovvobhjwhhwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: tretter
Cipher: gerggre

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: tretter
Cipher: 44245144445124

Extended Methods:
Method #1

Plaintext: tretter
method variations:
ywkyykwdbpddpbiguiiugomzoozm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
t r e t t e r 
4 2 5 4 4 5 2 
4 4 1 4 4 1 4 
They are then read out in rows:
42544524414414
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: tretter
Cipher: iuyrdtq

Read more ...
Method #3

Plaintext: tretter
method variations:
iyqtyft yqtyfti qtyftiy
tyftiyq yftiyqt ftiyqty
tiyqtyf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: tretter

all 5040 cipher variations:
tretter trettre tretetr tretert tretret tretrte tretter trettre tretetr tretert tretret
tretrte treettr treetrt treettr treetrt treertt treertt trertet trertte trerett trerett
trertet trertte trteter trtetre trteetr trteert trteret trterte trtteer trttere trtteer
trttere trttree trttree trteter trtetre trteetr trteert trteret trterte trtrtee trtrtee
trtrete trtreet trtreet trtrete trtteer trttere trtteer trttere trttree trttree trteter
trtetre trteetr trteert trteret trterte trteetr trteert trteter trtetre trterte trteret
trtreet trtrete trtreet trtrete trtrtee trtrtee tretter trettre tretetr tretert tretret
tretrte tretter trettre tretetr tretert tretret tretrte treettr treetrt treettr treetrt
treertt treertt trertet trertte trerett trerett trertet trertte trrttee trrttee trrtete
trrteet trrteet trrtete trrttee trrttee trrtete trrteet trrteet trrtete trrette trretet
trrette trretet trreett trreett trretet trrette trreett trreett trretet trrette tertter
terttre tertetr tertert tertret tertrte tertter terttre tertetr tertert tertret tertrte
terettr teretrt terettr teretrt terertt terertt terrtet terrtte terrett terrett terrtet
terrtte tetrter tetrtre tetretr tetrert tetrret tetrrte tettrer tettrre tetterr tetterr
tettrer tettrre tetetrr tetetrr tetertr teterrt teterrt tetertr tetrter tetrtre tetretr
tetrert tetrret tetrrte tettrer tettrre tetterr tetterr tettrer tettrre tetrter tetrtre
tetretr tetrert tetrret tetrrte tetertr teterrt tetetrr tetetrr tetertr teterrt tetrret
tetrrte tetrert tetretr tetrter tetrtre teettrr teettrr teetrtr teetrrt teetrrt teetrtr
teettrr teettrr teetrtr teetrrt teetrrt teetrtr teerttr teertrt teerttr teertrt teerrtt
teerrtt teertrt teerttr teerrtt teerrtt teertrt teerttr tertter terttre tertetr tertert
tertret tertrte tertter terttre tertetr tertert tertret tertrte terettr teretrt terettr
teretrt terertt terertt terrtet terrtte terrett terrett terrtet terrtte tterter ttertre
tteretr tterert tterret tterrte ttetrer ttetrre tteterr tteterr ttetrer ttetrre tteetrr
tteetrr tteertr tteerrt tteerrt tteertr tterter ttertre tteretr tterert tterret tterrte
ttreter ttretre ttreetr ttreert ttreret ttrerte ttrteer ttrtere ttrteer ttrtere ttrtree
ttrtree ttreter ttretre ttreetr ttreert ttreret ttrerte ttrrtee ttrrtee ttrrete ttrreet
ttrreet ttrrete tttreer tttrere tttreer tttrere tttrree tttrree ttterer ttterre ttteerr
ttteerr ttterer ttterre ttteerr ttteerr ttterer ttterre ttterre ttterer tttreer tttrere
tttreer tttrere tttrree tttrree tterter ttertre tteretr tterert tterret tterrte ttetrer
ttetrre tteterr tteterr ttetrer ttetrre tteetrr tteetrr tteertr tteerrt tteerrt tteertr
tterter ttertre tteretr tterert tterret tterrte ttrrtee ttrrtee ttrrete ttrreet ttrreet
ttrrete ttrtree ttrtree ttrtere ttrteer ttrteer ttrtere ttretre ttreter ttrerte ttreret
ttreert ttreetr ttreter ttretre ttreetr ttreert ttreret ttrerte ttetrer ttetrre tteterr
tteterr ttetrer ttetrre tterter ttertre tteretr tterert tterret tterrte tteertr tteerrt
tteetrr tteetrr tteertr tteerrt tterret tterrte tterert tteretr tterter ttertre ttterer
ttterre ttteerr ttteerr ttterer ttterre tttreer tttrere tttreer tttrere tttrree tttrree
ttterer ttterre ttteerr ttteerr ttterer ttterre tttrree tttrree tttrere tttreer tttreer
tttrere ttrteer ttrtere ttrteer ttrtere ttrtree ttrtree ttreter ttretre ttreetr ttreert
ttreret ttrerte ttreetr ttreert ttreter ttretre ttrerte ttreret ttrreet ttrrete ttrreet
ttrrete ttrrtee ttrrtee ttetrer ttetrre tteterr tteterr ttetrer ttetrre tterter ttertre
tteretr tterert tterret tterrte tteertr tteerrt tteetrr tteetrr tteertr tteerrt tterret
tterrte tterert tteretr tterter ttertre ttrtree ttrtree ttrtere ttrteer ttrteer ttrtere
ttrrtee ttrrtee ttrrete ttrreet ttrreet ttrrete ttrerte ttreret ttretre ttreter ttreetr
ttreert ttreret ttrerte ttreert ttreetr ttreter ttretre teettrr teettrr teetrtr teetrrt
teetrrt teetrtr teettrr teettrr teetrtr teetrrt teetrrt teetrtr teerttr teertrt teerttr
teertrt teerrtt teerrtt teertrt teerttr teerrtt teerrtt teertrt teerttr tetetrr tetetrr
tetertr teterrt teterrt tetertr tetterr tetterr tettrer tettrre tettrre tettrer tetrter
tetrtre tetretr tetrert tetrret tetrrte tetrtre tetrter tetrrte tetrret tetrert tetretr
tetterr tetterr tettrer tettrre tettrre tettrer tetetrr tetetrr tetertr teterrt teterrt
tetertr tetretr tetrert tetrter tetrtre tetrrte tetrret tetrert tetretr tetrret tetrrte
