easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

bertolt

tendential

attulimusque

jointured

pennipes

blastemal

agiebatisque

clinteastwood

stikland

sanenesses

garnisheing

clamitantesque

saccarimeter

simplicial

techserv

indecisivenesses

prophetesses

jaroff


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: trabesque
cipher variations:
usbcftrvf vtcdguswg wudehvtxh xvefiwuyi ywfgjxvzj
zxghkywak ayhilzxbl bzijmaycm cajknbzdn dbklocaeo
eclmpdbfp fdmnqecgq genorfdhr hfopsgeis igpqthfjt
jhqruigku kirsvjhlv ljstwkimw mktuxljnx nluvymkoy
omvwznlpz pnwxaomqa qoxybpnrb rpyzcqosc sqzadrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: trabesque
Cipher: gizyvhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: trabesque
Cipher: BAABA BAAAA AAAAA AAAAB AABAA BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: trabesque
cipher variations:
usbcftrvfgabendxjnsibgvndxveqbidxjldqybklhpzlcgbmtrvntawbqjlhpjmebsrvndr
ymbuzftrzkubwhpzfhwcbypzftpikbaxjlhxvtcdguswghbcfoeykotjchwoeywfrcjeykme
rzclmiqamdhcnuswoubxcrkmiqknfctswoeszncvagusalvcxiqagixdczqaguqjlcbykmiy
wudehvtxhicdgpfzlpukdixpfzxgsdkfzlnfsadmnjrbneidovtxpvcydslnjrlogdutxpft
aodwbhvtbmwdyjrbhjyedarbhvrkmdczlnjzxvefiwuyijdehqgamqvlejyqgayhtelgamog
tbenokscofjepwuyqwdzetmoksmphevuyqgubpexciwucnxezkscikzfebsciwslnedamoka
ywfgjxvzjkefirhbnrwmfkzrhbziufmhbnphucfopltdpgkfqxvzrxeafunpltnqifwvzrhv
cqfydjxvdoyfaltdjlagfctdjxtmofebnplbzxghkywaklfgjsicosxnglasicajvgnicoqi
vdgpqmueqhlgrywasyfbgvoqmuorjgxwasiwdrgzekywepzgbmuekmbhgduekyunpgfcoqmc
ayhilzxblmghktjdptyohmbtjdbkwhojdprjwehqrnvfrimhszxbtzgchwprnvpskhyxbtjx
eshaflzxfqahcnvflncihevflzvoqhgdprndbzijmaycmnhilukequzpincukeclxipkeqsk
xfirsowgsjnitaycuahdixqsowqtlizycukyftibgmaygrbidowgmodjifwgmawpriheqsoe
cajknbzdnoijmvlfrvaqjodvlfdmyjqlfrtlygjstpxhtkojubzdvbiejyrtpxrumjazdvlz
gujchnbzhscjepxhnpekjgxhnbxqsjifrtpfdbklocaeopjknwmgswbrkpewmgenzkrmgsum
zhktuqyiulpkvcaewcjfkzsuqysvnkbaewmahvkdiocaitdkfqyioqflkhyiocyrtkjgsuqg
eclmpdbfpqkloxnhtxcslqfxnhfoalsnhtvnailuvrzjvmqlwdbfxdkglatvrztwolcbfxnb
iwlejpdbjuelgrzjprgmlizjpdzsulkhtvrhfdmnqecgqrlmpyoiuydtmrgyoigpbmtoiuwo
bjmvwsakwnrmxecgyelhmbuwsauxpmdcgyocjxmfkqeckvfmhsakqshnmjakqeatvmliuwsi
genorfdhrsmnqzpjvzeunshzpjhqcnupjvxpcknwxtblxosnyfdhzfmincvxtbvyqnedhzpd
kynglrfdlwgnitblrtionkblrfbuwnmjvxtjhfopsgeistnoraqkwafvotiaqkirdovqkwyq
dloxyucmyptozgeiagnjodwyucwzrofeiaqelzohmsgemxhojucmsujpolcmsgcvxonkwyuk
igpqthfjtuopsbrlxbgwpujbrljsepwrlxzrempyzvdnzqupahfjbhokpexzvdxaspgfjbrf
mapinthfnyipkvdntvkqpmdnthdwypolxzvljhqruigkuvpqtcsmychxqvkcsmktfqxsmyas
fnqzaweoarvqbigkciplqfyaweybtqhgkcsgnbqjouigozjqlweouwlrqneouiexzqpmyawm
kirsvjhlvwqrudtnzdiyrwldtnlugrytnzbtgorabxfpbswrcjhldjqmrgzbxfzcurihldth
ocrkpvjhpakrmxfpvxmsrofpvjfyarqnzbxnljstwkimwxrsveuoaejzsxmeuomvhszuoacu
hpsbcygqctxsdkimekrnshacygadvsjimeuipdslqwkiqblsnygqwyntspgqwkgzbsroacyo
mktuxljnxystwfvpbfkatynfvpnwitavpbdviqtcdzhrduyteljnflsotibdzhbewtkjnfvj
qetmrxljrcmtozhrxzoutqhrxlhactspbdzpnluvymkoyztuxgwqcglbuzogwqoxjubwqcew
jrudeaisevzufmkogmtpujceaicfxulkogwkrfunsymksdnupaisyapvurisymibdutqceaq
omvwznlpzauvyhxrdhmcvaphxrpykvcxrdfxksvefbjtfwavgnlphnuqvkdfbjdgyvmlphxl
sgvotznlteovqbjtzbqwvsjtznjcevurdfbrpnwxaomqabvwziyseindwbqiysqzlwdysegy
ltwfgckugxbwhomqiovrwlegckehzwnmqiymthwpuaomufpwrckuacrxwtkuaokdfwvsegcs
qoxybpnrbcwxajztfjoexcrjztramxeztfhzmuxghdlvhycxipnrjpwsxmfhdlfiaxonrjzn
uixqvbpnvgqxsdlvbdsyxulvbplegxwtfhdtrpyzcqoscdxybkaugkpfydskausbnyfaugia
nvyhiemwizdyjqoskqxtyngiemgjbyposkaovjyrwcqowhrytemwcetzyvmwcqmfhyxugieu
sqzadrptdeyzclbvhlqgzetlbvtcozgbvhjbowzijfnxjaezkrptlryuzohjfnhkczqptlbp
wkzsxdrpxiszufnxdfuazwnxdrngizyvhjfvtrabesquefzadmcwimrhafumcwudpahcwikc
pxajkgoykbfalsqumszvapikgoildarqumcqxlatyesqyjtavgoyegvbaxoyesohjazwikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: trabesque
Cipher: genorfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: trabesque
Cipher: 442411215134145451

Extended Methods:
Method #1

Plaintext: trabesque
method variations:
ywfgkxvzkdblmpcaepigqruhfkuomvwznlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
t r a b e s q u e 
4 2 1 2 5 3 1 5 5 
4 4 1 1 1 4 4 4 1 
They are then read out in rows:
421253155441114441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: trabesque
Cipher: ifpvudatd

Read more ...
Method #3

Plaintext: trabesque
method variations:
idfvldyyq dfvldyyqi fvldyyqid
vldyyqidf ldyyqidfv dyyqidfvl
yyqidfvld yqidfvldy qidfvldyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: trabesque

