easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

flumps

aliquandoque

glory

nowheres

kaste

solemque

beckoning

legosrv

effugiebatque

heteropoly

voluereque

propodium

cherishingly

bordello

emisisse

phlobaphene

groundflower

multiovulate


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: tigerville
cipher variations:
ujhfswjmmf vkigtxknng wljhuylooh xmkivzmppi ynljwanqqj
zomkxborrk apnlycpssl bqomzdqttm crpnaeruun dsqobfsvvo
etrpcgtwwp fusqdhuxxq gvtreivyyr hwusfjwzzs ixvtgkxaat
jywuhlybbu kzxvimzccv laywjnaddw mbzxkobeex ncaylpcffy
odbzmqdggz pecanrehha qfdbosfiib rgecptgjjc shfdquhkkd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: tigerville
Cipher: grtvieroov

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: tigerville
Cipher: BAABA ABAAA AABBA AABAA BAAAA BBBAB ABAAA ABABA ABABA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: tigerville
cipher variations:
ujhfswjmmfgztnamziinspfvicpeevefrdqsfaadqvdlyivwwlclptgylsstarnjwerkkjmhzreuhggr
yxlzmkxcczknxhuanyyhwdjpcqduupitvxkgtqqxvkigtxknnghauobnajjotqgwjdqffwfgsertgbbe
rwemzjwxxmdmquhzmttubsokxfsllkniasfvihhszymanlyddaloyivbozzixekqdrevvqjuwylhurry
wljhuyloohibvpcobkkpurhxkerggxghtfsuhccfsxfnakxyynenrvianuuvctplygtmmlojbtgwjiit
aznbomzeebmpzjwcpaajyflresfwwrkvxzmivsszxmkivzmppijcwqdpcllqvsiylfshhyhiugtviddg
tygoblyzzofoswjbovvwduqmzhunnmpkcuhxkjjubaocpnaffcnqakxdqbbkzgmsftgxxslwyanjwtta
ynljwanqqjkdxreqdmmrwtjzmgtiizijvhuwjeehuzhpcmzaapgptxkcpwwxevrnaivoonqldviylkkv
cbpdqobggdorblyercclahntguhyytmxzbokxuubzomkxborrkleysfrennsxukanhujjajkwivxkffi
vaiqdnabbqhquyldqxxyfwsobjwppormewjzmllwdcqerpchhepscmzfsddmbiouhvizzunyacplyvvc
apnlycpsslmfztgsfootyvlboivkkbklxjwylggjwbjreobccrirvzmeryyzgxtpckxqqpsnfxkanmmx
edrfsqdiifqtdnagteencjpviwjaavozbdqmzwwdbqomzdqttmngauhtgppuzwmcpjwllclmykxzmhhk
xcksfpcddsjswanfszzahyuqdlyrrqtogylbonnyfesgtrejjgrueobhuffodkqwjxkbbwpacernaxxe
crpnaeruunohbviuhqqvaxndqkxmmdmnzlyaniilydltgqdeetktxbogtaabizvremzssruphzmcpooz
gfthusfkkhsvfpcivggpelrxkylccxqbdfsobyyfdsqobfsvvopicwjvirrwbyoerlynnenoamzbojjm
zemuhreffuluycphubbcjawsfnattsvqiandqppahguivtgllitwgqdjwhhqfmsylzmddyrcegtpczzg
etrpcgtwwpqjdxkwjssxczpfsmzoofopbnacpkknafnvisfggvmvzdqivccdkbxtgobuutwrjboerqqb
ihvjwuhmmjuxhrekxiirgntzmaneezsdfhuqdaahfusqdhuxxqrkeylxkttydaqgtnappgpqcobdqllo
bgowjtghhwnwaerjwddelcyuhpcvvuxskcpfsrrcjiwkxvinnkvyisflyjjshouanboffategivrebbi
gvtreivyyrslfzmyluuzebrhuobqqhqrdpcermmpchpxkuhiixoxbfskxeefmdzviqdwwvytldqgtssd
kjxlywjoolwzjtgmzkktipvbocpggbufhjwsfccjhwusfjwzzstmganzmvvafcsivpcrrirseqdfsnnq
diqylvijjypycgtlyffgneawjrexxwzumerhuttelkymzxkppmxakuhnallujqwcpdqhhcvgikxtgddk
ixvtgkxaatunhboanwwbgdtjwqdssjstfregtoorejrzmwjkkzqzdhumzgghofbxksfyyxavnfsivuuf
mlznaylqqnyblviobmmvkrxdqeriidwhjlyuheeljywuhlybbuvoicpboxxcheukxrettktugsfhupps
fksanxkllaraeivnahhipgcyltgzzybwogtjwvvgnmaobzmrrozcmwjpcnnwlsyerfsjjexikmzviffm
kzxvimzccvwpjdqcpyydifvlysfuuluvhtgivqqtgltboylmmbsbfjwobiijqhdzmuhaazcxphukxwwh
onbpcansspadnxkqdooxmtzfsgtkkfyjlnawjggnlaywjnaddwxqkerdqzzejgwmztgvvmvwiuhjwrru
hmucpzmnnctcgkxpcjjkrieanvibbadyqivlyxxipocqdbottqbeoylreppynuagthullgzkmobxkhho
mbzxkobeexyrlfseraafkhxnauhwwnwxjvikxssvinvdqanoodudhlyqdkklsjfbowjccbezrjwmzyyj
qpdrecpuurcfpzmsfqqzovbhuivmmhalnpcyliipncaylpcffyzsmgtfsbbgliyobvixxoxykwjlyttw
jowerboppeveimzrellmtkgcpxkddcfaskxnazzkrqesfdqvvsdgqantgrrapwcivjwnnibmoqdzmjjq
odbzmqdggzatnhugtcchmjzpcwjyypyzlxkmzuuxkpxfscpqqfwfjnasfmmnulhdqyleedgbtlyobaal
srftgerwwtehrbouhssbqxdjwkxoojcnpreankkrpecanrehhabuoivhuddinkaqdxkzzqzamylnavvy
lqygtdqrrgxgkobtgnnovmierzmffehcumzpcbbmtsguhfsxxufiscpvittcryekxlyppkdoqsfbolls
qfdbosfiibcvpjwiveejolbreylaarabnzmobwwzmrzhuersshyhlpcuhoopwnjfsanggfidvnaqdccn
uthvigtyyvgjtdqwjuudszflymzqqleprtgcpmmtrgecptgjjcdwqkxjwffkpmcsfzmbbsbcoanpcxxa
nsaivfsttizimqdvippqxokgtbohhgjewobreddovuiwjhuzzwhkuerxkvvetagmznarrmfqsuhdqnnu
shfdquhkkdexrlykxgglqndtgancctcdpboqdyybotbjwgtuujajnrewjqqryplhucpiihkfxpcsfeep
wvjxkivaaxilvfsylwwfubhnaobssngrtvieroovtigervillefysmzlyhhmroeuhboddudeqcprezzc
puckxhuvvkbkosfxkrrszqmivdqjjilgyqdtgffqxwkyljwbbyjmwgtzmxxgvciobpcttohsuwjfsppw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: tigerville
Cipher: gvtreivyyr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: tigerville
Cipher: 44422251241542131351