tetrtre tetrter tertter terttre tertetr tertert tertret tertrte tertter terttre tertetr
tertert tertret tertrte terettr teretrt terettr teretrt terertt terertt terrtet terrtte
terrett terrett terrtet terrtte terttre tertter tertrte tertret tertert tertetr terttre
tertter tertrte tertret tertert tertetr terrtte terrtet terrtte terrtet terrett terrett
teretrt terettr terertt terertt teretrt terettr tretter trettre tretetr tretert tretret
tretrte tretter trettre tretetr tretert tretret tretrte treettr treetrt treettr treetrt
treertt treertt trertet trertte trerett trerett trertet trertte trteter trtetre trteetr
trteert trteret trterte trtteer trttere trtteer trttere trttree trttree trteter trtetre
trteetr trteert trteret trterte trtrtee trtrtee trtrete trtreet trtreet trtrete trtteer
trttere trtteer trttere trttree trttree trteter trtetre trteetr trteert trteret trterte
trteetr trteert trteter trtetre trterte trteret trtreet trtrete trtreet trtrete trtrtee
trtrtee tretter trettre tretetr tretert tretret tretrte tretter trettre tretetr tretert
tretret tretrte treettr treetrt treettr treetrt treertt treertt trertet trertte trerett
trerett trertet trertte trrttee trrttee trrtete trrteet trrteet trrtete trrttee trrttee
trrtete trrteet trrteet trrtete trrette trretet trrette trretet trreett trreett trretet
trrette trreett trreett trretet trrette rtetter rtettre rtetetr rtetert rtetret rtetrte
rtetter rtettre rtetetr rtetert rtetret rtetrte rteettr rteetrt rteettr rteetrt rteertt
rteertt rtertet rtertte rterett rterett rtertet rtertte rtteter rttetre rtteetr rtteert
rtteret rtterte rttteer rtttere rttteer rtttere rtttree rtttree rtteter rttetre rtteetr
rtteert rtteret rtterte rttrtee rttrtee rttrete rttreet rttreet rttrete rttteer rtttere
rttteer rtttere rtttree rtttree rtteter rttetre rtteetr rtteert rtteret rtterte rtteetr
rtteert rtteter rttetre rtterte rtteret rttreet rttrete rttreet rttrete rttrtee rttrtee
rtetter rtettre rtetetr rtetert rtetret rtetrte rtetter rtettre rtetetr rtetert rtetret
rtetrte rteettr rteetrt rteettr rteetrt rteertt rteertt rtertet rtertte rterett rterett
rtertet rtertte rtrttee rtrttee rtrtete rtrteet rtrteet rtrtete rtrttee rtrttee rtrtete
rtrteet rtrteet rtrtete rtrette rtretet rtrette rtretet rtreett rtreett rtretet rtrette
rtreett rtreett rtretet rtrette rettter retttre rettetr rettert rettret rettrte rettter
retttre rettetr rettert rettret rettrte retettr retetrt retettr retetrt retertt retertt
retrtet retrtte retrett retrett retrtet retrtte rettter retttre rettetr rettert rettret
rettrte rettter retttre rettetr rettert rettret rettrte retettr retetrt retettr retetrt
retertt retertt retrtet retrtte retrett retrett retrtet retrtte rettter retttre rettetr
rettert rettret rettrte rettter retttre rettetr rettert rettret rettrte retettr retetrt
retettr retetrt retertt retertt retrtet retrtte retrett retrett retrtet retrtte reetttr
reettrt reetttr reettrt reetrtt reetrtt reetttr reettrt reetttr reettrt reetrtt reetrtt
reetttr reettrt reetttr reettrt reetrtt reetrtt reerttt reerttt reerttt reerttt reerttt
reerttt rerttet rerttte rertett rertett rerttet rerttte rerttet rerttte rertett rertett
rerttet rerttte rerettt rerettt rerettt rerettt rerettt rerettt rerttet rerttte rertett
rertett rerttet rerttte rtetter rtettre rtetetr rtetert rtetret rtetrte rtetter rtettre
rtetetr rtetert rtetret rtetrte rteettr rteetrt rteettr rteetrt rteertt rteertt rtertet
rtertte rterett rterett rtertet rtertte rtteter rttetre rtteetr rtteert rtteret rtterte
rttteer rtttere rttteer rtttere rtttree rtttree rtteter rttetre rtteetr rtteert rtteret
rtterte rttrtee rttrtee rttrete rttreet rttreet rttrete rttteer rtttere rttteer rtttere
rtttree rtttree rtteter rttetre rtteetr rtteert rtteret rtterte rtteetr rtteert rtteter
rttetre rtterte rtteret rttreet rttrete rttreet rttrete rttrtee rttrtee rtetter rtettre
rtetetr rtetert rtetret rtetrte rtetter rtettre rtetetr rtetert rtetret rtetrte rteettr
rteetrt rteettr rteetrt rteertt rteertt rtertet rtertte rterett rterett rtertet rtertte
rtrttee rtrttee rtrtete rtrteet rtrteet rtrtete rtrttee rtrttee rtrtete rtrteet rtrteet
rtrtete rtrette rtretet rtrette rtretet rtreett rtreett rtretet rtrette rtreett rtreett
rtretet rtrette rtetter rtettre rtetetr rtetert rtetret rtetrte rtetter rtettre rtetetr
rtetert rtetret rtetrte rteettr rteetrt rteettr rteetrt rteertt rteertt rtertet rtertte
rterett rterett rtertet rtertte rtteter rttetre rtteetr rtteert rtteret rtterte rttteer
rtttere rttteer rtttere rtttree rtttree rtteter rttetre rtteetr rtteert rtteret rtterte
rttrtee rttrtee rttrete rttreet rttreet rttrete rttteer rtttere rttteer rtttere rtttree
rtttree rtteter rttetre rtteetr rtteert rtteret rtterte rtteetr rtteert rtteter rttetre
rtterte rtteret rttreet rttrete rttreet rttrete rttrtee rttrtee rtetter rtettre rtetetr
rtetert rtetret rtetrte rtetter rtettre rtetetr rtetert rtetret rtetrte rteettr rteetrt
rteettr rteetrt rteertt rteertt rtertet rtertte rterett rterett rtertet rtertte rtrttee
rtrttee rtrtete rtrteet rtrteet rtrtete rtrttee rtrttee rtrtete rtrteet rtrteet rtrtete
rtrette rtretet rtrette rtretet rtreett rtreett rtretet rtrette rtreett rtreett rtretet