first 5040 cipher variations(362880 total)
trabesque trabesqeu trabesuqe trabesueq trabeseuq trabesequ trabeqsue trabeqseu trabequse trabeques trabeqeus
trabeqesu trabeuqse trabeuqes trabeusqe trabeuseq trabeuesq trabeueqs trabeequs trabeeqsu trabeeuqs trabeeusq
trabeesuq trabeesqu trabseque trabseqeu trabseuqe trabseueq trabseeuq trabseequ trabsqeue trabsqeeu trabsquee
trabsquee trabsqeue trabsqeeu trabsuqee trabsuqee trabsueqe trabsueeq trabsueeq trabsueqe trabseque trabseqeu
trabseuqe trabseueq trabseeuq trabseequ trabqseue trabqseeu trabqsuee trabqsuee trabqseue trabqseeu trabqesue
trabqeseu trabqeuse trabqeues trabqeeus trabqeesu trabquese trabquees trabqusee trabqusee trabquese trabquees
trabqeeus trabqeesu trabqeues trabqeuse trabqesue trabqeseu trabusqee trabusqee trabuseqe trabuseeq trabuseeq
trabuseqe trabuqsee trabuqsee trabuqese trabuqees trabuqees trabuqese trabueqse trabueqes trabuesqe trabueseq
trabueesq trabueeqs trabueqes trabueqse trabueeqs trabueesq trabueseq trabuesqe trabesque trabesqeu trabesuqe
trabesueq trabeseuq trabesequ trabeqsue trabeqseu trabequse trabeques trabeqeus trabeqesu trabeuqse trabeuqes
trabeusqe trabeuseq trabeuesq trabeueqs trabeequs trabeeqsu trabeeuqs trabeeusq trabeesuq trabeesqu traebsque
traebsqeu traebsuqe traebsueq traebseuq traebsequ traebqsue traebqseu traebquse traebques traebqeus traebqesu
traebuqse traebuqes traebusqe traebuseq traebuesq traebueqs traebequs traebeqsu traebeuqs traebeusq traebesuq
traebesqu traesbque traesbqeu traesbuqe traesbueq traesbeuq traesbequ traesqbue traesqbeu traesqube traesqueb
traesqeub traesqebu traesuqbe traesuqeb traesubqe traesubeq traesuebq traesueqb traesequb traeseqbu traeseuqb
traeseubq traesebuq traesebqu traeqsbue traeqsbeu traeqsube traeqsueb traeqseub traeqsebu traeqbsue traeqbseu
traeqbuse traeqbues traeqbeus traeqbesu traequbse traequbes traequsbe traequseb traequesb traequebs traeqebus
traeqebsu traeqeubs traeqeusb traeqesub traeqesbu traeusqbe traeusqeb traeusbqe traeusbeq traeusebq traeuseqb
traeuqsbe traeuqseb traeuqbse traeuqbes traeuqebs traeuqesb traeubqse traeubqes traeubsqe traeubseq traeubesq
traeubeqs traeueqbs traeueqsb traeuebqs traeuebsq traeuesbq traeuesqb traeesqub traeesqbu traeesuqb traeesubq
traeesbuq traeesbqu traeeqsub traeeqsbu traeequsb traeequbs traeeqbus traeeqbsu traeeuqsb traeeuqbs traeeusqb
traeeusbq traeeubsq traeeubqs traeebqus traeebqsu traeebuqs traeebusq traeebsuq traeebsqu trasebque trasebqeu
trasebuqe trasebueq trasebeuq trasebequ traseqbue traseqbeu traseqube trasequeb traseqeub traseqebu traseuqbe
traseuqeb traseubqe traseubeq traseuebq traseueqb traseequb traseeqbu traseeuqb traseeubq traseebuq traseebqu
trasbeque trasbeqeu trasbeuqe trasbeueq trasbeeuq trasbeequ trasbqeue trasbqeeu trasbquee trasbquee trasbqeue
trasbqeeu trasbuqee trasbuqee trasbueqe trasbueeq trasbueeq trasbueqe trasbeque trasbeqeu trasbeuqe trasbeueq
trasbeeuq trasbeequ trasqbeue trasqbeeu trasqbuee trasqbuee trasqbeue trasqbeeu trasqebue trasqebeu trasqeube
trasqeueb trasqeeub trasqeebu trasquebe trasqueeb trasqubee trasqubee trasquebe trasqueeb trasqeeub trasqeebu
trasqeueb trasqeube trasqebue trasqebeu trasubqee trasubqee trasubeqe trasubeeq trasubeeq trasubeqe trasuqbee
trasuqbee trasuqebe trasuqeeb trasuqeeb trasuqebe trasueqbe trasueqeb trasuebqe trasuebeq trasueebq trasueeqb
trasueqeb trasueqbe trasueeqb trasueebq trasuebeq trasuebqe trasebque trasebqeu trasebuqe trasebueq trasebeuq
trasebequ traseqbue traseqbeu traseqube trasequeb traseqeub traseqebu traseuqbe traseuqeb traseubqe traseubeq
traseuebq traseueqb traseequb traseeqbu traseeuqb traseeubq traseebuq traseebqu traqesbue traqesbeu traqesube
traqesueb traqeseub traqesebu traqebsue traqebseu traqebuse traqebues traqebeus traqebesu traqeubse traqeubes
traqeusbe traqeuseb traqeuesb traqeuebs traqeebus traqeebsu traqeeubs traqeeusb traqeesub traqeesbu traqsebue
traqsebeu traqseube traqseueb traqseeub traqseebu traqsbeue traqsbeeu traqsbuee traqsbuee traqsbeue traqsbeeu
traqsubee traqsubee traqsuebe traqsueeb traqsueeb traqsuebe traqsebue traqsebeu traqseube traqseueb traqseeub
traqseebu traqbseue traqbseeu traqbsuee traqbsuee traqbseue traqbseeu traqbesue traqbeseu traqbeuse traqbeues
traqbeeus traqbeesu traqbuese traqbuees traqbusee traqbusee traqbuese traqbuees traqbeeus traqbeesu traqbeues
traqbeuse traqbesue traqbeseu traqusbee traqusbee traqusebe traquseeb traquseeb traqusebe traqubsee traqubsee
traqubese traqubees traqubees traqubese traquebse traquebes traquesbe traqueseb traqueesb traqueebs traquebes
traquebse traqueebs traqueesb traqueseb traquesbe traqesbue traqesbeu traqesube traqesueb traqeseub traqesebu
traqebsue traqebseu traqebuse traqebues traqebeus traqebesu traqeubse traqeubes traqeusbe traqeuseb traqeuesb
traqeuebs traqeebus traqeebsu traqeeubs traqeeusb traqeesub traqeesbu trauesqbe trauesqeb trauesbqe trauesbeq
trauesebq traueseqb traueqsbe traueqseb traueqbse traueqbes traueqebs traueqesb trauebqse trauebqes trauebsqe
trauebseq trauebesq trauebeqs traueeqbs traueeqsb traueebqs traueebsq traueesbq traueesqb trauseqbe trauseqeb
trausebqe trausebeq trauseebq trauseeqb trausqebe trausqeeb trausqbee trausqbee trausqebe trausqeeb trausbqee
trausbqee trausbeqe trausbeeq trausbeeq trausbeqe trauseqbe trauseqeb trausebqe trausebeq trauseebq trauseeqb
trauqsebe trauqseeb trauqsbee trauqsbee trauqsebe trauqseeb trauqesbe trauqeseb trauqebse trauqebes trauqeebs
trauqeesb trauqbese trauqbees trauqbsee trauqbsee trauqbese trauqbees trauqeebs trauqeesb trauqebes trauqebse
trauqesbe trauqeseb traubsqee traubsqee traubseqe traubseeq traubseeq traubseqe traubqsee traubqsee traubqese
traubqees traubqees traubqese traubeqse traubeqes traubesqe traubeseq traubeesq traubeeqs traubeqes traubeqse
traubeeqs traubeesq traubeseq traubesqe trauesqbe trauesqeb trauesbqe trauesbeq trauesebq traueseqb traueqsbe
traueqseb traueqbse traueqbes traueqebs traueqesb trauebqse trauebqes trauebsqe trauebseq trauebesq trauebeqs
traueeqbs traueeqsb traueebqs traueebsq traueesbq traueesqb traeesqub traeesqbu traeesuqb traeesubq traeesbuq
traeesbqu traeeqsub traeeqsbu traeequsb traeequbs traeeqbus traeeqbsu traeeuqsb traeeuqbs traeeusqb traeeusbq
traeeubsq traeeubqs traeebqus traeebqsu traeebuqs traeebusq traeebsuq traeebsqu traesequb traeseqbu traeseuqb
traeseubq traesebuq traesebqu traesqeub traesqebu traesqueb traesqube traesqbue traesqbeu traesuqeb traesuqbe
traesueqb traesuebq traesubeq traesubqe traesbque traesbqeu traesbuqe traesbueq traesbeuq traesbequ traeqseub
traeqsebu traeqsueb traeqsube traeqsbue traeqsbeu traeqesub traeqesbu traeqeusb traeqeubs traeqebus traeqebsu
traequesb traequebs traequseb traequsbe traequbse traequbes traeqbeus traeqbesu traeqbues traeqbuse traeqbsue
traeqbseu traeusqeb traeusqbe traeuseqb traeusebq traeusbeq traeusbqe traeuqseb traeuqsbe traeuqesb traeuqebs
traeuqbes traeuqbse traeueqsb traeueqbs traeuesqb traeuesbq traeuebsq traeuebqs traeubqes traeubqse traeubeqs
traeubesq traeubseq traeubsqe traebsque traebsqeu traebsuqe traebsueq traebseuq traebsequ traebqsue traebqseu
traebquse traebques traebqeus traebqesu traebuqse traebuqes traebusqe traebuseq traebuesq traebueqs traebequs
