easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

investigatorial

odontosyllis

beatinest

conicatisque

bianchi

tradat

defunctness

apotheoses

mauled

hysterocrystalline

banishments

aorangi

subglenoid

maculabant

mostlings

tesatoh

duphly

undergrowth


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: tremie
cipher variations:
usfnjf vtgokg wuhplh xviqmi ywjrnj
zxksok ayltpl bzmuqm canvrn dbowso
ecpxtp fdqyuq gerzvr hfsaws igtbxt
jhucyu kivdzv ljweaw mkxfbx nlygcy
omzhdz pnaiea qobjfb rpckgc sqdlhd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: tremie
Cipher: givnrv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: tremie
Cipher: BAABA BAAAA AABAA ABABB ABAAA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: tremie
cipher variations:
usfnjfganlznsivjpveqdhfdqylfvlcgtdltawjzrjmerxhr
ymzvxzkuhtnhwcprdpikxptxvtgokghbomaotjwkqwfreige
rzmgwmdhuemubxkasknfsyisznawyalviuoixdqseqjlyquy
wuhplhicpnbpukxlrxgsfjhfsanhxneivfnvcylbtlogtzjt
aobxzbmwjvpjyertfrkmzrvzxviqmijdqocqvlymsyhtgkig
tboiyofjwgowdzmcumphuakubpcyacnxkwqkzfsugslnaswa
ywjrnjkerpdrwmzntziuhljhucpjzpgkxhpxeandvnqivblv
cqdzbdoylxrlagtvhtmobtxbzxksoklfsqesxnaouajvimki
vdqkaqhlyiqyfboeworjwcmwdreacepzmysmbhuwiunpcuyc
ayltplmgtrftyobpvbkwjnljwerlbrimzjrzgcpfxpskxdnx
esfbdfqanztncivxjvoqdvzdbzmuqmnhusguzpcqwclxkomk
xfsmcsjnaksahdqgyqtlyeoyftgcegrboauodjwykwprewae
canvrnoivthvaqdrxdmylpnlygtndtkobltbierhzrumzfpz
guhdfhscpbvpekxzlxqsfxbfdbowsopjwuiwbresyenzmqom
zhuoeulpcmucjfsiasvnagqahviegitdqcwqflyamyrtgycg
ecpxtpqkxvjxcsftzfoanrpnaivpfvmqdnvdkgtjbtwobhrb
iwjfhjuerdxrgmzbnzsuhzdhfdqyuqrlywkydtguagpbosqo
bjwqgwnreowelhukcuxpciscjxkgikvfseyshnacoatviaei
gerzvrsmzxlzeuhvbhqcptrpckxrhxosfpxfmivldvyqdjtd
kylhjlwgtfztiobdpbuwjbfjhfsawstnaymafviwcirdqusq
dlysiyptgqygnjwmewzrekuelzmikmxhugaujpceqcvxkcgk
igtbxtuobznbgwjxdjservtremztjzquhrzhokxnfxasflvf
manjlnyivhbvkqdfrdwyldhljhucyuvpcaochxkyektfswus
fnaukarvisaiplyogybtgmwgnbokmozjwicwlregsexzmeim
kivdzvwqdbpdiylzflugtxvtgobvlbswjtbjqmzphzcuhnxh
ocplnpakxjdxmsfhtfyanfjnljweawxrecqejzmagmvhuywu
hpcwmctxkuckrnaqiadvioyipdqmoqblykeyntgiugzbogko
mkxfbxysfdrfkanbhnwivzxviqdxnduylvdlsobrjbewjpzj
qernprcmzlfzouhjvhacphlpnlygcyztgesglbocioxjwayw
jreyoevzmwemtpcskcfxkqakrfsoqsdnamgapvikwibdqimq
omzhdzauhfthmcpdjpykxbzxksfzpfwanxfnuqdtldgylrbl
sgtprteobnhbqwjlxjcerjnrpnaieabviguindqekqzlycay
ltgaqgxboygovreumehzmscmthuqsufpcoicrxkmykdfskos
qobjfbcwjhvjoerflramzdbzmuhbrhycpzhpwsfvnfiantdn
uivrtvgqdpjdsylnzlegtlptrpckgcdxkiwkpfsgmsbnaeca
nvicsizdqaiqxtgwogjboueovjwsuwhreqketzmoamfhumqu
sqdlhdeyljxlqgthntcobfdbowjdtjaerbjryuhxphkcpvfp
wkxtvxisfrlfuanpbngivnrvtremiefzmkymrhuioudpcgec
pxkeukbfsckszviyqildqwgqxlyuwyjtgsmgvboqcohjwosw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: tremie
Cipher: gerzvr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: tremie
Cipher: 442451234251