rtrette reetttr reettrt reetttr reettrt reetrtt reetrtt reetttr reettrt reetttr reettrt
reetrtt reetrtt reetttr reettrt reetttr reettrt reetrtt reetrtt reerttt reerttt reerttt
reerttt reerttt reerttt retettr retetrt retettr retetrt retertt retertt rettetr rettert
rettter retttre rettrte rettret rettter retttre rettetr rettert rettret rettrte retrtte
retrtet retrtte retrtet retrett retrett rettetr rettert rettter retttre rettrte rettret
retettr retetrt retettr retetrt retertt retertt rettetr rettert rettter retttre rettrte
rettret retrett retrett retrtet retrtte retrtte retrtet rettter retttre rettetr rettert
rettret rettrte rettter retttre rettetr rettert rettret rettrte retettr retetrt retettr
retetrt retertt retertt retrtet retrtte retrett retrett retrtet retrtte rerttte rerttet
rerttte rerttet rertett rertett rerttte rerttet rerttte rerttet rertett rertett rerttte
rerttet rerttte rerttet rertett rertett rerettt rerettt rerettt rerettt rerettt rerettt
rrettet rrettte rretett rretett rrettet rrettte rrettet rrettte rretett rretett rrettet
rrettte rreettt rreettt rreettt rreettt rreettt rreettt rrettet rrettte rretett rretett
rrettet rrettte rrtetet rrtette rrteett rrteett rrtetet rrtette rrtteet rrttete rrtteet
rrttete rrtttee rrtttee rrtetet rrtette rrteett rrteett rrtetet rrtette rrtttee rrtttee
rrttete rrtteet rrtteet rrttete rrtteet rrttete rrtteet rrttete rrtttee rrtttee rrtetet
rrtette rrteett rrteett rrtetet rrtette rrteett rrteett rrtetet rrtette rrtette rrtetet
rrtteet rrttete rrtteet rrttete rrtttee rrtttee rrettet rrettte rretett rretett rrettet
rrettte rrettet rrettte rretett rretett rrettet rrettte rreettt rreettt rreettt rreettt
rreettt rreettt rrettet rrettte rretett rretett rrettet rrettte rrtttee rrtttee rrttete
rrtteet rrtteet rrttete rrtttee rrtttee rrttete rrtteet rrtteet rrttete rrtette rrtetet
rrtette rrtetet rrteett rrteett rrtetet rrtette rrteett rrteett rrtetet rrtette erttter
ertttre erttetr erttert erttret erttrte erttter ertttre erttetr erttert erttret erttrte
ertettr ertetrt ertettr ertetrt ertertt ertertt ertrtet ertrtte ertrett ertrett ertrtet
ertrtte erttter ertttre erttetr erttert erttret erttrte erttter ertttre erttetr erttert
erttret erttrte ertettr ertetrt ertettr ertetrt ertertt ertertt ertrtet ertrtte ertrett
ertrett ertrtet ertrtte erttter ertttre erttetr erttert erttret erttrte erttter ertttre
erttetr erttert erttret erttrte ertettr ertetrt ertettr ertetrt ertertt ertertt ertrtet
ertrtte ertrett ertrett ertrtet ertrtte eretttr erettrt eretttr erettrt eretrtt eretrtt
eretttr erettrt eretttr erettrt eretrtt eretrtt eretttr erettrt eretttr erettrt eretrtt
eretrtt ererttt ererttt ererttt ererttt ererttt ererttt errttet errttte errtett errtett
errttet errttte errttet errttte errtett errtett errttet errttte errettt errettt errettt
errettt errettt errettt errttet errttte errtett errtett errttet errttte etrtter etrttre
etrtetr etrtert etrtret etrtrte etrtter etrttre etrtetr etrtert etrtret etrtrte etrettr
etretrt etrettr etretrt etrertt etrertt etrrtet etrrtte etrrett etrrett etrrtet etrrtte
ettrter ettrtre ettretr ettrert ettrret ettrrte etttrer etttrre ettterr ettterr etttrer
etttrre ettetrr ettetrr ettertr etterrt etterrt ettertr ettrter ettrtre ettretr ettrert
ettrret ettrrte etttrer etttrre ettterr ettterr etttrer etttrre ettrter ettrtre ettretr
ettrert ettrret ettrrte ettertr etterrt ettetrr ettetrr ettertr etterrt ettrret ettrrte
ettrert ettretr ettrter ettrtre etettrr etettrr etetrtr etetrrt etetrrt etetrtr etettrr
etettrr etetrtr etetrrt etetrrt etetrtr eterttr etertrt eterttr etertrt eterrtt eterrtt
etertrt eterttr eterrtt eterrtt etertrt eterttr etrtter etrttre etrtetr etrtert etrtret
etrtrte etrtter etrttre etrtetr etrtert etrtret etrtrte etrettr etretrt etrettr etretrt
etrertt etrertt etrrtet etrrtte etrrett etrrett etrrtet etrrtte ettrter ettrtre ettretr
ettrert ettrret ettrrte etttrer etttrre ettterr ettterr etttrer etttrre ettetrr ettetrr
ettertr etterrt etterrt ettertr ettrter ettrtre ettretr ettrert ettrret ettrrte etrtter
etrttre etrtetr etrtert etrtret etrtrte etrtter etrttre etrtetr etrtert etrtret etrtrte
etrettr etretrt etrettr etretrt etrertt etrertt etrrtet etrrtte etrrett etrrett etrrtet
etrrtte ettrter ettrtre ettretr ettrert ettrret ettrrte etttrer etttrre ettterr ettterr
etttrer etttrre ettetrr ettetrr ettertr etterrt etterrt ettertr ettrter ettrtre ettretr
ettrert ettrret ettrrte eterttr etertrt eterttr etertrt eterrtt eterrtt etetrtr etetrrt
etettrr etettrr etetrtr etetrrt etettrr etettrr etetrtr etetrrt etetrrt etetrtr eterttr
etertrt eterttr etertrt eterrtt eterrtt etrrtet etrrtte etrrett etrrett etrrtet etrrtte
etrtret etrtrte etrtert etrtetr etrtter etrttre etretrt etrettr etrertt etrertt etretrt
etrettr etrtter etrttre etrtetr etrtert etrtret etrtrte etttrer etttrre ettterr ettterr
etttrer etttrre ettrter ettrtre ettretr ettrert ettrret ettrrte ettertr etterrt ettetrr
ettetrr ettertr etterrt ettrret ettrrte ettrert ettretr ettrter ettrtre etttrer etttrre
ettterr ettterr etttrer etttrre ettrter ettrtre ettretr ettrert ettrret ettrrte ettertr