Extended Methods:
Method #1

Plaintext: tigerville
method variations:
yomkwaoqqkdtrpbftvvpiywuglyaauodbzmqdffz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
t i g e r v i l l e 
4 4 2 5 2 1 4 1 1 5 
4 2 2 1 4 5 2 3 3 1 
They are then read out in rows:
44252141154221452331
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: tigerville
Cipher: twbdvibymc

Read more ...
Method #3

Plaintext: tigerville
method variations:
tgwfdubcxq gwfdubcxqt wfdubcxqtg
fdubcxqtgw dubcxqtgwf ubcxqtgwfd
bcxqtgwfdu cxqtgwfdub xqtgwfdubc
qtgwfdubcx

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: tigerville

first 5040 cipher variations(3628800 total)
tigerville tigervilel tigerville tigervilel tigerviell tigerviell tigervlile tigervliel tigervllie tigervllei tigervleli
tigervleil tigervllie tigervllei tigervlile tigervliel tigervleil tigervleli tigervelli tigervelil tigervelli tigervelil
tigerveill tigerveill tigerivlle tigerivlel tigerivlle tigerivlel tigerivell tigerivell tigerilvle tigerilvel tigerillve
tigerillev tigerilelv tigerilevl tigerillve tigerillev tigerilvle tigerilvel tigerilevl tigerilelv tigeriellv tigerielvl
tigeriellv tigerielvl tigerievll tigerievll tigerlivle tigerlivel tigerlilve tigerlilev tigerlielv tigerlievl tigerlvile
tigerlviel tigerlvlie tigerlvlei tigerlveli tigerlveil tigerllvie tigerllvei tigerllive tigerlliev tigerlleiv tigerllevi
tigerlevli tigerlevil tigerlelvi tigerleliv tigerleilv tigerleivl tigerlilve tigerlilev tigerlivle tigerlivel tigerlievl
tigerlielv tigerllive tigerlliev tigerllvie tigerllvei tigerllevi tigerlleiv tigerlvlie tigerlvlei tigerlvile tigerlviel
tigerlveil tigerlveli tigerlelvi tigerleliv tigerlevli tigerlevil tigerleivl tigerleilv tigereillv tigereilvl tigereillv
tigereilvl tigereivll tigereivll tigerelilv tigerelivl tigerelliv tigerellvi tigerelvli tigerelvil tigerelliv tigerellvi
tigerelilv tigerelivl tigerelvil tigerelvli tigerevlli tigerevlil tigerevlli tigerevlil tigerevill tigerevill tigevrille
tigevrilel tigevrille tigevrilel tigevriell tigevriell tigevrlile tigevrliel tigevrllie tigevrllei tigevrleli tigevrleil
tigevrllie tigevrllei tigevrlile tigevrliel tigevrleil tigevrleli tigevrelli tigevrelil tigevrelli tigevrelil tigevreill
tigevreill tigevirlle tigevirlel tigevirlle tigevirlel tigevirell tigevirell tigevilrle tigevilrel tigevillre tigeviller
tigevilelr tigevilerl tigevillre tigeviller tigevilrle tigevilrel tigevilerl tigevilelr tigeviellr tigevielrl tigeviellr
tigevielrl tigevierll tigevierll tigevlirle tigevlirel tigevlilre tigevliler tigevlielr tigevlierl tigevlrile tigevlriel
tigevlrlie tigevlrlei tigevlreli tigevlreil tigevllrie tigevllrei tigevllire tigevllier tigevlleir tigevlleri tigevlerli
tigevleril tigevlelri tigevlelir tigevleilr tigevleirl tigevlilre tigevliler tigevlirle tigevlirel tigevlierl tigevlielr
tigevllire tigevllier tigevllrie tigevllrei tigevlleri tigevlleir tigevlrlie tigevlrlei tigevlrile tigevlriel tigevlreil
tigevlreli tigevlelri tigevlelir tigevlerli tigevleril tigevleirl tigevleilr tigeveillr tigeveilrl tigeveillr tigeveilrl
tigeveirll tigeveirll tigevelilr tigevelirl tigevellir tigevellri tigevelrli tigevelril tigevellir tigevellri tigevelilr
tigevelirl tigevelril tigevelrli tigeverlli tigeverlil tigeverlli tigeverlil tigeverill tigeverill tigeivrlle tigeivrlel
tigeivrlle tigeivrlel tigeivrell tigeivrell tigeivlrle tigeivlrel tigeivllre tigeivller tigeivlelr tigeivlerl tigeivllre
tigeivller tigeivlrle tigeivlrel tigeivlerl tigeivlelr tigeivellr tigeivelrl tigeivellr tigeivelrl tigeiverll tigeiverll