traebeqsu traebeuqs traebeusq traebesuq traebesqu trbaesque trbaesqeu trbaesuqe trbaesueq trbaeseuq trbaesequ
trbaeqsue trbaeqseu trbaequse trbaeques trbaeqeus trbaeqesu trbaeuqse trbaeuqes trbaeusqe trbaeuseq trbaeuesq
trbaeueqs trbaeequs trbaeeqsu trbaeeuqs trbaeeusq trbaeesuq trbaeesqu trbaseque trbaseqeu trbaseuqe trbaseueq
trbaseeuq trbaseequ trbasqeue trbasqeeu trbasquee trbasquee trbasqeue trbasqeeu trbasuqee trbasuqee trbasueqe
trbasueeq trbasueeq trbasueqe trbaseque trbaseqeu trbaseuqe trbaseueq trbaseeuq trbaseequ trbaqseue trbaqseeu
trbaqsuee trbaqsuee trbaqseue trbaqseeu trbaqesue trbaqeseu trbaqeuse trbaqeues trbaqeeus trbaqeesu trbaquese
trbaquees trbaqusee trbaqusee trbaquese trbaquees trbaqeeus trbaqeesu trbaqeues trbaqeuse trbaqesue trbaqeseu
trbausqee trbausqee trbauseqe trbauseeq trbauseeq trbauseqe trbauqsee trbauqsee trbauqese trbauqees trbauqees
trbauqese trbaueqse trbaueqes trbauesqe trbaueseq trbaueesq trbaueeqs trbaueqes trbaueqse trbaueeqs trbaueesq
trbaueseq trbauesqe trbaesque trbaesqeu trbaesuqe trbaesueq trbaeseuq trbaesequ trbaeqsue trbaeqseu trbaequse
trbaeques trbaeqeus trbaeqesu trbaeuqse trbaeuqes trbaeusqe trbaeuseq trbaeuesq trbaeueqs trbaeequs trbaeeqsu
trbaeeuqs trbaeeusq trbaeesuq trbaeesqu trbeasque trbeasqeu trbeasuqe trbeasueq trbeaseuq trbeasequ trbeaqsue
trbeaqseu trbeaquse trbeaques trbeaqeus trbeaqesu trbeauqse trbeauqes trbeausqe trbeauseq trbeauesq trbeaueqs
trbeaequs trbeaeqsu trbeaeuqs trbeaeusq trbeaesuq trbeaesqu trbesaque trbesaqeu trbesauqe trbesaueq trbesaeuq
trbesaequ trbesqaue trbesqaeu trbesquae trbesquea trbesqeua trbesqeau trbesuqae trbesuqea trbesuaqe trbesuaeq
trbesueaq trbesueqa trbesequa trbeseqau trbeseuqa trbeseuaq trbeseauq trbeseaqu trbeqsaue trbeqsaeu trbeqsuae
trbeqsuea trbeqseua trbeqseau trbeqasue trbeqaseu trbeqause trbeqaues trbeqaeus trbeqaesu trbequase trbequaes
trbequsae trbequsea trbequesa trbequeas trbeqeaus trbeqeasu trbeqeuas trbeqeusa trbeqesua trbeqesau trbeusqae
trbeusqea trbeusaqe trbeusaeq trbeuseaq trbeuseqa trbeuqsae trbeuqsea trbeuqase trbeuqaes trbeuqeas trbeuqesa
trbeuaqse trbeuaqes trbeuasqe trbeuaseq trbeuaesq trbeuaeqs trbeueqas trbeueqsa trbeueaqs trbeueasq trbeuesaq
trbeuesqa trbeesqua trbeesqau trbeesuqa trbeesuaq trbeesauq trbeesaqu trbeeqsua trbeeqsau trbeequsa trbeequas
trbeeqaus trbeeqasu trbeeuqsa trbeeuqas trbeeusqa trbeeusaq trbeeuasq trbeeuaqs trbeeaqus trbeeaqsu trbeeauqs
trbeeausq trbeeasuq trbeeasqu trbseaque trbseaqeu trbseauqe trbseaueq trbseaeuq trbseaequ trbseqaue trbseqaeu
trbsequae trbsequea trbseqeua trbseqeau trbseuqae trbseuqea trbseuaqe trbseuaeq trbseueaq trbseueqa trbseequa
trbseeqau trbseeuqa trbseeuaq trbseeauq trbseeaqu trbsaeque trbsaeqeu trbsaeuqe trbsaeueq trbsaeeuq trbsaeequ
trbsaqeue trbsaqeeu trbsaquee trbsaquee trbsaqeue trbsaqeeu trbsauqee trbsauqee trbsaueqe trbsaueeq trbsaueeq
trbsaueqe trbsaeque trbsaeqeu trbsaeuqe trbsaeueq trbsaeeuq trbsaeequ trbsqaeue trbsqaeeu trbsqauee trbsqauee
trbsqaeue trbsqaeeu trbsqeaue trbsqeaeu trbsqeuae trbsqeuea trbsqeeua trbsqeeau trbsqueae trbsqueea trbsquaee
trbsquaee trbsqueae trbsqueea trbsqeeua trbsqeeau trbsqeuea trbsqeuae trbsqeaue trbsqeaeu trbsuaqee trbsuaqee
trbsuaeqe trbsuaeeq trbsuaeeq trbsuaeqe trbsuqaee trbsuqaee trbsuqeae trbsuqeea trbsuqeea trbsuqeae trbsueqae
trbsueqea trbsueaqe trbsueaeq trbsueeaq trbsueeqa trbsueqea trbsueqae trbsueeqa trbsueeaq trbsueaeq trbsueaqe
trbseaque trbseaqeu trbseauqe trbseaueq trbseaeuq trbseaequ trbseqaue trbseqaeu trbsequae trbsequea trbseqeua
trbseqeau trbseuqae trbseuqea trbseuaqe trbseuaeq trbseueaq trbseueqa trbseequa trbseeqau trbseeuqa trbseeuaq
trbseeauq trbseeaqu trbqesaue trbqesaeu trbqesuae trbqesuea trbqeseua trbqeseau trbqeasue trbqeaseu trbqeause
trbqeaues trbqeaeus trbqeaesu trbqeuase trbqeuaes trbqeusae trbqeusea trbqeuesa trbqeueas trbqeeaus trbqeeasu
trbqeeuas trbqeeusa trbqeesua trbqeesau trbqseaue trbqseaeu trbqseuae trbqseuea trbqseeua trbqseeau trbqsaeue
trbqsaeeu trbqsauee trbqsauee trbqsaeue trbqsaeeu trbqsuaee trbqsuaee trbqsueae trbqsueea trbqsueea trbqsueae
trbqseaue trbqseaeu trbqseuae trbqseuea trbqseeua trbqseeau trbqaseue trbqaseeu trbqasuee trbqasuee trbqaseue
trbqaseeu trbqaesue trbqaeseu trbqaeuse trbqaeues trbqaeeus trbqaeesu trbqauese trbqauees trbqausee trbqausee
trbqauese trbqauees trbqaeeus trbqaeesu trbqaeues trbqaeuse trbqaesue trbqaeseu trbqusaee trbqusaee trbquseae
trbquseea trbquseea trbquseae trbquasee trbquasee trbquaese trbquaees trbquaees trbquaese trbquease trbqueaes
trbquesae trbquesea trbqueesa trbqueeas trbqueaes trbquease trbqueeas trbqueesa trbquesea trbquesae trbqesaue
trbqesaeu trbqesuae trbqesuea trbqeseua trbqeseau trbqeasue trbqeaseu trbqeause trbqeaues trbqeaeus trbqeaesu
trbqeuase trbqeuaes trbqeusae trbqeusea trbqeuesa trbqeueas trbqeeaus trbqeeasu trbqeeuas trbqeeusa trbqeesua
trbqeesau trbuesqae trbuesqea trbuesaqe trbuesaeq trbueseaq trbueseqa trbueqsae trbueqsea trbueqase trbueqaes
trbueqeas trbueqesa trbueaqse trbueaqes trbueasqe trbueaseq trbueaesq trbueaeqs trbueeqas trbueeqsa trbueeaqs
trbueeasq trbueesaq trbueesqa trbuseqae trbuseqea trbuseaqe trbuseaeq trbuseeaq trbuseeqa trbusqeae trbusqeea
trbusqaee trbusqaee trbusqeae trbusqeea trbusaqee trbusaqee trbusaeqe trbusaeeq trbusaeeq trbusaeqe trbuseqae
trbuseqea trbuseaqe trbuseaeq trbuseeaq trbuseeqa trbuqseae trbuqseea trbuqsaee trbuqsaee trbuqseae trbuqseea
trbuqesae trbuqesea trbuqease trbuqeaes trbuqeeas trbuqeesa trbuqaese trbuqaees trbuqasee trbuqasee trbuqaese
trbuqaees trbuqeeas trbuqeesa trbuqeaes trbuqease trbuqesae trbuqesea trbuasqee trbuasqee trbuaseqe trbuaseeq
trbuaseeq trbuaseqe trbuaqsee trbuaqsee trbuaqese trbuaqees trbuaqees trbuaqese trbuaeqse trbuaeqes trbuaesqe
trbuaeseq trbuaeesq trbuaeeqs trbuaeqes trbuaeqse trbuaeeqs trbuaeesq trbuaeseq trbuaesqe trbuesqae trbuesqea
trbuesaqe trbuesaeq trbueseaq trbueseqa trbueqsae trbueqsea trbueqase trbueqaes trbueqeas trbueqesa trbueaqse
trbueaqes trbueasqe trbueaseq trbueaesq trbueaeqs trbueeqas trbueeqsa trbueeaqs trbueeasq trbueesaq trbueesqa
trbeesqua trbeesqau trbeesuqa trbeesuaq trbeesauq trbeesaqu trbeeqsua trbeeqsau trbeequsa trbeequas trbeeqaus
trbeeqasu trbeeuqsa trbeeuqas trbeeusqa trbeeusaq trbeeuasq trbeeuaqs trbeeaqus trbeeaqsu trbeeauqs trbeeausq
trbeeasuq trbeeasqu trbesequa trbeseqau trbeseuqa trbeseuaq trbeseauq trbeseaqu trbesqeua trbesqeau trbesquea
trbesquae trbesqaue trbesqaeu trbesuqea trbesuqae trbesueqa trbesueaq trbesuaeq trbesuaqe trbesaque trbesaqeu
trbesauqe trbesaueq trbesaeuq trbesaequ trbeqseua trbeqseau trbeqsuea trbeqsuae trbeqsaue trbeqsaeu trbeqesua
trbeqesau trbeqeusa trbeqeuas trbeqeaus trbeqeasu trbequesa trbequeas trbequsea trbequsae trbequase trbequaes
trbeqaeus trbeqaesu trbeqaues trbeqause trbeqasue trbeqaseu trbeusqea trbeusqae trbeuseqa trbeuseaq trbeusaeq
trbeusaqe trbeuqsea trbeuqsae trbeuqesa trbeuqeas trbeuqaes trbeuqase trbeueqsa trbeueqas trbeuesqa trbeuesaq
trbeueasq trbeueaqs trbeuaqes trbeuaqse trbeuaeqs trbeuaesq trbeuaseq trbeuasqe trbeasque trbeasqeu trbeasuqe
trbeasueq trbeaseuq trbeasequ trbeaqsue trbeaqseu trbeaquse trbeaques trbeaqeus trbeaqesu trbeauqse trbeauqes
trbeausqe trbeauseq trbeauesq trbeaueqs trbeaequs trbeaeqsu trbeaeuqs trbeaeusq trbeaesuq trbeaesqu trebasque