Extended Methods:
Method #1

Plaintext: tremie
method variations:
ywkrokdbpwtpigubyuomzgdz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
t r e m i e 
4 2 5 2 4 5 
4 4 1 3 2 1 
They are then read out in rows:
425245441321
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: tremie
Cipher: ikytlb

Read more ...
Method #3

Plaintext: tremie
method variations:
iyfswq yfswqi fswqiy
swqiyf wqiyfs qiyfsw

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: tremie

all 720 cipher variations:
tremie tremei treime treiem treeim treemi trmeie trmeei trmiee trmiee trmeie
trmeei trimee trimee trieme trieem trieem trieme tremie tremei treime treiem
treeim treemi termie termei terime teriem tereim teremi temrie temrei temire
temier temeir temeri teimre teimer teirme teirem teierm teiemr teemir teemri
teeimr teeirm teerim teermi tmerie tmerei tmeire tmeier tmeeir tmeeri tmreie
tmreei tmriee tmriee tmreie tmreei tmiree tmiree tmiere tmieer tmieer tmiere
tmerie tmerei tmeire tmeier tmeeir tmeeri tiemre tiemer tierme tierem tieerm
tieemr timere timeer timree timree timere timeer tirmee tirmee tireme tireem
tireem tireme tiemre tiemer tierme tierem tieerm tieemr teemir teemri teeimr
teeirm teerim teermi temeir temeri temier temire temrie temrei teimer teimre
teiemr teierm teirem teirme termie termei terime teriem tereim teremi rtemie
rtemei rteime rteiem rteeim rteemi rtmeie rtmeei rtmiee rtmiee rtmeie rtmeei
rtimee rtimee rtieme rtieem rtieem rtieme rtemie rtemei rteime rteiem rteeim
rteemi retmie retmei retime retiem reteim retemi remtie remtei remite remiet
remeit remeti reimte reimet reitme reitem reietm reiemt reemit reemti reeimt
reeitm reetim reetmi rmetie rmetei rmeite rmeiet rmeeit rmeeti rmteie rmteei
rmtiee rmtiee rmteie rmteei rmitee rmitee rmiete rmieet rmieet rmiete rmetie
rmetei rmeite rmeiet rmeeit rmeeti riemte riemet rietme rietem rieetm rieemt
rimete rimeet rimtee rimtee rimete rimeet ritmee ritmee riteme riteem riteem
riteme riemte riemet rietme rietem rieetm rieemt reemit reemti reeimt reeitm
reetim reetmi remeit remeti remiet remite remtie remtei reimet reimte reiemt
reietm reitem reitme retmie retmei retime retiem reteim retemi ertmie ertmei
ertime ertiem erteim ertemi ermtie ermtei ermite ermiet ermeit ermeti erimte
erimet eritme eritem erietm eriemt eremit eremti ereimt ereitm eretim eretmi
etrmie etrmei etrime etriem etreim etremi etmrie etmrei etmire etmier etmeir
etmeri etimre etimer etirme etirem etierm etiemr etemir etemri eteimr eteirm
eterim etermi emtrie emtrei emtire emtier emteir emteri emrtie emrtei emrite
emriet emreit emreti emirte emiret emitre emiter emietr emiert emerit emerti
emeirt emeitr emetir emetri eitmre eitmer eitrme eitrem eiterm eitemr eimtre
eimter eimrte eimret eimert eimetr eirmte eirmet eirtme eirtem eiretm eiremt