tigeirvlle tigeirvlel tigeirvlle tigeirvlel tigeirvell tigeirvell tigeirlvle tigeirlvel tigeirllve tigeirllev tigeirlelv
tigeirlevl tigeirllve tigeirllev tigeirlvle tigeirlvel tigeirlevl tigeirlelv tigeirellv tigeirelvl tigeirellv tigeirelvl
tigeirevll tigeirevll tigeilrvle tigeilrvel tigeilrlve tigeilrlev tigeilrelv tigeilrevl tigeilvrle tigeilvrel tigeilvlre
tigeilvler tigeilvelr tigeilverl tigeillvre tigeillver tigeillrve tigeillrev tigeillerv tigeillevr tigeilevlr tigeilevrl
tigeilelvr tigeilelrv tigeilerlv tigeilervl tigeilrlve tigeilrlev tigeilrvle tigeilrvel tigeilrevl tigeilrelv tigeillrve
tigeillrev tigeillvre tigeillver tigeillevr tigeillerv tigeilvlre tigeilvler tigeilvrle tigeilvrel tigeilverl tigeilvelr
tigeilelvr tigeilelrv tigeilevlr tigeilevrl tigeilervl tigeilerlv tigeierllv tigeierlvl tigeierllv tigeierlvl tigeiervll
tigeiervll tigeielrlv tigeielrvl tigeiellrv tigeiellvr tigeielvlr tigeielvrl tigeiellrv tigeiellvr tigeielrlv tigeielrvl
tigeielvrl tigeielvlr tigeievllr tigeievlrl tigeievllr tigeievlrl tigeievrll tigeievrll tigelvirle tigelvirel tigelvilre
tigelviler tigelvielr tigelvierl tigelvrile tigelvriel tigelvrlie tigelvrlei tigelvreli tigelvreil tigelvlrie tigelvlrei
tigelvlire tigelvlier tigelvleir tigelvleri tigelverli tigelveril tigelvelri tigelvelir tigelveilr tigelveirl tigelivrle
tigelivrel tigelivlre tigelivler tigelivelr tigeliverl tigelirvle tigelirvel tigelirlve tigelirlev tigelirelv tigelirevl
tigelilrve tigelilrev tigelilvre tigelilver tigelilevr tigelilerv tigelierlv tigeliervl tigelielrv tigelielvr tigelievlr
tigelievrl tigelrivle tigelrivel tigelrilve tigelrilev tigelrielv tigelrievl tigelrvile tigelrviel tigelrvlie tigelrvlei
tigelrveli tigelrveil tigelrlvie tigelrlvei tigelrlive tigelrliev tigelrleiv tigelrlevi tigelrevli tigelrevil tigelrelvi
tigelreliv tigelreilv tigelreivl tigellirve tigellirev tigellivre tigelliver tigellievr tigellierv tigellrive tigellriev
tigellrvie tigellrvei tigellrevi tigellreiv tigellvrie tigellvrei tigellvire tigellvier tigellveir tigellveri tigellervi
tigelleriv tigellevri tigellevir tigelleivr tigelleirv tigeleirlv tigeleirvl tigeleilrv tigeleilvr tigeleivlr tigeleivrl
tigelerilv tigelerivl tigelerliv tigelerlvi tigelervli tigelervil tigelelriv tigelelrvi tigelelirv tigelelivr tigelelvir
tigelelvri tigelevrli tigelevril tigelevlri tigelevlir tigelevilr tigelevirl tigelvilre tigelviler tigelvirle tigelvirel
tigelvierl tigelvielr tigelvlire tigelvlier tigelvlrie tigelvlrei tigelvleri tigelvleir tigelvrlie tigelvrlei tigelvrile
tigelvriel tigelvreil tigelvreli tigelvelri tigelvelir tigelverli tigelveril tigelveirl tigelveilr tigelivlre tigelivler
tigelivrle tigelivrel tigeliverl tigelivelr tigelilvre tigelilver tigelilrve tigelilrev tigelilerv tigelilevr tigelirlve
tigelirlev tigelirvle tigelirvel tigelirevl tigelirelv tigelielrv tigelielvr tigelierlv tigeliervl tigelievrl tigelievlr
tigellivre tigelliver tigellirve tigellirev tigellierv tigellievr tigellvire tigellvier tigellvrie tigellvrei tigellveri
tigellveir tigellrvie tigellrvei tigellrive tigellriev tigellreiv tigellrevi tigellevri tigellevir tigellervi tigelleriv
tigelleirv tigelleivr tigelrilve tigelrilev tigelrivle tigelrivel tigelrievl tigelrielv tigelrlive tigelrliev tigelrlvie
tigelrlvei tigelrlevi tigelrleiv tigelrvlie tigelrvlei tigelrvile tigelrviel tigelrveil tigelrveli tigelrelvi tigelreliv
tigelrevli tigelrevil tigelreivl tigelreilv tigeleilrv tigeleilvr tigeleirlv tigeleirvl tigeleivrl tigeleivlr tigelelirv
tigelelivr tigelelriv tigelelrvi tigelelvri tigelelvir tigelerliv tigelerlvi tigelerilv tigelerivl tigelervil tigelervli