trebasqeu trebasuqe trebasueq trebaseuq trebasequ trebaqsue trebaqseu trebaquse trebaques trebaqeus trebaqesu
trebauqse trebauqes trebausqe trebauseq trebauesq trebaueqs trebaequs trebaeqsu trebaeuqs trebaeusq trebaesuq
trebaesqu trebsaque trebsaqeu trebsauqe trebsaueq trebsaeuq trebsaequ trebsqaue trebsqaeu trebsquae trebsquea
trebsqeua trebsqeau trebsuqae trebsuqea trebsuaqe trebsuaeq trebsueaq trebsueqa trebsequa trebseqau trebseuqa
trebseuaq trebseauq trebseaqu trebqsaue trebqsaeu trebqsuae trebqsuea trebqseua trebqseau trebqasue trebqaseu
trebqause trebqaues trebqaeus trebqaesu trebquase trebquaes trebqusae trebqusea trebquesa trebqueas trebqeaus
trebqeasu trebqeuas trebqeusa trebqesua trebqesau trebusqae trebusqea trebusaqe trebusaeq trebuseaq trebuseqa
trebuqsae trebuqsea trebuqase trebuqaes trebuqeas trebuqesa trebuaqse trebuaqes trebuasqe trebuaseq trebuaesq
trebuaeqs trebueqas trebueqsa trebueaqs trebueasq trebuesaq trebuesqa trebesqua trebesqau trebesuqa trebesuaq
trebesauq trebesaqu trebeqsua trebeqsau trebequsa trebequas trebeqaus trebeqasu trebeuqsa trebeuqas trebeusqa
trebeusaq trebeuasq trebeuaqs trebeaqus trebeaqsu trebeauqs trebeausq trebeasuq trebeasqu treabsque treabsqeu
treabsuqe treabsueq treabseuq treabsequ treabqsue treabqseu treabquse treabques treabqeus treabqesu treabuqse
treabuqes treabusqe treabuseq treabuesq treabueqs treabequs treabeqsu treabeuqs treabeusq treabesuq treabesqu
treasbque treasbqeu treasbuqe treasbueq treasbeuq treasbequ treasqbue treasqbeu treasqube treasqueb treasqeub
treasqebu treasuqbe treasuqeb treasubqe treasubeq treasuebq treasueqb treasequb treaseqbu treaseuqb treaseubq
treasebuq treasebqu treaqsbue treaqsbeu treaqsube treaqsueb treaqseub treaqsebu treaqbsue treaqbseu treaqbuse
treaqbues treaqbeus treaqbesu treaqubse treaqubes treaqusbe treaquseb treaquesb treaquebs treaqebus treaqebsu
treaqeubs treaqeusb treaqesub treaqesbu treausqbe treausqeb treausbqe treausbeq treausebq treauseqb treauqsbe
treauqseb treauqbse treauqbes treauqebs treauqesb treaubqse treaubqes treaubsqe treaubseq treaubesq treaubeqs
treaueqbs treaueqsb treauebqs treauebsq treauesbq treauesqb treaesqub treaesqbu treaesuqb treaesubq treaesbuq
treaesbqu treaeqsub treaeqsbu treaequsb treaequbs treaeqbus treaeqbsu treaeuqsb treaeuqbs treaeusqb treaeusbq
treaeubsq treaeubqs treaebqus treaebqsu treaebuqs treaebusq treaebsuq treaebsqu tresabque tresabqeu tresabuqe
tresabueq tresabeuq tresabequ tresaqbue tresaqbeu tresaqube tresaqueb tresaqeub tresaqebu tresauqbe tresauqeb
tresaubqe tresaubeq tresauebq tresaueqb tresaequb tresaeqbu tresaeuqb tresaeubq tresaebuq tresaebqu tresbaque
tresbaqeu tresbauqe tresbaueq tresbaeuq tresbaequ tresbqaue tresbqaeu tresbquae tresbquea tresbqeua tresbqeau
tresbuqae tresbuqea tresbuaqe tresbuaeq tresbueaq tresbueqa tresbequa tresbeqau tresbeuqa tresbeuaq tresbeauq
tresbeaqu tresqbaue tresqbaeu tresqbuae tresqbuea tresqbeua tresqbeau tresqabue tresqabeu tresqaube tresqaueb
tresqaeub tresqaebu tresquabe tresquaeb tresqubae tresqubea tresqueba tresqueab tresqeaub tresqeabu tresqeuab
tresqeuba tresqebua tresqebau tresubqae tresubqea tresubaqe tresubaeq tresubeaq tresubeqa tresuqbae tresuqbea
tresuqabe tresuqaeb tresuqeab tresuqeba tresuaqbe tresuaqeb tresuabqe tresuabeq tresuaebq tresuaeqb tresueqab
tresueqba tresueaqb tresueabq tresuebaq tresuebqa tresebqua tresebqau tresebuqa tresebuaq tresebauq tresebaqu
treseqbua treseqbau tresequba tresequab treseqaub treseqabu treseuqba treseuqab treseubqa treseubaq treseuabq
treseuaqb treseaqub treseaqbu treseauqb treseaubq treseabuq treseabqu treqasbue treqasbeu treqasube treqasueb
treqaseub treqasebu treqabsue treqabseu treqabuse treqabues treqabeus treqabesu treqaubse treqaubes treqausbe
treqauseb treqauesb treqauebs treqaebus treqaebsu treqaeubs treqaeusb treqaesub treqaesbu treqsabue treqsabeu
treqsaube treqsaueb treqsaeub treqsaebu treqsbaue treqsbaeu treqsbuae treqsbuea treqsbeua treqsbeau treqsubae
treqsubea treqsuabe treqsuaeb treqsueab treqsueba treqsebua treqsebau treqseuba treqseuab treqseaub treqseabu
treqbsaue treqbsaeu treqbsuae treqbsuea treqbseua treqbseau treqbasue treqbaseu treqbause treqbaues treqbaeus
treqbaesu treqbuase treqbuaes treqbusae treqbusea treqbuesa treqbueas treqbeaus treqbeasu treqbeuas treqbeusa
treqbesua treqbesau trequsbae trequsbea trequsabe trequsaeb trequseab trequseba trequbsae trequbsea trequbase
trequbaes trequbeas trequbesa trequabse trequabes trequasbe trequaseb trequaesb trequaebs trequebas trequebsa
trequeabs trequeasb trequesab trequesba treqesbua treqesbau treqesuba treqesuab treqesaub treqesabu treqebsua
treqebsau treqebusa treqebuas treqebaus treqebasu treqeubsa treqeubas treqeusba treqeusab treqeuasb treqeuabs
treqeabus treqeabsu treqeaubs treqeausb treqeasub treqeasbu treuasqbe treuasqeb treuasbqe treuasbeq treuasebq
treuaseqb treuaqsbe treuaqseb treuaqbse treuaqbes treuaqebs treuaqesb treuabqse treuabqes treuabsqe treuabseq
treuabesq treuabeqs treuaeqbs treuaeqsb treuaebqs treuaebsq treuaesbq treuaesqb treusaqbe treusaqeb treusabqe
treusabeq treusaebq treusaeqb treusqabe treusqaeb treusqbae treusqbea treusqeba treusqeab treusbqae treusbqea
treusbaqe treusbaeq treusbeaq treusbeqa treuseqba treuseqab treusebqa treusebaq treuseabq treuseaqb treuqsabe
treuqsaeb treuqsbae treuqsbea treuqseba treuqseab treuqasbe treuqaseb treuqabse treuqabes treuqaebs treuqaesb
treuqbase treuqbaes treuqbsae treuqbsea treuqbesa treuqbeas treuqeabs treuqeasb treuqebas treuqebsa treuqesba
treuqesab treubsqae treubsqea treubsaqe treubsaeq treubseaq treubseqa treubqsae treubqsea treubqase treubqaes
treubqeas treubqesa treubaqse treubaqes treubasqe treubaseq treubaesq treubaeqs treubeqas treubeqsa treubeaqs
treubeasq treubesaq treubesqa treuesqba treuesqab treuesbqa treuesbaq treuesabq treuesaqb treueqsba treueqsab
treueqbsa treueqbas treueqabs treueqasb treuebqsa treuebqas treuebsqa treuebsaq treuebasq treuebaqs treueaqbs
treueaqsb treueabqs treueabsq treueasbq treueasqb treeasqub treeasqbu treeasuqb treeasubq treeasbuq treeasbqu
treeaqsub treeaqsbu treeaqusb treeaqubs treeaqbus treeaqbsu treeauqsb treeauqbs treeausqb treeausbq treeaubsq
treeaubqs treeabqus treeabqsu treeabuqs treeabusq treeabsuq treeabsqu treesaqub treesaqbu treesauqb treesaubq
treesabuq treesabqu treesqaub treesqabu treesquab treesquba treesqbua treesqbau treesuqab treesuqba treesuaqb
treesuabq treesubaq treesubqa treesbqua treesbqau treesbuqa treesbuaq treesbauq treesbaqu treeqsaub treeqsabu
treeqsuab treeqsuba treeqsbua treeqsbau treeqasub treeqasbu treeqausb treeqaubs treeqabus treeqabsu treequasb
treequabs treequsab treequsba treequbsa treequbas treeqbaus treeqbasu treeqbuas treeqbusa treeqbsua treeqbsau
treeusqab treeusqba treeusaqb treeusabq treeusbaq treeusbqa treeuqsab treeuqsba treeuqasb treeuqabs treeuqbas
treeuqbsa treeuaqsb treeuaqbs treeuasqb treeuasbq treeuabsq treeuabqs treeubqas treeubqsa treeubaqs treeubasq
treeubsaq treeubsqa treebsqua treebsqau treebsuqa treebsuaq treebsauq treebsaqu treebqsua treebqsau treebqusa
treebquas treebqaus treebqasu treebuqsa treebuqas treebusqa treebusaq treebuasq treebuaqs treebaqus treebaqsu