etterrt ettetrr ettetrr ettertr etterrt ettrret ettrrte ettrert ettretr ettrter ettrtre
etrtter etrttre etrtetr etrtert etrtret etrtrte etrtter etrttre etrtetr etrtert etrtret
etrtrte etrettr etretrt etrettr etretrt etrertt etrertt etrrtet etrrtte etrrett etrrett
etrrtet etrrtte etetrtr etetrrt etettrr etettrr etetrtr etetrrt eterttr etertrt eterttr
etertrt eterrtt eterrtt etetrtr etetrrt etettrr etettrr etetrtr etetrrt eterrtt eterrtt
etertrt eterttr eterttr etertrt etrtret etrtrte etrtert etrtetr etrtter etrttre etrrtet
etrrtte etrrett etrrett etrrtet etrrtte etrertt etrertt etretrt etrettr etrettr etretrt
etrtret etrtrte etrtert etrtetr etrtter etrttre eetttrr eetttrr eettrtr eettrrt eettrrt
eettrtr eetttrr eetttrr eettrtr eettrrt eettrrt eettrtr eetrttr eetrtrt eetrttr eetrtrt
eetrrtt eetrrtt eetrtrt eetrttr eetrrtt eetrrtt eetrtrt eetrttr eetttrr eetttrr eettrtr
eettrrt eettrrt eettrtr eetttrr eetttrr eettrtr eettrrt eettrrt eettrtr eetrttr eetrtrt
eetrttr eetrtrt eetrrtt eetrrtt eetrtrt eetrttr eetrrtt eetrrtt eetrtrt eetrttr eetttrr
eetttrr eettrtr eettrrt eettrrt eettrtr eetttrr eetttrr eettrtr eettrrt eettrrt eettrtr
eetrttr eetrtrt eetrttr eetrtrt eetrrtt eetrrtt eetrtrt eetrttr eetrrtt eetrrtt eetrtrt
eetrttr eertttr eerttrt eertttr eerttrt eertrtt eertrtt eertttr eerttrt eertttr eerttrt
eertrtt eertrtt eertttr eerttrt eertttr eerttrt eertrtt eertrtt eerrttt eerrttt eerrttt
eerrttt eerrttt eerrttt eerttrt eertttr eertrtt eertrtt eerttrt eertttr eerttrt eertttr
eertrtt eertrtt eerttrt eertttr eerrttt eerrttt eerrttt eerrttt eerrttt eerrttt eerttrt
eertttr eertrtt eertrtt eerttrt eertttr erttter ertttre erttetr erttert erttret erttrte
erttter ertttre erttetr erttert erttret erttrte ertettr ertetrt ertettr ertetrt ertertt
ertertt ertrtet ertrtte ertrett ertrett ertrtet ertrtte erttter ertttre erttetr erttert
erttret erttrte erttter ertttre erttetr erttert erttret erttrte ertettr ertetrt ertettr
ertetrt ertertt ertertt ertrtet ertrtte ertrett ertrett ertrtet ertrtte erttter ertttre
erttetr erttert erttret erttrte erttter ertttre erttetr erttert erttret erttrte ertettr
ertetrt ertettr ertetrt ertertt ertertt ertrtet ertrtte ertrett ertrett ertrtet ertrtte
eretttr erettrt eretttr erettrt eretrtt eretrtt eretttr erettrt eretttr erettrt eretrtt
eretrtt eretttr erettrt eretttr erettrt eretrtt eretrtt ererttt ererttt ererttt ererttt
ererttt ererttt errttet errttte errtett errtett errttet errttte errttet errttte errtett
errtett errttet errttte errettt errettt errettt errettt errettt errettt errttet errttte
errtett errtett errttet errttte tretter trettre tretetr tretert tretret tretrte tretter
trettre tretetr tretert tretret tretrte treettr treetrt treettr treetrt treertt treertt
trertet trertte trerett trerett trertet trertte trteter trtetre trteetr trteert trteret
trterte trtteer trttere trtteer trttere trttree trttree trteter trtetre trteetr trteert
trteret trterte trtrtee trtrtee trtrete trtreet trtreet trtrete trtteer trttere trtteer
trttere trttree trttree trteter trtetre trteetr trteert trteret trterte trteetr trteert
trteter trtetre trterte trteret trtreet trtrete trtreet trtrete trtrtee trtrtee tretter
trettre tretetr tretert tretret tretrte tretter trettre tretetr tretert tretret tretrte
treettr treetrt treettr treetrt treertt treertt trertet trertte trerett trerett trertet
trertte trrttee trrttee trrtete trrteet trrteet trrtete trrttee trrttee trrtete trrteet
trrteet trrtete trrette trretet trrette trretet trreett trreett trretet trrette trreett
trreett trretet trrette tertter terttre tertetr tertert tertret tertrte tertter terttre
tertetr tertert tertret tertrte terettr teretrt terettr teretrt terertt terertt terrtet
terrtte terrett terrett terrtet terrtte tetrter tetrtre tetretr tetrert tetrret tetrrte
tettrer tettrre tetterr tetterr tettrer tettrre tetetrr tetetrr tetertr teterrt teterrt
tetertr tetrter tetrtre tetretr tetrert tetrret tetrrte tettrer tettrre tetterr tetterr
tettrer tettrre tetrter tetrtre tetretr tetrert tetrret tetrrte tetertr teterrt tetetrr
tetetrr tetertr teterrt tetrret tetrrte tetrert tetretr tetrter tetrtre teettrr teettrr
teetrtr teetrrt teetrrt teetrtr teettrr teettrr teetrtr teetrrt teetrrt teetrtr teerttr
teertrt teerttr teertrt teerrtt teerrtt teertrt teerttr teerrtt teerrtt teertrt teerttr
tertter terttre tertetr tertert tertret tertrte tertter terttre tertetr tertert tertret
tertrte terettr teretrt terettr teretrt terertt terertt terrtet terrtte terrett terrett
terrtet terrtte tterter ttertre tteretr tterert tterret tterrte ttetrer ttetrre tteterr
tteterr ttetrer ttetrre tteetrr tteetrr tteertr tteerrt tteerrt tteertr tterter ttertre
tteretr tterert tterret tterrte ttreter ttretre ttreetr ttreert ttreret ttrerte ttrteer
ttrtere ttrteer ttrtere ttrtree ttrtree ttreter ttretre ttreetr ttreert ttreret ttrerte
ttrrtee ttrrtee ttrrete ttrreet ttrreet ttrrete tttreer tttrere tttreer tttrere tttrree
tttrree ttterer ttterre ttteerr ttteerr ttterer ttterre ttteerr ttteerr ttterer ttterre
ttterre ttterer tttreer tttrere tttreer tttrere tttrree tttrree tterter ttertre tteretr