tigelevlri tigelevlir tigelevrli tigelevril tigelevirl tigelevilr tigeevillr tigeevilrl tigeevillr tigeevilrl tigeevirll
tigeevirll tigeevlilr tigeevlirl tigeevllir tigeevllri tigeevlrli tigeevlril tigeevllir tigeevllri tigeevlilr tigeevlirl
tigeevlril tigeevlrli tigeevrlli tigeevrlil tigeevrlli tigeevrlil tigeevrill tigeevrill tigeeivllr tigeeivlrl tigeeivllr
tigeeivlrl tigeeivrll tigeeivrll tigeeilvlr tigeeilvrl tigeeillvr tigeeillrv tigeeilrlv tigeeilrvl tigeeillvr tigeeillrv
tigeeilvlr tigeeilvrl tigeeilrvl tigeeilrlv tigeeirllv tigeeirlvl tigeeirllv tigeeirlvl tigeeirvll tigeeirvll tigeelivlr
tigeelivrl tigeelilvr tigeelilrv tigeelirlv tigeelirvl tigeelvilr tigeelvirl tigeelvlir tigeelvlri tigeelvrli tigeelvril
tigeellvir tigeellvri tigeellivr tigeellirv tigeellriv tigeellrvi tigeelrvli tigeelrvil tigeelrlvi tigeelrliv tigeelrilv
tigeelrivl tigeelilvr tigeelilrv tigeelivlr tigeelivrl tigeelirvl tigeelirlv tigeellivr tigeellirv tigeellvir tigeellvri
tigeellrvi tigeellriv tigeelvlir tigeelvlri tigeelvilr tigeelvirl tigeelvril tigeelvrli tigeelrlvi tigeelrliv tigeelrvli
tigeelrvil tigeelrivl tigeelrilv tigeerillv tigeerilvl tigeerillv tigeerilvl tigeerivll tigeerivll tigeerlilv tigeerlivl
tigeerlliv tigeerllvi tigeerlvli tigeerlvil tigeerlliv tigeerllvi tigeerlilv tigeerlivl tigeerlvil tigeerlvli tigeervlli
tigeervlil tigeervlli tigeervlil tigeervill tigeervill tigreville tigrevilel tigreville tigrevilel tigreviell tigreviell
tigrevlile tigrevliel tigrevllie tigrevllei tigrevleli tigrevleil tigrevllie tigrevllei tigrevlile tigrevliel tigrevleil
tigrevleli tigrevelli tigrevelil tigrevelli tigrevelil tigreveill tigreveill tigreivlle tigreivlel tigreivlle tigreivlel
tigreivell tigreivell tigreilvle tigreilvel tigreillve tigreillev tigreilelv tigreilevl tigreillve tigreillev tigreilvle
tigreilvel tigreilevl tigreilelv tigreiellv tigreielvl tigreiellv tigreielvl tigreievll tigreievll tigrelivle tigrelivel
tigrelilve tigrelilev tigrelielv tigrelievl tigrelvile tigrelviel tigrelvlie tigrelvlei tigrelveli tigrelveil tigrellvie
tigrellvei tigrellive tigrelliev tigrelleiv tigrellevi tigrelevli tigrelevil tigrelelvi tigreleliv tigreleilv tigreleivl
tigrelilve tigrelilev tigrelivle tigrelivel tigrelievl tigrelielv tigrellive tigrelliev tigrellvie tigrellvei tigrellevi
tigrelleiv tigrelvlie tigrelvlei tigrelvile tigrelviel tigrelveil tigrelveli tigrelelvi tigreleliv tigrelevli tigrelevil
tigreleivl tigreleilv tigreeillv tigreeilvl tigreeillv tigreeilvl tigreeivll tigreeivll tigreelilv tigreelivl tigreelliv
tigreellvi tigreelvli tigreelvil tigreelliv tigreellvi tigreelilv tigreelivl tigreelvil tigreelvli tigreevlli tigreevlil
tigreevlli tigreevlil tigreevill tigreevill tigrveille tigrveilel tigrveille tigrveilel tigrveiell tigrveiell tigrvelile
tigrveliel tigrvellie tigrvellei tigrveleli tigrveleil tigrvellie tigrvellei tigrvelile tigrveliel tigrveleil tigrveleli
tigrveelli tigrveelil tigrveelli tigrveelil tigrveeill tigrveeill tigrvielle tigrvielel tigrvielle tigrvielel tigrvieell
tigrvieell tigrvilele tigrvileel tigrvillee tigrvillee tigrvilele tigrvileel tigrvillee tigrvillee tigrvilele tigrvileel
tigrvileel tigrvilele tigrvielle tigrvielel tigrvielle tigrvielel tigrvieell tigrvieell tigrvliele tigrvlieel tigrvlilee
tigrvlilee tigrvliele tigrvlieel tigrvleile tigrvleiel tigrvlelie tigrvlelei tigrvleeli tigrvleeil tigrvlleie tigrvlleei
tigrvlliee tigrvlliee tigrvlleie tigrvlleei tigrvleeli tigrvleeil tigrvlelei tigrvlelie tigrvleile tigrvleiel tigrvlilee