treebauqs treebausq treebasuq treebasqu trsbeaque trsbeaqeu trsbeauqe trsbeaueq trsbeaeuq trsbeaequ trsbeqaue
trsbeqaeu trsbequae trsbequea trsbeqeua trsbeqeau trsbeuqae trsbeuqea trsbeuaqe trsbeuaeq trsbeueaq trsbeueqa
trsbeequa trsbeeqau trsbeeuqa trsbeeuaq trsbeeauq trsbeeaqu trsbaeque trsbaeqeu trsbaeuqe trsbaeueq trsbaeeuq
trsbaeequ trsbaqeue trsbaqeeu trsbaquee trsbaquee trsbaqeue trsbaqeeu trsbauqee trsbauqee trsbaueqe trsbaueeq
trsbaueeq trsbaueqe trsbaeque trsbaeqeu trsbaeuqe trsbaeueq trsbaeeuq trsbaeequ trsbqaeue trsbqaeeu trsbqauee
trsbqauee trsbqaeue trsbqaeeu trsbqeaue trsbqeaeu trsbqeuae trsbqeuea trsbqeeua trsbqeeau trsbqueae trsbqueea
trsbquaee trsbquaee trsbqueae trsbqueea trsbqeeua trsbqeeau trsbqeuea trsbqeuae trsbqeaue trsbqeaeu trsbuaqee
trsbuaqee trsbuaeqe trsbuaeeq trsbuaeeq trsbuaeqe trsbuqaee trsbuqaee trsbuqeae trsbuqeea trsbuqeea trsbuqeae
trsbueqae trsbueqea trsbueaqe trsbueaeq trsbueeaq trsbueeqa trsbueqea trsbueqae trsbueeqa trsbueeaq trsbueaeq
trsbueaqe trsbeaque trsbeaqeu trsbeauqe trsbeaueq trsbeaeuq trsbeaequ trsbeqaue trsbeqaeu trsbequae trsbequea
trsbeqeua trsbeqeau trsbeuqae trsbeuqea trsbeuaqe trsbeuaeq trsbeueaq trsbeueqa trsbeequa trsbeeqau trsbeeuqa
trsbeeuaq trsbeeauq trsbeeaqu trsebaque trsebaqeu trsebauqe trsebaueq trsebaeuq trsebaequ trsebqaue trsebqaeu
trsebquae trsebquea trsebqeua trsebqeau trsebuqae trsebuqea trsebuaqe trsebuaeq trsebueaq trsebueqa trsebequa
trsebeqau trsebeuqa trsebeuaq trsebeauq trsebeaqu trseabque trseabqeu trseabuqe trseabueq trseabeuq trseabequ
trseaqbue trseaqbeu trseaqube trseaqueb trseaqeub trseaqebu trseauqbe trseauqeb trseaubqe trseaubeq trseauebq
trseaueqb trseaequb trseaeqbu trseaeuqb trseaeubq trseaebuq trseaebqu trseqabue trseqabeu trseqaube trseqaueb
trseqaeub trseqaebu trseqbaue trseqbaeu trseqbuae trseqbuea trseqbeua trseqbeau trsequbae trsequbea trsequabe
trsequaeb trsequeab trsequeba trseqebua trseqebau trseqeuba trseqeuab trseqeaub trseqeabu trseuaqbe trseuaqeb
trseuabqe trseuabeq trseuaebq trseuaeqb trseuqabe trseuqaeb trseuqbae trseuqbea trseuqeba trseuqeab trseubqae
trseubqea trseubaqe trseubaeq trseubeaq trseubeqa trseueqba trseueqab trseuebqa trseuebaq trseueabq trseueaqb
trseeaqub trseeaqbu trseeauqb trseeaubq trseeabuq trseeabqu trseeqaub trseeqabu trseequab trseequba trseeqbua
trseeqbau trseeuqab trseeuqba trseeuaqb trseeuabq trseeubaq trseeubqa trseebqua trseebqau trseebuqa trseebuaq
trseebauq trseebaqu trsaebque trsaebqeu trsaebuqe trsaebueq trsaebeuq trsaebequ trsaeqbue trsaeqbeu trsaeqube
trsaequeb trsaeqeub trsaeqebu trsaeuqbe trsaeuqeb trsaeubqe trsaeubeq trsaeuebq trsaeueqb trsaeequb trsaeeqbu
trsaeeuqb trsaeeubq trsaeebuq trsaeebqu trsabeque trsabeqeu trsabeuqe trsabeueq trsabeeuq trsabeequ trsabqeue
trsabqeeu trsabquee trsabquee trsabqeue trsabqeeu trsabuqee trsabuqee trsabueqe trsabueeq trsabueeq trsabueqe
trsabeque trsabeqeu trsabeuqe trsabeueq trsabeeuq trsabeequ trsaqbeue trsaqbeeu trsaqbuee trsaqbuee trsaqbeue
trsaqbeeu trsaqebue trsaqebeu trsaqeube trsaqeueb trsaqeeub trsaqeebu trsaquebe trsaqueeb trsaqubee trsaqubee
trsaquebe trsaqueeb trsaqeeub trsaqeebu trsaqeueb trsaqeube trsaqebue trsaqebeu trsaubqee trsaubqee trsaubeqe
trsaubeeq trsaubeeq trsaubeqe trsauqbee trsauqbee trsauqebe trsauqeeb trsauqeeb trsauqebe trsaueqbe trsaueqeb
trsauebqe trsauebeq trsaueebq trsaueeqb trsaueqeb trsaueqbe trsaueeqb trsaueebq trsauebeq trsauebqe trsaebque
trsaebqeu trsaebuqe trsaebueq trsaebeuq trsaebequ trsaeqbue trsaeqbeu trsaeqube trsaequeb trsaeqeub trsaeqebu
trsaeuqbe trsaeuqeb trsaeubqe trsaeubeq trsaeuebq trsaeueqb trsaeequb trsaeeqbu trsaeeuqb trsaeeubq trsaeebuq
trsaeebqu trsqeabue trsqeabeu trsqeaube trsqeaueb trsqeaeub trsqeaebu trsqebaue trsqebaeu trsqebuae trsqebuea
trsqebeua trsqebeau trsqeubae trsqeubea trsqeuabe trsqeuaeb trsqeueab trsqeueba trsqeebua trsqeebau trsqeeuba
trsqeeuab trsqeeaub trsqeeabu trsqaebue trsqaebeu trsqaeube trsqaeueb trsqaeeub trsqaeebu trsqabeue trsqabeeu
trsqabuee trsqabuee trsqabeue trsqabeeu trsqaubee trsqaubee trsqauebe trsqaueeb trsqaueeb trsqauebe trsqaebue
trsqaebeu trsqaeube trsqaeueb trsqaeeub trsqaeebu trsqbaeue trsqbaeeu trsqbauee trsqbauee trsqbaeue trsqbaeeu
trsqbeaue trsqbeaeu trsqbeuae trsqbeuea trsqbeeua trsqbeeau trsqbueae trsqbueea trsqbuaee trsqbuaee trsqbueae
trsqbueea trsqbeeua trsqbeeau trsqbeuea trsqbeuae trsqbeaue trsqbeaeu trsquabee trsquabee trsquaebe trsquaeeb
trsquaeeb trsquaebe trsqubaee trsqubaee trsqubeae trsqubeea trsqubeea trsqubeae trsquebae trsquebea trsqueabe
trsqueaeb trsqueeab trsqueeba trsquebea trsquebae trsqueeba trsqueeab trsqueaeb trsqueabe trsqeabue trsqeabeu
trsqeaube trsqeaueb trsqeaeub trsqeaebu trsqebaue trsqebaeu trsqebuae trsqebuea trsqebeua trsqebeau trsqeubae
trsqeubea trsqeuabe trsqeuaeb trsqeueab trsqeueba trsqeebua trsqeebau trsqeeuba trsqeeuab trsqeeaub trsqeeabu
trsueaqbe trsueaqeb trsueabqe trsueabeq trsueaebq trsueaeqb trsueqabe trsueqaeb trsueqbae trsueqbea trsueqeba
trsueqeab trsuebqae trsuebqea trsuebaqe trsuebaeq trsuebeaq trsuebeqa trsueeqba trsueeqab trsueebqa trsueebaq
trsueeabq trsueeaqb trsuaeqbe trsuaeqeb trsuaebqe trsuaebeq trsuaeebq trsuaeeqb trsuaqebe trsuaqeeb trsuaqbee
trsuaqbee trsuaqebe trsuaqeeb trsuabqee trsuabqee trsuabeqe trsuabeeq trsuabeeq trsuabeqe trsuaeqbe trsuaeqeb
trsuaebqe trsuaebeq trsuaeebq trsuaeeqb trsuqaebe trsuqaeeb trsuqabee trsuqabee trsuqaebe trsuqaeeb trsuqeabe
trsuqeaeb trsuqebae trsuqebea trsuqeeba trsuqeeab trsuqbeae trsuqbeea trsuqbaee trsuqbaee trsuqbeae trsuqbeea
trsuqeeba trsuqeeab trsuqebea trsuqebae trsuqeabe trsuqeaeb trsubaqee trsubaqee trsubaeqe trsubaeeq trsubaeeq
trsubaeqe trsubqaee trsubqaee trsubqeae trsubqeea trsubqeea trsubqeae trsubeqae trsubeqea trsubeaqe trsubeaeq
trsubeeaq trsubeeqa trsubeqea trsubeqae trsubeeqa trsubeeaq trsubeaeq trsubeaqe trsueaqbe trsueaqeb trsueabqe
trsueabeq trsueaebq trsueaeqb trsueqabe trsueqaeb trsueqbae trsueqbea trsueqeba trsueqeab trsuebqae trsuebqea
trsuebaqe trsuebaeq trsuebeaq trsuebeqa trsueeqba trsueeqab trsueebqa trsueebaq trsueeabq trsueeaqb trseeaqub
trseeaqbu trseeauqb trseeaubq trseeabuq trseeabqu trseeqaub trseeqabu trseequab trseequba trseeqbua trseeqbau
trseeuqab trseeuqba trseeuaqb trseeuabq trseeubaq trseeubqa trseebqua trseebqau trseebuqa trseebuaq trseebauq
trseebaqu trseaequb trseaeqbu trseaeuqb trseaeubq trseaebuq trseaebqu trseaqeub trseaqebu trseaqueb trseaqube
trseaqbue trseaqbeu trseauqeb trseauqbe trseaueqb trseauebq trseaubeq trseaubqe trseabque trseabqeu trseabuqe
trseabueq trseabeuq trseabequ trseqaeub trseqaebu trseqaueb trseqaube trseqabue trseqabeu trseqeaub trseqeabu
trseqeuab trseqeuba trseqebua trseqebau trsequeab trsequeba trsequaeb trsequabe trsequbae trsequbea trseqbeua
trseqbeau trseqbuea trseqbuae trseqbaue trseqbaeu trseuaqeb trseuaqbe trseuaeqb trseuaebq trseuabeq trseuabqe
trseuqaeb trseuqabe trseuqeab trseuqeba trseuqbea trseuqbae trseueqab trseueqba trseueaqb trseueabq trseuebaq
trseuebqa trseubqea trseubqae trseubeqa trseubeaq trseubaeq trseubaqe trsebaque trsebaqeu trsebauqe trsebaueq
trsebaeuq trsebaequ trsebqaue trsebqaeu trsebquae trsebquea trsebqeua trsebqeau trsebuqae trsebuqea trsebuaqe
trsebuaeq trsebueaq trsebueqa trsebequa trsebeqau trsebeuqa trsebeuaq trsebeauq trsebeaqu trqbesaue trqbesaeu