tterert tterret tterrte ttetrer ttetrre tteterr tteterr ttetrer ttetrre tteetrr tteetrr
tteertr tteerrt tteerrt tteertr tterter ttertre tteretr tterert tterret tterrte ttrrtee
ttrrtee ttrrete ttrreet ttrreet ttrrete ttrtree ttrtree ttrtere ttrteer ttrteer ttrtere
ttretre ttreter ttrerte ttreret ttreert ttreetr ttreter ttretre ttreetr ttreert ttreret
ttrerte ttetrer ttetrre tteterr tteterr ttetrer ttetrre tterter ttertre tteretr tterert
tterret tterrte tteertr tteerrt tteetrr tteetrr tteertr tteerrt tterret tterrte tterert
tteretr tterter ttertre ttterer ttterre ttteerr ttteerr ttterer ttterre tttreer tttrere
tttreer tttrere tttrree tttrree ttterer ttterre ttteerr ttteerr ttterer ttterre tttrree
tttrree tttrere tttreer tttreer tttrere ttrteer ttrtere ttrteer ttrtere ttrtree ttrtree
ttreter ttretre ttreetr ttreert ttreret ttrerte ttreetr ttreert ttreter ttretre ttrerte
ttreret ttrreet ttrrete ttrreet ttrrete ttrrtee ttrrtee ttetrer ttetrre tteterr tteterr
ttetrer ttetrre tterter ttertre tteretr tterert tterret tterrte tteertr tteerrt tteetrr
tteetrr tteertr tteerrt tterret tterrte tterert tteretr tterter ttertre ttrtree ttrtree
ttrtere ttrteer ttrteer ttrtere ttrrtee ttrrtee ttrrete ttrreet ttrreet ttrrete ttrerte
ttreret ttretre ttreter ttreetr ttreert ttreret ttrerte ttreert ttreetr ttreter ttretre
teettrr teettrr teetrtr teetrrt teetrrt teetrtr teettrr teettrr teetrtr teetrrt teetrrt
teetrtr teerttr teertrt teerttr teertrt teerrtt teerrtt teertrt teerttr teerrtt teerrtt
teertrt teerttr tetetrr tetetrr tetertr teterrt teterrt tetertr tetterr tetterr tettrer
tettrre tettrre tettrer tetrter tetrtre tetretr tetrert tetrret tetrrte tetrtre tetrter
tetrrte tetrret tetrert tetretr tetterr tetterr tettrer tettrre tettrre tettrer tetetrr
tetetrr tetertr teterrt teterrt tetertr tetretr tetrert tetrter tetrtre tetrrte tetrret
tetrert tetretr tetrret tetrrte tetrtre tetrter tertter terttre tertetr tertert tertret
tertrte tertter terttre tertetr tertert tertret tertrte terettr teretrt terettr teretrt
terertt terertt terrtet terrtte terrett terrett terrtet terrtte terttre tertter tertrte
tertret tertert tertetr terttre tertter tertrte tertret tertert tertetr terrtte terrtet
terrtte terrtet terrett terrett teretrt terettr terertt terertt teretrt terettr tretter
trettre tretetr tretert tretret tretrte tretter trettre tretetr tretert tretret tretrte
treettr treetrt treettr treetrt treertt treertt trertet trertte trerett trerett trertet
trertte trteter trtetre trteetr trteert trteret trterte trtteer trttere trtteer trttere
trttree trttree trteter trtetre trteetr trteert trteret trterte trtrtee trtrtee trtrete
trtreet trtreet trtrete trtteer trttere trtteer trttere trttree trttree trteter trtetre
trteetr trteert trteret trterte trteetr trteert trteter trtetre trterte trteret trtreet
trtrete trtreet trtrete trtrtee trtrtee tretter trettre tretetr tretert tretret tretrte
tretter trettre tretetr tretert tretret tretrte treettr treetrt treettr treetrt treertt
treertt trertet trertte trerett trerett trertet trertte trrttee trrttee trrtete trrteet
trrteet trrtete trrttee trrttee trrtete trrteet trrteet trrtete trrette trretet trrette
trretet trreett trreett trretet trrette trreett trreett trretet trrette tretter trettre
tretetr tretert tretret tretrte tretter trettre tretetr tretert tretret tretrte treettr
treetrt treettr treetrt treertt treertt trertet trertte trerett trerett trertet trertte
trteter trtetre trteetr trteert trteret trterte trtteer trttere trtteer trttere trttree
trttree trteter trtetre trteetr trteert trteret trterte trtrtee trtrtee trtrete trtreet
trtreet trtrete trtteer trttere trtteer trttere trttree trttree trteter trtetre trteetr
trteert trteret trterte trteetr trteert trteter trtetre trterte trteret trtreet trtrete
trtreet trtrete trtrtee trtrtee tretter trettre tretetr tretert tretret tretrte tretter
trettre tretetr tretert tretret tretrte treettr treetrt treettr treetrt treertt treertt
trertet trertte trerett trerett trertet trertte trrttee trrttee trrtete trrteet trrteet
trrtete trrttee trrttee trrtete trrteet trrteet trrtete trrette trretet trrette trretet
trreett trreett trretet trrette trreett trreett trretet trrette tertter terttre tertetr
tertert tertret tertrte tertter terttre tertetr tertert tertret tertrte terettr teretrt
terettr teretrt terertt terertt terrtet terrtte terrett terrett terrtet terrtte tetrter
tetrtre tetretr tetrert tetrret tetrrte tettrer tettrre tetterr tetterr tettrer tettrre
tetetrr tetetrr tetertr teterrt teterrt tetertr tetrter tetrtre tetretr tetrert tetrret
tetrrte tettrer tettrre tetterr tetterr tettrer tettrre tetrter tetrtre tetretr tetrert
tetrret tetrrte tetertr teterrt tetetrr tetetrr tetertr teterrt tetrret tetrrte tetrert
tetretr tetrter tetrtre teettrr teettrr teetrtr teetrrt teetrrt teetrtr teettrr teettrr
teetrtr teetrrt teetrrt teetrtr teerttr teertrt teerttr teertrt teerrtt teerrtt teertrt
teerttr teerrtt teerrtt teertrt teerttr tertter terttre tertetr tertert tertret tertrte
tertter terttre tertetr tertert tertret tertrte terettr teretrt terettr teretrt terertt
terertt terrtet terrtte terrett terrett terrtet terrtte tterter ttertre tteretr tterert