tigrvlilee tigrvliele tigrvlieel tigrvlieel tigrvliele tigrvlliee tigrvlliee tigrvlleie tigrvlleei tigrvlleei tigrvlleie
tigrvlelie tigrvlelei tigrvleile tigrvleiel tigrvleeil tigrvleeli tigrvlelei tigrvlelie tigrvleeli tigrvleeil tigrvleiel
tigrvleile tigrveille tigrveilel tigrveille tigrveilel tigrveiell tigrveiell tigrvelile tigrveliel tigrvellie tigrvellei
tigrveleli tigrveleil tigrvellie tigrvellei tigrvelile tigrveliel tigrveleil tigrveleli tigrveelli tigrveelil tigrveelli
tigrveelil tigrveeill tigrveeill tigrivelle tigrivelel tigrivelle tigrivelel tigriveell tigriveell tigrivlele tigrivleel
tigrivllee tigrivllee tigrivlele tigrivleel tigrivllee tigrivllee tigrivlele tigrivleel tigrivleel tigrivlele tigrivelle
tigrivelel tigrivelle tigrivelel tigriveell tigriveell tigrievlle tigrievlel tigrievlle tigrievlel tigrievell tigrievell
tigrielvle tigrielvel tigriellve tigriellev tigrielelv tigrielevl tigriellve tigriellev tigrielvle tigrielvel tigrielevl
tigrielelv tigrieellv tigrieelvl tigrieellv tigrieelvl tigrieevll tigrieevll tigrilevle tigrilevel tigrilelve tigrilelev
tigrileelv tigrileevl tigrilvele tigrilveel tigrilvlee tigrilvlee tigrilvele tigrilveel tigrillvee tigrillvee tigrilleve
tigrilleev tigrilleev tigrilleve tigrilevle tigrilevel tigrilelve tigrilelev tigrileelv tigrileevl tigrilelve tigrilelev
tigrilevle tigrilevel tigrileevl tigrileelv tigrilleve tigrilleev tigrillvee tigrillvee tigrilleve tigrilleev tigrilvlee
tigrilvlee tigrilvele tigrilveel tigrilveel tigrilvele tigrilelve tigrilelev tigrilevle tigrilevel tigrileevl tigrileelv
tigrieellv tigrieelvl tigrieellv tigrieelvl tigrieevll tigrieevll tigrielelv tigrielevl tigriellev tigriellve tigrielvle
tigrielvel tigriellev tigriellve tigrielelv tigrielevl tigrielvel tigrielvle tigrievlle tigrievlel tigrievlle tigrievlel
tigrievell tigrievell tigrlviele tigrlvieel tigrlvilee tigrlvilee tigrlviele tigrlvieel tigrlveile tigrlveiel tigrlvelie
tigrlvelei tigrlveeli tigrlveeil tigrlvleie tigrlvleei tigrlvliee tigrlvliee tigrlvleie tigrlvleei tigrlveeli tigrlveeil
tigrlvelei tigrlvelie tigrlveile tigrlveiel tigrlivele tigrliveel tigrlivlee tigrlivlee tigrlivele tigrliveel tigrlievle
tigrlievel tigrlielve tigrlielev tigrlieelv tigrlieevl tigrlileve tigrlileev tigrlilvee tigrlilvee tigrlileve tigrlileev
tigrlieelv tigrlieevl tigrlielev tigrlielve tigrlievle tigrlievel tigrleivle tigrleivel tigrleilve tigrleilev tigrleielv
tigrleievl tigrlevile tigrleviel tigrlevlie tigrlevlei tigrleveli tigrleveil tigrlelvie tigrlelvei tigrlelive tigrleliev
tigrleleiv tigrlelevi tigrleevli tigrleevil tigrleelvi tigrleeliv tigrleeilv tigrleeivl tigrllieve tigrllieev tigrllivee
tigrllivee tigrllieve tigrllieev tigrlleive tigrlleiev tigrllevie tigrllevei tigrlleevi tigrlleeiv tigrllveie tigrllveei
tigrllviee tigrllviee tigrllveie tigrllveei tigrlleevi tigrlleeiv tigrllevei tigrllevie tigrlleive tigrlleiev tigrleielv
tigrleievl tigrleilev tigrleilve tigrleivle tigrleivel tigrleeilv tigrleeivl tigrleeliv tigrleelvi tigrleevli tigrleevil
tigrleleiv tigrlelevi tigrleliev tigrlelive tigrlelvie tigrlelvei tigrleveli tigrleveil tigrlevlei tigrlevlie tigrlevile
tigrleviel tigrlvilee tigrlvilee tigrlviele tigrlvieel tigrlvieel tigrlviele tigrlvliee tigrlvliee tigrlvleie tigrlvleei
tigrlvleei tigrlvleie tigrlvelie tigrlvelei tigrlveile tigrlveiel tigrlveeil tigrlveeli tigrlvelei tigrlvelie tigrlveeli
tigrlveeil tigrlveiel tigrlveile tigrlivlee tigrlivlee tigrlivele tigrliveel tigrliveel tigrlivele tigrlilvee tigrlilvee
tigrlileve tigrlileev tigrlileev tigrlileve tigrlielve tigrlielev tigrlievle tigrlievel tigrlieevl tigrlieelv tigrlielev