eiemrt eiemtr eiermt eiertm eietrm eietmr eetmir eetmri eetimr eetirm eetrim
eetrmi eemtir eemtri eemitr eemirt eemrit eemrti eeimtr eeimrt eeitmr eeitrm
eeirtm eeirmt eermit eermti eerimt eeritm eertim eertmi mretie mretei mreite
mreiet mreeit mreeti mrteie mrteei mrtiee mrtiee mrteie mrteei mritee mritee
mriete mrieet mrieet mriete mretie mretei mreite mreiet mreeit mreeti mertie
mertei merite meriet mereit mereti metrie metrei metire metier meteir meteri
meitre meiter meirte meiret meiert meietr meetir meetri meeitr meeirt meerit
meerti mterie mterei mteire mteier mteeir mteeri mtreie mtreei mtriee mtriee
mtreie mtreei mtiree mtiree mtiere mtieer mtieer mtiere mterie mterei mteire
mteier mteeir mteeri mietre mieter mierte mieret mieert mieetr mitere miteer
mitree mitree mitere miteer mirtee mirtee mirete mireet mireet mirete mietre
mieter mierte mieret mieert mieetr meetir meetri meeitr meeirt meerit meerti
meteir meteri metier metire metrie metrei meiter meitre meietr meiert meiret
meirte mertie mertei merite meriet mereit mereti iremte iremet iretme iretem
ireetm ireemt irmete irmeet irmtee irmtee irmete irmeet irtmee irtmee irteme
irteem irteem irteme iremte iremet iretme iretem ireetm ireemt iermte iermet
iertme iertem ieretm ieremt iemrte iemret iemtre iemter iemetr iemert ietmre
ietmer ietrme ietrem ieterm ietemr ieemtr ieemrt ieetmr ieetrm ieertm ieermt
imerte imeret imetre imeter imeetr imeert imrete imreet imrtee imrtee imrete
imreet imtree imtree imtere imteer imteer imtere imerte imeret imetre imeter
imeetr imeert itemre itemer iterme iterem iteerm iteemr itmere itmeer itmree
itmree itmere itmeer itrmee itrmee itreme itreem itreem itreme itemre itemer
iterme iterem iteerm iteemr ieemtr ieemrt ieetmr ieetrm ieertm ieermt iemetr
iemert iemter iemtre iemrte iemret ietmer ietmre ietemr ieterm ietrem ietrme
iermte iermet iertme iertem ieretm ieremt eremit eremti ereimt ereitm eretim
eretmi ermeit ermeti ermiet ermite ermtie ermtei erimet erimte eriemt erietm
eritem eritme ertmie ertmei ertime ertiem erteim ertemi eermit eermti eerimt
eeritm eertim eertmi eemrit eemrti eemirt eemitr eemtir eemtri eeimrt eeimtr
eeirmt eeirtm eeitrm eeitmr eetmir eetmri eetimr eetirm eetrim eetrmi emerit
emerti emeirt emeitr emetir emetri emreit emreti emriet emrite emrtie emrtei
emiret emirte emiert emietr emiter emitre emtrie emtrei emtire emtier emteir
emteri eiemrt eiemtr eiermt eiertm eietrm eietmr eimert eimetr eimret eimrte
eimtre eimter eirmet eirmte eiremt eiretm eirtem eirtme eitmre eitmer eitrme
eitrem eiterm eitemr etemir etemri eteimr eteirm eterim etermi etmeir etmeri
etmier etmire etmrie etmrei etimer etimre etiemr etierm etirem etirme etrmie
etrmei etrime etriem etreim etremi

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us