tterret tterrte ttetrer ttetrre tteterr tteterr ttetrer ttetrre tteetrr tteetrr tteertr
tteerrt tteerrt tteertr tterter ttertre tteretr tterert tterret tterrte ttreter ttretre
ttreetr ttreert ttreret ttrerte ttrteer ttrtere ttrteer ttrtere ttrtree ttrtree ttreter
ttretre ttreetr ttreert ttreret ttrerte ttrrtee ttrrtee ttrrete ttrreet ttrreet ttrrete
tttreer tttrere tttreer tttrere tttrree tttrree ttterer ttterre ttteerr ttteerr ttterer
ttterre ttteerr ttteerr ttterer ttterre ttterre ttterer tttreer tttrere tttreer tttrere
tttrree tttrree tterter ttertre tteretr tterert tterret tterrte ttetrer ttetrre tteterr
tteterr ttetrer ttetrre tteetrr tteetrr tteertr tteerrt tteerrt tteertr tterter ttertre
tteretr tterert tterret tterrte ttrrtee ttrrtee ttrrete ttrreet ttrreet ttrrete ttrtree
ttrtree ttrtere ttrteer ttrteer ttrtere ttretre ttreter ttrerte ttreret ttreert ttreetr
ttreter ttretre ttreetr ttreert ttreret ttrerte ttetrer ttetrre tteterr tteterr ttetrer
ttetrre tterter ttertre tteretr tterert tterret tterrte tteertr tteerrt tteetrr tteetrr
tteertr tteerrt tterret tterrte tterert tteretr tterter ttertre ttterer ttterre ttteerr
ttteerr ttterer ttterre tttreer tttrere tttreer tttrere tttrree tttrree ttterer ttterre
ttteerr ttteerr ttterer ttterre tttrree tttrree tttrere tttreer tttreer tttrere ttrteer
ttrtere ttrteer ttrtere ttrtree ttrtree ttreter ttretre ttreetr ttreert ttreret ttrerte
ttreetr ttreert ttreter ttretre ttrerte ttreret ttrreet ttrrete ttrreet ttrrete ttrrtee
ttrrtee ttetrer ttetrre tteterr tteterr ttetrer ttetrre tterter ttertre tteretr tterert
tterret tterrte tteertr tteerrt tteetrr tteetrr tteertr tteerrt tterret tterrte tterert
tteretr tterter ttertre ttrtree ttrtree ttrtere ttrteer ttrteer ttrtere ttrrtee ttrrtee
ttrrete ttrreet ttrreet ttrrete ttrerte ttreret ttretre ttreter ttreetr ttreert ttreret
ttrerte ttreert ttreetr ttreter ttretre teettrr teettrr teetrtr teetrrt teetrrt teetrtr
teettrr teettrr teetrtr teetrrt teetrrt teetrtr teerttr teertrt teerttr teertrt teerrtt
teerrtt teertrt teerttr teerrtt teerrtt teertrt teerttr tetetrr tetetrr tetertr teterrt
teterrt tetertr tetterr tetterr tettrer tettrre tettrre tettrer tetrter tetrtre tetretr
tetrert tetrret tetrrte tetrtre tetrter tetrrte tetrret tetrert tetretr tetterr tetterr
tettrer tettrre tettrre tettrer tetetrr tetetrr tetertr teterrt teterrt tetertr tetretr
tetrert tetrter tetrtre tetrrte tetrret tetrert tetretr tetrret tetrrte tetrtre tetrter
tertter terttre tertetr tertert tertret tertrte tertter terttre tertetr tertert tertret
tertrte terettr teretrt terettr teretrt terertt terertt terrtet terrtte terrett terrett
terrtet terrtte terttre tertter tertrte tertret tertert tertetr terttre tertter tertrte
tertret tertert tertetr terrtte terrtet terrtte terrtet terrett terrett teretrt terettr
terertt terertt teretrt terettr tretter trettre tretetr tretert tretret tretrte tretter
trettre tretetr tretert tretret tretrte treettr treetrt treettr treetrt treertt treertt
trertet trertte trerett trerett trertet trertte trteter trtetre trteetr trteert trteret
trterte trtteer trttere trtteer trttere trttree trttree trteter trtetre trteetr trteert
trteret trterte trtrtee trtrtee trtrete trtreet trtreet trtrete trtteer trttere trtteer
trttere trttree trttree trteter trtetre trteetr trteert trteret trterte trteetr trteert
trteter trtetre trterte trteret trtreet trtrete trtreet trtrete trtrtee trtrtee tretter
trettre tretetr tretert tretret tretrte tretter trettre tretetr tretert tretret tretrte
treettr treetrt treettr treetrt treertt treertt trertet trertte trerett trerett trertet
trertte trrttee trrttee trrtete trrteet trrteet trrtete trrttee trrttee trrtete trrteet
trrteet trrtete trrette trretet trrette trretet trreett trreett trretet trrette trreett
trreett trretet trrette eretttr erettrt eretttr erettrt eretrtt eretrtt eretttr erettrt
eretttr erettrt eretrtt eretrtt eretttr erettrt eretttr erettrt eretrtt eretrtt ererttt
ererttt ererttt ererttt ererttt ererttt ertettr ertetrt ertettr ertetrt ertertt ertertt
erttetr erttert erttter ertttre erttrte erttret erttter ertttre erttetr erttert erttret
erttrte ertrtte ertrtet ertrtte ertrtet ertrett ertrett erttetr erttert erttter ertttre
erttrte erttret ertettr ertetrt ertettr ertetrt ertertt ertertt erttetr erttert erttter
ertttre erttrte erttret ertrett ertrett ertrtet ertrtte ertrtte ertrtet erttter ertttre
erttetr erttert erttret erttrte erttter ertttre erttetr erttert erttret erttrte ertettr
ertetrt ertettr ertetrt ertertt ertertt ertrtet ertrtte ertrett ertrett ertrtet ertrtte
errttte errttet errttte errttet errtett errtett errttte errttet errttte errttet errtett
errtett errttte errttet errttte errttet errtett errtett errettt errettt errettt errettt
errettt errettt eertttr eerttrt eertttr eerttrt eertrtt eertrtt eertttr eerttrt eertttr
eerttrt eertrtt eertrtt eertttr eerttrt eertttr eerttrt eertrtt eertrtt eerrttt eerrttt
eerrttt eerrttt eerrttt eerrttt eetrttr eetrtrt eetrttr eetrtrt eetrrtt eetrrtt eettrtr
eettrrt eetttrr eetttrr eettrtr eettrrt eetttrr eetttrr eettrtr eettrrt eettrrt eettrtr