trqbesuae trqbesuea trqbeseua trqbeseau trqbeasue trqbeaseu trqbeause trqbeaues trqbeaeus trqbeaesu trqbeuase
trqbeuaes trqbeusae trqbeusea trqbeuesa trqbeueas trqbeeaus trqbeeasu trqbeeuas trqbeeusa trqbeesua trqbeesau
trqbseaue trqbseaeu trqbseuae trqbseuea trqbseeua trqbseeau trqbsaeue trqbsaeeu trqbsauee trqbsauee trqbsaeue
trqbsaeeu trqbsuaee trqbsuaee trqbsueae trqbsueea trqbsueea trqbsueae trqbseaue trqbseaeu trqbseuae trqbseuea
trqbseeua trqbseeau trqbaseue trqbaseeu trqbasuee trqbasuee trqbaseue trqbaseeu trqbaesue trqbaeseu trqbaeuse
trqbaeues trqbaeeus trqbaeesu trqbauese trqbauees trqbausee trqbausee trqbauese trqbauees trqbaeeus trqbaeesu
trqbaeues trqbaeuse trqbaesue trqbaeseu trqbusaee trqbusaee trqbuseae trqbuseea trqbuseea trqbuseae trqbuasee
trqbuasee trqbuaese trqbuaees trqbuaees trqbuaese trqbuease trqbueaes trqbuesae trqbuesea trqbueesa trqbueeas
trqbueaes trqbuease trqbueeas trqbueesa trqbuesea trqbuesae trqbesaue trqbesaeu trqbesuae trqbesuea trqbeseua
trqbeseau trqbeasue trqbeaseu trqbeause trqbeaues trqbeaeus trqbeaesu trqbeuase trqbeuaes trqbeusae trqbeusea
trqbeuesa trqbeueas trqbeeaus trqbeeasu trqbeeuas trqbeeusa trqbeesua trqbeesau trqebsaue trqebsaeu trqebsuae
trqebsuea trqebseua trqebseau trqebasue trqebaseu trqebause trqebaues trqebaeus trqebaesu trqebuase trqebuaes
trqebusae trqebusea trqebuesa trqebueas trqebeaus trqebeasu trqebeuas trqebeusa trqebesua trqebesau trqesbaue
trqesbaeu trqesbuae trqesbuea trqesbeua trqesbeau trqesabue trqesabeu trqesaube trqesaueb trqesaeub trqesaebu
trqesuabe trqesuaeb trqesubae trqesubea trqesueba trqesueab trqeseaub trqeseabu trqeseuab trqeseuba trqesebua
trqesebau trqeasbue trqeasbeu trqeasube trqeasueb trqeaseub trqeasebu trqeabsue trqeabseu trqeabuse trqeabues
trqeabeus trqeabesu trqeaubse trqeaubes trqeausbe trqeauseb trqeauesb trqeauebs trqeaebus trqeaebsu trqeaeubs
trqeaeusb trqeaesub trqeaesbu trqeusabe trqeusaeb trqeusbae trqeusbea trqeuseba trqeuseab trqeuasbe trqeuaseb
trqeuabse trqeuabes trqeuaebs trqeuaesb trqeubase trqeubaes trqeubsae trqeubsea trqeubesa trqeubeas trqeueabs
trqeueasb trqeuebas trqeuebsa trqeuesba trqeuesab trqeesaub trqeesabu trqeesuab trqeesuba trqeesbua trqeesbau
trqeeasub trqeeasbu trqeeausb trqeeaubs trqeeabus trqeeabsu trqeeuasb trqeeuabs trqeeusab trqeeusba trqeeubsa
trqeeubas trqeebaus trqeebasu trqeebuas trqeebusa trqeebsua trqeebsau trqsebaue trqsebaeu trqsebuae trqsebuea
trqsebeua trqsebeau trqseabue trqseabeu trqseaube trqseaueb trqseaeub trqseaebu trqseuabe trqseuaeb trqseubae
trqseubea trqseueba trqseueab trqseeaub trqseeabu trqseeuab trqseeuba trqseebua trqseebau trqsbeaue trqsbeaeu
trqsbeuae trqsbeuea trqsbeeua trqsbeeau trqsbaeue trqsbaeeu trqsbauee trqsbauee trqsbaeue trqsbaeeu trqsbuaee
trqsbuaee trqsbueae trqsbueea trqsbueea trqsbueae trqsbeaue trqsbeaeu trqsbeuae trqsbeuea trqsbeeua trqsbeeau
trqsabeue trqsabeeu trqsabuee trqsabuee trqsabeue trqsabeeu trqsaebue trqsaebeu trqsaeube trqsaeueb trqsaeeub
trqsaeebu trqsauebe trqsaueeb trqsaubee trqsaubee trqsauebe trqsaueeb trqsaeeub trqsaeebu trqsaeueb trqsaeube
trqsaebue trqsaebeu trqsubaee trqsubaee trqsubeae trqsubeea trqsubeea trqsubeae trqsuabee trqsuabee trqsuaebe
trqsuaeeb trqsuaeeb trqsuaebe trqsueabe trqsueaeb trqsuebae trqsuebea trqsueeba trqsueeab trqsueaeb trqsueabe
trqsueeab trqsueeba trqsuebea trqsuebae trqsebaue trqsebaeu trqsebuae trqsebuea trqsebeua trqsebeau trqseabue
trqseabeu trqseaube trqseaueb trqseaeub trqseaebu trqseuabe trqseuaeb trqseubae trqseubea trqseueba trqseueab
trqseeaub trqseeabu trqseeuab trqseeuba trqseebua trqseebau trqaesbue trqaesbeu trqaesube trqaesueb trqaeseub
trqaesebu trqaebsue trqaebseu trqaebuse trqaebues trqaebeus trqaebesu trqaeubse trqaeubes trqaeusbe trqaeuseb
trqaeuesb trqaeuebs trqaeebus trqaeebsu trqaeeubs trqaeeusb trqaeesub trqaeesbu trqasebue trqasebeu trqaseube
trqaseueb trqaseeub trqaseebu trqasbeue trqasbeeu trqasbuee trqasbuee trqasbeue trqasbeeu trqasubee trqasubee
trqasuebe trqasueeb trqasueeb trqasuebe trqasebue trqasebeu trqaseube trqaseueb trqaseeub trqaseebu trqabseue
trqabseeu trqabsuee trqabsuee trqabseue trqabseeu trqabesue trqabeseu trqabeuse trqabeues trqabeeus trqabeesu
trqabuese trqabuees trqabusee trqabusee trqabuese trqabuees trqabeeus trqabeesu trqabeues trqabeuse trqabesue
trqabeseu trqausbee trqausbee trqausebe trqauseeb trqauseeb trqausebe trqaubsee trqaubsee trqaubese trqaubees
trqaubees trqaubese trqauebse trqauebes trqauesbe trqaueseb trqaueesb trqaueebs trqauebes trqauebse trqaueebs
trqaueesb trqaueseb trqauesbe trqaesbue trqaesbeu trqaesube trqaesueb trqaeseub trqaesebu trqaebsue trqaebseu
trqaebuse trqaebues trqaebeus trqaebesu trqaeubse trqaeubes trqaeusbe trqaeuseb trqaeuesb trqaeuebs trqaeebus
trqaeebsu trqaeeubs trqaeeusb trqaeesub trqaeesbu trquesabe trquesaeb trquesbae trquesbea trqueseba trqueseab
trqueasbe trqueaseb trqueabse trqueabes trqueaebs trqueaesb trquebase trquebaes trquebsae trquebsea trquebesa
trquebeas trqueeabs trqueeasb trqueebas trqueebsa trqueesba trqueesab trquseabe trquseaeb trqusebae trqusebea
trquseeba trquseeab trqusaebe trqusaeeb trqusabee trqusabee trqusaebe trqusaeeb trqusbaee trqusbaee trqusbeae
trqusbeea trqusbeea trqusbeae trquseabe trquseaeb trqusebae trqusebea trquseeba trquseeab trquasebe trquaseeb
trquasbee trquasbee trquasebe trquaseeb trquaesbe trquaeseb trquaebse trquaebes trquaeebs trquaeesb trquabese
trquabees trquabsee trquabsee trquabese trquabees trquaeebs trquaeesb trquaebes trquaebse trquaesbe trquaeseb
trqubsaee trqubsaee trqubseae trqubseea trqubseea trqubseae trqubasee trqubasee trqubaese trqubaees trqubaees
trqubaese trqubease trqubeaes trqubesae trqubesea trqubeesa trqubeeas trqubeaes trqubease trqubeeas trqubeesa
trqubesea trqubesae trquesabe trquesaeb trquesbae trquesbea trqueseba trqueseab trqueasbe trqueaseb trqueabse
trqueabes trqueaebs trqueaesb trquebase trquebaes trquebsae trquebsea trquebesa trquebeas trqueeabs trqueeasb
trqueebas trqueebsa trqueesba trqueesab trqeesaub trqeesabu trqeesuab trqeesuba trqeesbua trqeesbau trqeeasub
trqeeasbu trqeeausb trqeeaubs trqeeabus trqeeabsu trqeeuasb trqeeuabs trqeeusab trqeeusba trqeeubsa trqeeubas
trqeebaus trqeebasu trqeebuas trqeebusa trqeebsua trqeebsau trqeseaub trqeseabu trqeseuab trqeseuba trqesebua
trqesebau trqesaeub trqesaebu trqesaueb trqesaube trqesabue trqesabeu trqesuaeb trqesuabe trqesueab trqesueba
trqesubea trqesubae trqesbaue trqesbaeu trqesbuae trqesbuea trqesbeua trqesbeau trqeaseub trqeasebu trqeasueb
trqeasube trqeasbue trqeasbeu trqeaesub trqeaesbu trqeaeusb trqeaeubs trqeaebus trqeaebsu trqeauesb trqeauebs
trqeauseb trqeausbe trqeaubse trqeaubes trqeabeus trqeabesu trqeabues trqeabuse trqeabsue trqeabseu trqeusaeb
trqeusabe trqeuseab trqeuseba trqeusbea trqeusbae trqeuaseb trqeuasbe trqeuaesb trqeuaebs trqeuabes trqeuabse
trqeueasb trqeueabs trqeuesab trqeuesba trqeuebsa trqeuebas trqeubaes trqeubase trqeubeas trqeubesa trqeubsea
trqeubsae trqebsaue trqebsaeu trqebsuae trqebsuea trqebseua trqebseau trqebasue trqebaseu trqebause trqebaues
trqebaeus trqebaesu trqebuase trqebuaes trqebusae trqebusea trqebuesa trqebueas trqebeaus trqebeasu trqebeuas
trqebeusa trqebesua trqebesau trubesqae trubesqea trubesaqe trubesaeq trubeseaq trubeseqa trubeqsae trubeqsea