tigrlielve tigrlieelv tigrlieevl tigrlievel tigrlievle tigrllivee tigrllivee tigrllieve tigrllieev tigrllieev tigrllieve
tigrllviee tigrllviee tigrllveie tigrllveei tigrllveei tigrllveie tigrllevie tigrllevei tigrlleive tigrlleiev tigrlleeiv
tigrlleevi tigrllevei tigrllevie tigrlleevi tigrlleeiv tigrlleiev tigrlleive tigrleilve tigrleilev tigrleivle tigrleivel
tigrleievl tigrleielv tigrlelive tigrleliev tigrlelvie tigrlelvei tigrlelevi tigrleleiv tigrlevlie tigrlevlei tigrlevile
tigrleviel tigrleveil tigrleveli tigrleelvi tigrleeliv tigrleevli tigrleevil tigrleeivl tigrleeilv tigrleilev tigrleilve
tigrleielv tigrleievl tigrleivel tigrleivle tigrleliev tigrlelive tigrleleiv tigrlelevi tigrlelvei tigrlelvie tigrleeliv
tigrleelvi tigrleeilv tigrleeivl tigrleevil tigrleevli tigrlevlei tigrlevlie tigrleveli tigrleveil tigrleviel tigrlevile
tigreville tigrevilel tigreville tigrevilel tigreviell tigreviell tigrevlile tigrevliel tigrevllie tigrevllei tigrevleli
tigrevleil tigrevllie tigrevllei tigrevlile tigrevliel tigrevleil tigrevleli tigrevelli tigrevelil tigrevelli tigrevelil
tigreveill tigreveill tigreivlle tigreivlel tigreivlle tigreivlel tigreivell tigreivell tigreilvle tigreilvel tigreillve
tigreillev tigreilelv tigreilevl tigreillve tigreillev tigreilvle tigreilvel tigreilevl tigreilelv tigreiellv tigreielvl
tigreiellv tigreielvl tigreievll tigreievll tigrelivle tigrelivel tigrelilve tigrelilev tigrelielv tigrelievl tigrelvile
tigrelviel tigrelvlie tigrelvlei tigrelveli tigrelveil tigrellvie tigrellvei tigrellive tigrelliev tigrelleiv tigrellevi
tigrelevli tigrelevil tigrelelvi tigreleliv tigreleilv tigreleivl tigrelilve tigrelilev tigrelivle tigrelivel tigrelievl
tigrelielv tigrellive tigrelliev tigrellvie tigrellvei tigrellevi tigrelleiv tigrelvlie tigrelvlei tigrelvile tigrelviel
tigrelveil tigrelveli tigrelelvi tigreleliv tigrelevli tigrelevil tigreleivl tigreleilv tigreeillv tigreeilvl tigreeillv
tigreeilvl tigreeivll tigreeivll tigreelilv tigreelivl tigreelliv tigreellvi tigreelvli tigreelvil tigreelliv tigreellvi
tigreelilv tigreelivl tigreelvil tigreelvli tigreevlli tigreevlil tigreevlli tigreevlil tigreevill tigreevill tigvreille
tigvreilel tigvreille tigvreilel tigvreiell tigvreiell tigvrelile tigvreliel tigvrellie tigvrellei tigvreleli tigvreleil
tigvrellie tigvrellei tigvrelile tigvreliel tigvreleil tigvreleli tigvreelli tigvreelil tigvreelli tigvreelil tigvreeill
tigvreeill tigvrielle tigvrielel tigvrielle tigvrielel tigvrieell tigvrieell tigvrilele tigvrileel tigvrillee tigvrillee
tigvrilele tigvrileel tigvrillee tigvrillee tigvrilele tigvrileel tigvrileel tigvrilele tigvrielle tigvrielel tigvrielle
tigvrielel tigvrieell tigvrieell tigvrliele tigvrlieel tigvrlilee tigvrlilee tigvrliele tigvrlieel tigvrleile tigvrleiel
tigvrlelie tigvrlelei tigvrleeli tigvrleeil tigvrlleie tigvrlleei tigvrlliee tigvrlliee tigvrlleie tigvrlleei tigvrleeli
tigvrleeil tigvrlelei tigvrlelie tigvrleile tigvrleiel tigvrlilee tigvrlilee tigvrliele tigvrlieel tigvrlieel tigvrliele
tigvrlliee tigvrlliee tigvrlleie tigvrlleei tigvrlleei tigvrlleie tigvrlelie tigvrlelei tigvrleile tigvrleiel tigvrleeil
tigvrleeli tigvrlelei tigvrlelie tigvrleeli tigvrleeil tigvrleiel tigvrleile tigvreille tigvreilel tigvreille tigvreilel
tigvreiell tigvreiell tigvrelile tigvreliel tigvrellie tigvrellei tigvreleli tigvreleil tigvrellie tigvrellei tigvrelile
tigvreliel tigvreleil tigvreleli tigvreelli tigvreelil tigvreelli tigvreelil tigvreeill tigvreeill tigverille tigverilel