eetrttr eetrtrt eetrttr eetrtrt eetrrtt eetrrtt eettrtr eettrrt eetttrr eetttrr eettrtr
eettrrt eetrttr eetrtrt eetrttr eetrtrt eetrrtt eetrrtt eettrtr eettrrt eetttrr eetttrr
eettrtr eettrrt eetrrtt eetrrtt eetrtrt eetrttr eetrttr eetrtrt eetttrr eetttrr eettrtr
eettrrt eettrrt eettrtr eetttrr eetttrr eettrtr eettrrt eettrrt eettrtr eetrttr eetrtrt
eetrttr eetrtrt eetrrtt eetrrtt eetrtrt eetrttr eetrrtt eetrrtt eetrtrt eetrttr eertttr
eerttrt eertttr eerttrt eertrtt eertrtt eertttr eerttrt eertttr eerttrt eertrtt eertrtt
eertttr eerttrt eertttr eerttrt eertrtt eertrtt eerrttt eerrttt eerrttt eerrttt eerrttt
eerrttt eterttr etertrt eterttr etertrt eterrtt eterrtt etetrtr etetrrt etettrr etettrr
etetrtr etetrrt etettrr etettrr etetrtr etetrrt etetrrt etetrtr eterttr etertrt eterttr
etertrt eterrtt eterrtt etrettr etretrt etrettr etretrt etrertt etrertt etrtetr etrtert
etrtter etrttre etrtrte etrtret etrtter etrttre etrtetr etrtert etrtret etrtrte etrrtte
etrrtet etrrtte etrrtet etrrett etrrett ettretr ettrert ettrter ettrtre ettrrte ettrret
ettertr etterrt ettetrr ettetrr ettertr etterrt ettterr ettterr etttrer etttrre etttrre
etttrer ettretr ettrert ettrter ettrtre ettrrte ettrret ettrter ettrtre ettretr ettrert
ettrret ettrrte etttrer etttrre ettterr ettterr etttrer etttrre ettetrr ettetrr ettertr
etterrt etterrt ettertr ettrter ettrtre ettretr ettrert ettrret ettrrte etrrtte etrrtet
etrrtte etrrtet etrrett etrrett etrtrte etrtret etrttre etrtter etrtetr etrtert etrttre
etrtter etrtrte etrtret etrtert etrtetr etrettr etretrt etrettr etretrt etrertt etrertt
etetrtr etetrrt etettrr etettrr etetrtr etetrrt eterttr etertrt eterttr etertrt eterrtt
eterrtt etetrtr etetrrt etettrr etettrr etetrtr etetrrt eterrtt eterrtt etertrt eterttr
eterttr etertrt ettertr etterrt ettetrr ettetrr ettertr etterrt ettretr ettrert ettrter
ettrtre ettrrte ettrret etttrer etttrre ettterr ettterr etttrer etttrre ettrrte ettrret
ettrtre ettrter ettretr ettrert etrtetr etrtert etrtter etrttre etrtrte etrtret etrettr
etretrt etrettr etretrt etrertt etrertt etrtetr etrtert etrtter etrttre etrtrte etrtret
etrrett etrrett etrrtet etrrtte etrrtte etrrtet etttrer etttrre ettterr ettterr etttrer
etttrre ettrter ettrtre ettretr ettrert ettrret ettrrte ettertr etterrt ettetrr ettetrr
ettertr etterrt ettrret ettrrte ettrert ettretr ettrter ettrtre etrtrte etrtret etrttre
etrtter etrtetr etrtert etrrtte etrrtet etrrtte etrrtet etrrett etrrett etrtrte etrtret
etrttre etrtter etrtetr etrtert etrertt etrertt etretrt etrettr etrettr etretrt etettrr
etettrr etetrtr etetrrt etetrrt etetrtr etettrr etettrr etetrtr etetrrt etetrrt etetrtr
eterttr etertrt eterttr etertrt eterrtt eterrtt etertrt eterttr eterrtt eterrtt etertrt
eterttr ettetrr ettetrr ettertr etterrt etterrt ettertr ettterr ettterr etttrer etttrre
etttrre etttrer ettrter ettrtre ettretr ettrert ettrret ettrrte ettrtre ettrter ettrrte
ettrret ettrert ettretr ettterr ettterr etttrer etttrre etttrre etttrer ettetrr ettetrr
ettertr etterrt etterrt ettertr ettretr ettrert ettrter ettrtre ettrrte ettrret ettrert
ettretr ettrret ettrrte ettrtre ettrter etrtter etrttre etrtetr etrtert etrtret etrtrte
etrtter etrttre etrtetr etrtert etrtret etrtrte etrettr etretrt etrettr etretrt etrertt
etrertt etrrtet etrrtte etrrett etrrett etrrtet etrrtte etrttre etrtter etrtrte etrtret
etrtert etrtetr etrttre etrtter etrtrte etrtret etrtert etrtetr etrrtte etrrtet etrrtte
etrrtet etrrett etrrett etretrt etrettr etrertt etrertt etretrt etrettr eretttr erettrt
eretttr erettrt eretrtt eretrtt eretttr erettrt eretttr erettrt eretrtt eretrtt eretttr
erettrt eretttr erettrt eretrtt eretrtt ererttt ererttt ererttt ererttt ererttt ererttt
ertettr ertetrt ertettr ertetrt ertertt ertertt erttetr erttert erttter ertttre erttrte
erttret erttter ertttre erttetr erttert erttret erttrte ertrtte ertrtet ertrtte ertrtet
ertrett ertrett erttetr erttert erttter ertttre erttrte erttret ertettr ertetrt ertettr
ertetrt ertertt ertertt erttetr erttert erttter ertttre erttrte erttret ertrett ertrett
ertrtet ertrtte ertrtte ertrtet erttter ertttre erttetr erttert erttret erttrte erttter
ertttre erttetr erttert erttret erttrte ertettr ertetrt ertettr ertetrt ertertt ertertt
ertrtet ertrtte ertrett ertrett ertrtet ertrtte errttte errttet errttte errttet errtett
errtett errttte errttet errttte errttet errtett errtett errttte errttet errttte errttet
errtett errtett errettt errettt errettt errettt errettt errettt rrettet rrettte rretett
rretett rrettet rrettte rrettet rrettte rretett rretett rrettet rrettte rreettt rreettt
rreettt rreettt rreettt rreettt rrettet rrettte rretett rretett rrettet rrettte rrtetet
rrtette rrteett rrteett rrtetet rrtette rrtteet rrttete rrtteet rrttete rrtttee rrtttee
rrtetet rrtette rrteett rrteett rrtetet rrtette rrtttee rrtttee rrttete rrtteet rrtteet
rrttete rrtteet rrttete rrtteet rrttete rrtttee rrtttee rrtetet rrtette rrteett rrteett
rrtetet rrtette rrteett rrteett rrtetet rrtette rrtette rrtetet rrtteet rrttete rrtteet
rrttete rrtttee rrtttee rrettet rrettte rretett rretett rrettet rrettte rrettet rrettte