trubeqase trubeqaes trubeqeas trubeqesa trubeaqse trubeaqes trubeasqe trubeaseq trubeaesq trubeaeqs trubeeqas
trubeeqsa trubeeaqs trubeeasq trubeesaq trubeesqa trubseqae trubseqea trubseaqe trubseaeq trubseeaq trubseeqa
trubsqeae trubsqeea trubsqaee trubsqaee trubsqeae trubsqeea trubsaqee trubsaqee trubsaeqe trubsaeeq trubsaeeq
trubsaeqe trubseqae trubseqea trubseaqe trubseaeq trubseeaq trubseeqa trubqseae trubqseea trubqsaee trubqsaee
trubqseae trubqseea trubqesae trubqesea trubqease trubqeaes trubqeeas trubqeesa trubqaese trubqaees trubqasee
trubqasee trubqaese trubqaees trubqeeas trubqeesa trubqeaes trubqease trubqesae trubqesea trubasqee trubasqee
trubaseqe trubaseeq trubaseeq trubaseqe trubaqsee trubaqsee trubaqese trubaqees trubaqees trubaqese trubaeqse
trubaeqes trubaesqe trubaeseq trubaeesq trubaeeqs trubaeqes trubaeqse trubaeeqs trubaeesq trubaeseq trubaesqe
trubesqae trubesqea trubesaqe trubesaeq trubeseaq trubeseqa trubeqsae trubeqsea trubeqase trubeqaes trubeqeas
trubeqesa trubeaqse trubeaqes trubeasqe trubeaseq trubeaesq trubeaeqs trubeeqas trubeeqsa trubeeaqs trubeeasq
trubeesaq trubeesqa truebsqae truebsqea truebsaqe truebsaeq truebseaq truebseqa truebqsae truebqsea truebqase
truebqaes truebqeas truebqesa truebaqse truebaqes truebasqe truebaseq truebaesq truebaeqs truebeqas truebeqsa
truebeaqs truebeasq truebesaq truebesqa truesbqae truesbqea truesbaqe truesbaeq truesbeaq truesbeqa truesqbae
truesqbea truesqabe truesqaeb truesqeab truesqeba truesaqbe truesaqeb truesabqe truesabeq truesaebq truesaeqb
trueseqab trueseqba trueseaqb trueseabq truesebaq truesebqa trueqsbae trueqsbea trueqsabe trueqsaeb trueqseab
trueqseba trueqbsae trueqbsea trueqbase trueqbaes trueqbeas trueqbesa trueqabse trueqabes trueqasbe trueqaseb
trueqaesb trueqaebs trueqebas trueqebsa trueqeabs trueqeasb trueqesab trueqesba trueasqbe trueasqeb trueasbqe
trueasbeq trueasebq trueaseqb trueaqsbe trueaqseb trueaqbse trueaqbes trueaqebs trueaqesb trueabqse trueabqes
trueabsqe trueabseq trueabesq trueabeqs trueaeqbs trueaeqsb trueaebqs trueaebsq trueaesbq trueaesqb trueesqab
trueesqba trueesaqb trueesabq trueesbaq trueesbqa trueeqsab trueeqsba trueeqasb trueeqabs trueeqbas trueeqbsa
trueeaqsb trueeaqbs trueeasqb trueeasbq trueeabsq trueeabqs trueebqas trueebqsa trueebaqs trueebasq trueebsaq
trueebsqa trusebqae trusebqea trusebaqe trusebaeq trusebeaq trusebeqa truseqbae truseqbea truseqabe truseqaeb
truseqeab truseqeba truseaqbe truseaqeb truseabqe truseabeq truseaebq truseaeqb truseeqab truseeqba truseeaqb
truseeabq truseebaq truseebqa trusbeqae trusbeqea trusbeaqe trusbeaeq trusbeeaq trusbeeqa trusbqeae trusbqeea
trusbqaee trusbqaee trusbqeae trusbqeea trusbaqee trusbaqee trusbaeqe trusbaeeq trusbaeeq trusbaeqe trusbeqae
trusbeqea trusbeaqe trusbeaeq trusbeeaq trusbeeqa trusqbeae trusqbeea trusqbaee trusqbaee trusqbeae trusqbeea
trusqebae trusqebea trusqeabe trusqeaeb trusqeeab trusqeeba trusqaebe trusqaeeb trusqabee trusqabee trusqaebe
trusqaeeb trusqeeab trusqeeba trusqeaeb trusqeabe trusqebae trusqebea trusabqee trusabqee trusabeqe trusabeeq
trusabeeq trusabeqe trusaqbee trusaqbee trusaqebe trusaqeeb trusaqeeb trusaqebe trusaeqbe trusaeqeb trusaebqe
trusaebeq trusaeebq trusaeeqb trusaeqeb trusaeqbe trusaeeqb trusaeebq trusaebeq trusaebqe trusebqae trusebqea
trusebaqe trusebaeq trusebeaq trusebeqa truseqbae truseqbea truseqabe truseqaeb truseqeab truseqeba truseaqbe
truseaqeb truseabqe truseabeq truseaebq truseaeqb truseeqab truseeqba truseeaqb truseeabq truseebaq truseebqa
truqesbae truqesbea truqesabe truqesaeb truqeseab truqeseba truqebsae truqebsea truqebase truqebaes truqebeas
truqebesa truqeabse truqeabes truqeasbe truqeaseb truqeaesb truqeaebs truqeebas truqeebsa truqeeabs truqeeasb
truqeesab truqeesba truqsebae truqsebea truqseabe truqseaeb truqseeab truqseeba truqsbeae truqsbeea truqsbaee
truqsbaee truqsbeae truqsbeea truqsabee truqsabee truqsaebe truqsaeeb truqsaeeb truqsaebe truqsebae truqsebea
truqseabe truqseaeb truqseeab truqseeba truqbseae truqbseea truqbsaee truqbsaee truqbseae truqbseea truqbesae
truqbesea truqbease truqbeaes truqbeeas truqbeesa truqbaese truqbaees truqbasee truqbasee truqbaese truqbaees
truqbeeas truqbeesa truqbeaes truqbease truqbesae truqbesea truqasbee truqasbee truqasebe truqaseeb truqaseeb
truqasebe truqabsee truqabsee truqabese truqabees truqabees truqabese truqaebse truqaebes truqaesbe truqaeseb
truqaeesb truqaeebs truqaebes truqaebse truqaeebs truqaeesb truqaeseb truqaesbe truqesbae truqesbea truqesabe
truqesaeb truqeseab truqeseba truqebsae truqebsea truqebase truqebaes truqebeas truqebesa truqeabse truqeabes
truqeasbe truqeaseb truqeaesb truqeaebs truqeebas truqeebsa truqeeabs truqeeasb truqeesab truqeesba truaesqbe
truaesqeb truaesbqe truaesbeq truaesebq truaeseqb truaeqsbe truaeqseb truaeqbse truaeqbes truaeqebs truaeqesb
truaebqse truaebqes truaebsqe truaebseq truaebesq truaebeqs truaeeqbs truaeeqsb truaeebqs truaeebsq truaeesbq
truaeesqb truaseqbe truaseqeb truasebqe truasebeq truaseebq truaseeqb truasqebe truasqeeb truasqbee truasqbee
truasqebe truasqeeb truasbqee truasbqee truasbeqe truasbeeq truasbeeq truasbeqe truaseqbe truaseqeb truasebqe
truasebeq truaseebq truaseeqb truaqsebe truaqseeb truaqsbee truaqsbee truaqsebe truaqseeb truaqesbe truaqeseb
truaqebse truaqebes truaqeebs truaqeesb truaqbese truaqbees truaqbsee truaqbsee truaqbese truaqbees truaqeebs
truaqeesb truaqebes truaqebse truaqesbe truaqeseb truabsqee truabsqee truabseqe truabseeq truabseeq truabseqe
truabqsee truabqsee truabqese truabqees truabqees truabqese truabeqse truabeqes truabesqe truabeseq truabeesq
truabeeqs truabeqes truabeqse truabeeqs truabeesq truabeseq truabesqe truaesqbe truaesqeb truaesbqe truaesbeq
truaesebq truaeseqb truaeqsbe truaeqseb truaeqbse truaeqbes truaeqebs truaeqesb truaebqse truaebqes truaebsqe
truaebseq truaebesq truaebeqs truaeeqbs truaeeqsb truaeebqs truaeebsq truaeesbq truaeesqb trueesqab trueesqba
trueesaqb trueesabq trueesbaq trueesbqa trueeqsab trueeqsba trueeqasb trueeqabs trueeqbas trueeqbsa trueeaqsb
trueeaqbs trueeasqb trueeasbq trueeabsq trueeabqs trueebqas trueebqsa trueebaqs trueebasq trueebsaq trueebsqa
trueseqab trueseqba trueseaqb trueseabq truesebaq truesebqa truesqeab truesqeba truesqaeb truesqabe truesqbae
truesqbea truesaqeb truesaqbe truesaeqb truesaebq truesabeq truesabqe truesbqae truesbqea truesbaqe truesbaeq
truesbeaq truesbeqa trueqseab trueqseba trueqsaeb trueqsabe trueqsbae trueqsbea trueqesab trueqesba trueqeasb
trueqeabs trueqebas trueqebsa trueqaesb trueqaebs trueqaseb trueqasbe trueqabse trueqabes trueqbeas trueqbesa
trueqbaes trueqbase trueqbsae trueqbsea trueasqeb trueasqbe trueaseqb trueasebq trueasbeq trueasbqe trueaqseb
trueaqsbe trueaqesb trueaqebs trueaqbes trueaqbse trueaeqsb trueaeqbs trueaesqb trueaesbq trueaebsq trueaebqs
trueabqes trueabqse trueabeqs trueabesq trueabseq trueabsqe truebsqae truebsqea truebsaqe truebsaeq truebseaq
truebseqa truebqsae truebqsea truebqase truebqaes truebqeas truebqesa truebaqse truebaqes truebasqe truebaseq
truebaesq truebaeqs truebeqas truebeqsa truebeaqs truebeasq truebesaq truebesqa trebesqua trebesqau trebesuqa