tigverille tigverilel tigveriell tigveriell tigverlile tigverliel tigverllie tigverllei tigverleli tigverleil tigverllie
tigverllei tigverlile tigverliel tigverleil tigverleli tigverelli tigverelil tigverelli tigverelil tigvereill tigvereill
tigveirlle tigveirlel tigveirlle tigveirlel tigveirell tigveirell tigveilrle tigveilrel tigveillre tigveiller tigveilelr
tigveilerl tigveillre tigveiller tigveilrle tigveilrel tigveilerl tigveilelr tigveiellr tigveielrl tigveiellr tigveielrl
tigveierll tigveierll tigvelirle tigvelirel tigvelilre tigveliler tigvelielr tigvelierl tigvelrile tigvelriel tigvelrlie
tigvelrlei tigvelreli tigvelreil tigvellrie tigvellrei tigvellire tigvellier tigvelleir tigvelleri tigvelerli tigveleril
tigvelelri tigvelelir tigveleilr tigveleirl tigvelilre tigveliler tigvelirle tigvelirel tigvelierl tigvelielr tigvellire
tigvellier tigvellrie tigvellrei tigvelleri tigvelleir tigvelrlie tigvelrlei tigvelrile tigvelriel tigvelreil tigvelreli
tigvelelri tigvelelir tigvelerli tigveleril tigveleirl tigveleilr tigveeillr tigveeilrl tigveeillr tigveeilrl tigveeirll
tigveeirll tigveelilr tigveelirl tigveellir tigveellri tigveelrli tigveelril tigveellir tigveellri tigveelilr tigveelirl
tigveelril tigveelrli tigveerlli tigveerlil tigveerlli tigveerlil tigveerill tigveerill tigvierlle tigvierlel tigvierlle
tigvierlel tigvierell tigvierell tigvielrle tigvielrel tigviellre tigvieller tigvielelr tigvielerl tigviellre tigvieller
tigvielrle tigvielrel tigvielerl tigvielelr tigvieellr tigvieelrl tigvieellr tigvieelrl tigvieerll tigvieerll tigvirelle
tigvirelel tigvirelle tigvirelel tigvireell tigvireell tigvirlele tigvirleel tigvirllee tigvirllee tigvirlele tigvirleel
tigvirllee tigvirllee tigvirlele tigvirleel tigvirleel tigvirlele tigvirelle tigvirelel tigvirelle tigvirelel tigvireell
tigvireell tigvilrele tigvilreel tigvilrlee tigvilrlee tigvilrele tigvilreel tigvilerle tigvilerel tigvilelre tigvileler
tigvileelr tigvileerl tigvillere tigvilleer tigvillree tigvillree tigvillere tigvilleer tigvileelr tigvileerl tigvileler
tigvilelre tigvilerle tigvilerel tigvilrlee tigvilrlee tigvilrele tigvilreel tigvilreel tigvilrele tigvillree tigvillree
tigvillere tigvilleer tigvilleer tigvillere tigvilelre tigvileler tigvilerle tigvilerel tigvileerl tigvileelr tigvileler
tigvilelre tigvileelr tigvileerl tigvilerel tigvilerle tigvierlle tigvierlel tigvierlle tigvierlel tigvierell tigvierell
tigvielrle tigvielrel tigviellre tigvieller tigvielelr tigvielerl tigviellre tigvieller tigvielrle tigvielrel tigvielerl
tigvielelr tigvieellr tigvieelrl tigvieellr tigvieelrl tigvieerll tigvieerll tigvleirle tigvleirel tigvleilre tigvleiler
tigvleielr tigvleierl tigvlerile tigvleriel tigvlerlie tigvlerlei tigvlereli tigvlereil tigvlelrie tigvlelrei tigvlelire
tigvlelier tigvleleir tigvleleri tigvleerli tigvleeril tigvleelri tigvleelir tigvleeilr tigvleeirl tigvlierle tigvlierel
tigvlielre tigvlieler tigvlieelr tigvlieerl tigvlirele tigvlireel tigvlirlee tigvlirlee tigvlirele tigvlireel tigvlilree
tigvlilree tigvlilere tigvlileer tigvlileer tigvlilere tigvlierle tigvlierel tigvlielre tigvlieler tigvlieelr tigvlieerl
tigvlriele tigvlrieel tigvlrilee tigvlrilee tigvlriele tigvlrieel tigvlreile tigvlreiel tigvlrelie tigvlrelei tigvlreeli
tigvlreeil tigvlrleie tigvlrleei tigvlrliee tigvlrliee tigvlrleie tigvlrleei tigvlreeli tigvlreeil tigvlrelei tigvlrelie
tigvlreile tigvlreiel tigvlliree tigvlliree tigvlliere tigvllieer tigvllieer tigvlliere tigvllriee tigvllriee tigvllreie
tigvllreei tigvllreei tigvllreie tigvllerie tigvllerei tigvlleire tigvlleier tigvlleeir tigvlleeri tigvllerei tigvllerie