rretett rretett rrettet rrettte rreettt rreettt rreettt rreettt rreettt rreettt rrettet
rrettte rretett rretett rrettet rrettte rrtttee rrtttee rrttete rrtteet rrtteet rrttete
rrtttee rrtttee rrttete rrtteet rrtteet rrttete rrtette rrtetet rrtette rrtetet rrteett
rrteett rrtetet rrtette rrteett rrteett rrtetet rrtette rerttet rerttte rertett rertett
rerttet rerttte rerttet rerttte rertett rertett rerttet rerttte rerettt rerettt rerettt
rerettt rerettt rerettt rerttet rerttte rertett rertett rerttet rerttte retrtet retrtte
retrett retrett retrtet retrtte rettret rettrte rettert rettetr rettter retttre retetrt
retettr retertt retertt retetrt retettr rettter retttre rettetr rettert rettret rettrte
rettret rettrte rettert rettetr rettter retttre retrtet retrtte retrett retrett retrtet
retrtte retertt retertt retetrt retettr retettr retetrt rettret rettrte rettert rettetr
rettter retttre reettrt reetttr reetrtt reetrtt reettrt reetttr reettrt reetttr reetrtt
reetrtt reettrt reetttr reerttt reerttt reerttt reerttt reerttt reerttt reettrt reetttr
reetrtt reetrtt reettrt reetttr rettter retttre rettetr rettert rettret rettrte rettter
retttre rettetr rettert rettret rettrte retettr retetrt retettr retetrt retertt retertt
retrtet retrtte retrett retrett retrtet retrtte rtertet rtertte rterett rterett rtertet
rtertte rtetret rtetrte rtetert rtetetr rtetter rtettre rteetrt rteettr rteertt rteertt
rteetrt rteettr rtetter rtettre rtetetr rtetert rtetret rtetrte rtretet rtrette rtreett
rtreett rtretet rtrette rtrteet rtrtete rtrteet rtrtete rtrttee rtrttee rtretet rtrette
rtreett rtreett rtretet rtrette rtrttee rtrttee rtrtete rtrteet rtrteet rtrtete rttreet
rttrete rttreet rttrete rttrtee rttrtee rtteret rtterte rtteert rtteetr rtteter rttetre
rtteert rtteetr rtteret rtterte rttetre rtteter rttteer rtttere rttteer rtttere rtttree
rtttree rtertet rtertte rterett rterett rtertet rtertte rtetret rtetrte rtetert rtetetr
rtetter rtettre rteetrt rteettr rteertt rteertt rteetrt rteettr rtetter rtettre rtetetr
rtetert rtetret rtetrte rttrtee rttrtee rttrete rttreet rttreet rttrete rtttree rtttree
rtttere rttteer rttteer rtttere rttetre rtteter rtterte rtteret rtteert rtteetr rtteter
rttetre rtteetr rtteert rtteret rtterte rtetret rtetrte rtetert rtetetr rtetter rtettre
rtertet rtertte rterett rterett rtertet rtertte rteertt rteertt rteetrt rteettr rteettr
rteetrt rtetret rtetrte rtetert rtetetr rtetter rtettre rtteret rtterte rtteert rtteetr
rtteter rttetre rttreet rttrete rttreet rttrete rttrtee rttrtee rtteret rtterte rtteert
rtteetr rtteter rttetre rtttree rtttree rtttere rttteer rttteer rtttere rtrteet rtrtete
rtrteet rtrtete rtrttee rtrttee rtretet rtrette rtreett rtreett rtretet rtrette rtreett
rtreett rtretet rtrette rtrette rtretet rtrteet rtrtete rtrteet rtrtete rtrttee rtrttee
rtetret rtetrte rtetert rtetetr rtetter rtettre rtertet rtertte rterett rterett rtertet
rtertte rteertt rteertt rteetrt rteettr rteettr rteetrt rtetret rtetrte rtetert rtetetr
rtetter rtettre rtttree rtttree rtttere rttteer rttteer rtttere rttrtee rttrtee rttrete
rttreet rttreet rttrete rtterte rtteret rttetre rtteter rtteetr rtteert rtteret rtterte
rtteert rtteetr rtteter rttetre reettrt reetttr reetrtt reetrtt reettrt reetttr reettrt
reetttr reetrtt reetrtt reettrt reetttr reerttt reerttt reerttt reerttt reerttt reerttt
reettrt reetttr reetrtt reetrtt reettrt reetttr retetrt retettr retertt retertt retetrt
retettr rettert rettetr rettret rettrte retttre rettter retrtet retrtte retrett retrett
retrtet retrtte retttre rettter rettrte rettret rettert rettetr rettert rettetr rettret
rettrte retttre rettter retetrt retettr retertt retertt retetrt retettr retrett retrett
retrtet retrtte retrtte retrtet rettert rettetr rettret rettrte retttre rettter rerttet
rerttte rertett rertett rerttet rerttte rerttet rerttte rertett rertett rerttet rerttte
rerettt rerettt rerettt rerettt rerettt rerettt rerttet rerttte rertett rertett rerttet
rerttte retttre rettter rettrte rettret rettert rettetr retttre rettter rettrte rettret
rettert rettetr retrtte retrtet retrtte retrtet retrett retrett retetrt retettr retertt
retertt retetrt retettr rtetter rtettre rtetetr rtetert rtetret rtetrte rtetter rtettre
rtetetr rtetert rtetret rtetrte rteettr rteetrt rteettr rteetrt rteertt rteertt rtertet
rtertte rterett rterett rtertet rtertte rtteter rttetre rtteetr rtteert rtteret rtterte
rttteer rtttere rttteer rtttere rtttree rtttree rtteter rttetre rtteetr rtteert rtteret
rtterte rttrtee rttrtee rttrete rttreet rttreet rttrete rttteer rtttere rttteer rtttere
rtttree rtttree rtteter rttetre rtteetr rtteert rtteret rtterte rtteetr rtteert rtteter
rttetre rtterte rtteret rttreet rttrete rttreet rttrete rttrtee rttrtee rtetter rtettre
rtetetr rtetert rtetret rtetrte rtetter rtettre rtetetr rtetert rtetret rtetrte rteettr
rteetrt rteettr rteetrt rteertt rteertt rtertet rtertte rterett rterett rtertet rtertte
rtrttee rtrttee rtrtete rtrteet rtrteet rtrtete rtrttee rtrttee rtrtete rtrteet rtrteet
rtrtete rtrette rtretet rtrette rtretet rtreett rtreett rtretet rtrette rtreett rtreett
rtretet rtrette

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us