trebesuaq trebesauq trebesaqu trebeqsua trebeqsau trebequsa trebequas trebeqaus trebeqasu trebeuqsa trebeuqas
trebeusqa trebeusaq trebeuasq trebeuaqs trebeaqus trebeaqsu trebeauqs trebeausq trebeasuq trebeasqu trebsequa
trebseqau trebseuqa trebseuaq trebseauq trebseaqu trebsqeua trebsqeau trebsquea trebsquae trebsqaue trebsqaeu
trebsuqea trebsuqae trebsueqa trebsueaq trebsuaeq trebsuaqe trebsaque trebsaqeu trebsauqe trebsaueq trebsaeuq
trebsaequ trebqseua trebqseau trebqsuea trebqsuae trebqsaue trebqsaeu trebqesua trebqesau trebqeusa trebqeuas
trebqeaus trebqeasu trebquesa trebqueas trebqusea trebqusae trebquase trebquaes trebqaeus trebqaesu trebqaues
trebqause trebqasue trebqaseu trebusqea trebusqae trebuseqa trebuseaq trebusaeq trebusaqe trebuqsea trebuqsae
trebuqesa trebuqeas trebuqaes trebuqase trebueqsa trebueqas trebuesqa trebuesaq trebueasq trebueaqs trebuaqes
trebuaqse trebuaeqs trebuaesq trebuaseq trebuasqe trebasque trebasqeu trebasuqe trebasueq trebaseuq trebasequ
trebaqsue trebaqseu trebaquse trebaques trebaqeus trebaqesu trebauqse trebauqes trebausqe trebauseq trebauesq
trebaueqs trebaequs trebaeqsu trebaeuqs trebaeusq trebaesuq trebaesqu treebsqua treebsqau treebsuqa treebsuaq
treebsauq treebsaqu treebqsua treebqsau treebqusa treebquas treebqaus treebqasu treebuqsa treebuqas treebusqa
treebusaq treebuasq treebuaqs treebaqus treebaqsu treebauqs treebausq treebasuq treebasqu treesbqua treesbqau
treesbuqa treesbuaq treesbauq treesbaqu treesqbua treesqbau treesquba treesquab treesqaub treesqabu treesuqba
treesuqab treesubqa treesubaq treesuabq treesuaqb treesaqub treesaqbu treesauqb treesaubq treesabuq treesabqu
treeqsbua treeqsbau treeqsuba treeqsuab treeqsaub treeqsabu treeqbsua treeqbsau treeqbusa treeqbuas treeqbaus
treeqbasu treequbsa treequbas treequsba treequsab treequasb treequabs treeqabus treeqabsu treeqaubs treeqausb
treeqasub treeqasbu treeusqba treeusqab treeusbqa treeusbaq treeusabq treeusaqb treeuqsba treeuqsab treeuqbsa
treeuqbas treeuqabs treeuqasb treeubqsa treeubqas treeubsqa treeubsaq treeubasq treeubaqs treeuaqbs treeuaqsb
treeuabqs treeuabsq treeuasbq treeuasqb treeasqub treeasqbu treeasuqb treeasubq treeasbuq treeasbqu treeaqsub
treeaqsbu treeaqusb treeaqubs treeaqbus treeaqbsu treeauqsb treeauqbs treeausqb treeausbq treeaubsq treeaubqs
treeabqus treeabqsu treeabuqs treeabusq treeabsuq treeabsqu tresebqua tresebqau tresebuqa tresebuaq tresebauq
tresebaqu treseqbua treseqbau tresequba tresequab treseqaub treseqabu treseuqba treseuqab treseubqa treseubaq
treseuabq treseuaqb treseaqub treseaqbu treseauqb treseaubq treseabuq treseabqu tresbequa tresbeqau tresbeuqa
tresbeuaq tresbeauq tresbeaqu tresbqeua tresbqeau tresbquea tresbquae tresbqaue tresbqaeu tresbuqea tresbuqae
tresbueqa tresbueaq tresbuaeq tresbuaqe tresbaque tresbaqeu tresbauqe tresbaueq tresbaeuq tresbaequ tresqbeua
tresqbeau tresqbuea tresqbuae tresqbaue tresqbaeu tresqebua tresqebau tresqeuba tresqeuab tresqeaub tresqeabu
tresqueba tresqueab tresqubea tresqubae tresquabe tresquaeb tresqaeub tresqaebu tresqaueb tresqaube tresqabue
tresqabeu tresubqea tresubqae tresubeqa tresubeaq tresubaeq tresubaqe tresuqbea tresuqbae tresuqeba tresuqeab
tresuqaeb tresuqabe tresueqba tresueqab tresuebqa tresuebaq tresueabq tresueaqb tresuaqeb tresuaqbe tresuaeqb
tresuaebq tresuabeq tresuabqe tresabque tresabqeu tresabuqe tresabueq tresabeuq tresabequ tresaqbue tresaqbeu
tresaqube tresaqueb tresaqeub tresaqebu tresauqbe tresauqeb tresaubqe tresaubeq tresauebq tresaueqb tresaequb
tresaeqbu tresaeuqb tresaeubq tresaebuq tresaebqu treqesbua treqesbau treqesuba treqesuab treqesaub treqesabu
treqebsua treqebsau treqebusa treqebuas treqebaus treqebasu treqeubsa treqeubas treqeusba treqeusab treqeuasb
treqeuabs treqeabus treqeabsu treqeaubs treqeausb treqeasub treqeasbu treqsebua treqsebau treqseuba treqseuab
treqseaub treqseabu treqsbeua treqsbeau treqsbuea treqsbuae treqsbaue treqsbaeu treqsubea treqsubae treqsueba
treqsueab treqsuaeb treqsuabe treqsabue treqsabeu treqsaube treqsaueb treqsaeub treqsaebu treqbseua treqbseau
treqbsuea treqbsuae treqbsaue treqbsaeu treqbesua treqbesau treqbeusa treqbeuas treqbeaus treqbeasu treqbuesa
treqbueas treqbusea treqbusae treqbuase treqbuaes treqbaeus treqbaesu treqbaues treqbause treqbasue treqbaseu
trequsbea trequsbae trequseba trequseab trequsaeb trequsabe trequbsea trequbsae trequbesa trequbeas trequbaes
trequbase trequebsa trequebas trequesba trequesab trequeasb trequeabs trequabes trequabse trequaebs trequaesb
trequaseb trequasbe treqasbue treqasbeu treqasube treqasueb treqaseub treqasebu treqabsue treqabseu treqabuse
treqabues treqabeus treqabesu treqaubse treqaubes treqausbe treqauseb treqauesb treqauebs treqaebus treqaebsu
treqaeubs treqaeusb treqaesub treqaesbu treuesqba treuesqab treuesbqa treuesbaq treuesabq treuesaqb treueqsba
treueqsab treueqbsa treueqbas treueqabs treueqasb treuebqsa treuebqas treuebsqa treuebsaq treuebasq treuebaqs
treueaqbs treueaqsb treueabqs treueabsq treueasbq treueasqb treuseqba treuseqab treusebqa treusebaq treuseabq
treuseaqb treusqeba treusqeab treusqbea treusqbae treusqabe treusqaeb treusbqea treusbqae treusbeqa treusbeaq
treusbaeq treusbaqe treusaqbe treusaqeb treusabqe treusabeq treusaebq treusaeqb treuqseba treuqseab treuqsbea
treuqsbae treuqsabe treuqsaeb treuqesba treuqesab treuqebsa treuqebas treuqeabs treuqeasb treuqbesa treuqbeas
treuqbsea treuqbsae treuqbase treuqbaes treuqaebs treuqaesb treuqabes treuqabse treuqasbe treuqaseb treubsqea
treubsqae treubseqa treubseaq treubsaeq treubsaqe treubqsea treubqsae treubqesa treubqeas treubqaes treubqase
treubeqsa treubeqas treubesqa treubesaq treubeasq treubeaqs treubaqes treubaqse treubaeqs treubaesq treubaseq
treubasqe treuasqbe treuasqeb treuasbqe treuasbeq treuasebq treuaseqb treuaqsbe treuaqseb treuaqbse treuaqbes
treuaqebs treuaqesb treuabqse treuabqes treuabsqe treuabseq treuabesq treuabeqs treuaeqbs treuaeqsb treuaebqs
treuaebsq treuaesbq treuaesqb treaesqub treaesqbu treaesuqb treaesubq treaesbuq treaesbqu treaeqsub treaeqsbu
treaequsb treaequbs treaeqbus treaeqbsu treaeuqsb treaeuqbs treaeusqb treaeusbq treaeubsq treaeubqs treaebqus
treaebqsu treaebuqs treaebusq treaebsuq treaebsqu treasequb treaseqbu treaseuqb treaseubq treasebuq treasebqu
treasqeub treasqebu treasqueb treasqube treasqbue treasqbeu treasuqeb treasuqbe treasueqb treasuebq treasubeq
treasubqe treasbque treasbqeu treasbuqe treasbueq treasbeuq treasbequ treaqseub treaqsebu treaqsueb treaqsube
treaqsbue treaqsbeu treaqesub treaqesbu treaqeusb treaqeubs treaqebus treaqebsu treaquesb treaquebs treaquseb
treaqusbe treaqubse treaqubes treaqbeus treaqbesu treaqbues treaqbuse treaqbsue treaqbseu treausqeb treausqbe
treauseqb treausebq treausbeq treausbqe treauqseb treauqsbe treauqesb treauqebs treauqbes treauqbse treaueqsb
treaueqbs treauesqb treauesbq treauebsq treauebqs treaubqes treaubqse treaubeqs treaubesq treaubseq treaubsqe
treabsque treabsqeu treabsuqe treabsueq treabseuq treabsequ treabqsue treabqseu treabquse treabques treabqeus
treabqesu treabuqse treabuqes treabusqe treabuseq treabuesq treabueqs treabequs treabeqsu treabeuqs treabeusq
treabesuq treabesqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us