tigvlleeri tigvlleeir tigvlleier tigvlleire tigvleirle tigvleirel tigvleilre tigvleiler tigvleielr tigvleierl tigvlerile
tigvleriel tigvlerlie tigvlerlei tigvlereli tigvlereil tigvlelrie tigvlelrei tigvlelire tigvlelier tigvleleir tigvleleri
tigvleerli tigvleeril tigvleelri tigvleelir tigvleeilr tigvleeirl tigvleilre tigvleiler tigvleirle tigvleirel tigvleierl
tigvleielr tigvlelire tigvlelier tigvlelrie tigvlelrei tigvleleri tigvleleir tigvlerlie tigvlerlei tigvlerile tigvleriel
tigvlereil tigvlereli tigvleelri tigvleelir tigvleerli tigvleeril tigvleeirl tigvleeilr tigvlielre tigvlieler tigvlierle
tigvlierel tigvlieerl tigvlieelr tigvlilere tigvlileer tigvlilree tigvlilree tigvlilere tigvlileer tigvlirlee tigvlirlee
tigvlirele tigvlireel tigvlireel tigvlirele tigvlielre tigvlieler tigvlierle tigvlierel tigvlieerl tigvlieelr tigvlliere
tigvllieer tigvlliree tigvlliree tigvlliere tigvllieer tigvlleire tigvlleier tigvllerie tigvllerei tigvlleeri tigvlleeir
tigvllreie tigvllreei tigvllriee tigvllriee tigvllreie tigvllreei tigvlleeri tigvlleeir tigvllerei tigvllerie tigvlleire
tigvlleier tigvlrilee tigvlrilee tigvlriele tigvlrieel tigvlrieel tigvlriele tigvlrliee tigvlrliee tigvlrleie tigvlrleei
tigvlrleei tigvlrleie tigvlrelie tigvlrelei tigvlreile tigvlreiel tigvlreeil tigvlreeli tigvlrelei tigvlrelie tigvlreeli
tigvlreeil tigvlreiel tigvlreile tigvleilre tigvleiler tigvleirle tigvleirel tigvleierl tigvleielr tigvlelire tigvlelier
tigvlelrie tigvlelrei tigvleleri tigvleleir tigvlerlie tigvlerlei tigvlerile tigvleriel tigvlereil tigvlereli tigvleelri
tigvleelir tigvleerli tigvleeril tigvleeirl tigvleeilr tigveeillr tigveeilrl tigveeillr tigveeilrl tigveeirll tigveeirll
tigveelilr tigveelirl tigveellir tigveellri tigveelrli tigveelril tigveellir tigveellri tigveelilr tigveelirl tigveelril
tigveelrli tigveerlli tigveerlil tigveerlli tigveerlil tigveerill tigveerill tigveiellr tigveielrl tigveiellr tigveielrl
tigveierll tigveierll tigveilelr tigveilerl tigveiller tigveillre tigveilrle tigveilrel tigveiller tigveillre tigveilelr
tigveilerl tigveilrel tigveilrle tigveirlle tigveirlel tigveirlle tigveirlel tigveirell tigveirell tigvelielr tigvelierl
tigveliler tigvelilre tigvelirle tigvelirel tigveleilr tigveleirl tigvelelir tigvelelri tigvelerli tigveleril tigvelleir
tigvelleri tigvellier tigvellire tigvellrie tigvellrei tigvelreli tigvelreil tigvelrlei tigvelrlie tigvelrile tigvelriel
tigveliler tigvelilre tigvelielr tigvelierl tigvelirel tigvelirle tigvellier tigvellire tigvelleir tigvelleri tigvellrei
tigvellrie tigvelelir tigvelelri tigveleilr tigveleirl tigveleril tigvelerli tigvelrlei tigvelrlie tigvelreli tigvelreil
tigvelriel tigvelrile tigverille tigverilel tigverille tigverilel tigveriell tigveriell tigverlile tigverliel tigverllie
tigverllei tigverleli tigverleil tigverllie tigverllei tigverlile tigverliel tigverleil tigverleli tigverelli tigverelil
tigverelli tigverelil tigvereill tigvereill tigirvelle tigirvelel tigirvelle tigirvelel tigirveell tigirveell tigirvlele
tigirvleel tigirvllee tigirvllee tigirvlele tigirvleel tigirvllee tigirvllee tigirvlele tigirvleel tigirvleel tigirvlele
tigirvelle tigirvelel tigirvelle tigirvelel tigirveell tigirveell tigirevlle tigirevlel tigirevlle tigirevlel tigirevell
tigirevell tigirelvle tigirelvel tigirellve tigirellev tigirelelv tigirelevl tigirellve tigirellev tigirelvle tigirelvel
tigirelevl tigirelelv tigireellv tigireelvl tigireellv tigireelvl tigireevll tigireevll tigirlevle tigirlevel tigirlelve
tigirlelev tigirleelv tigirleevl tigirlvele tigirlveel tigirlvlee tigirlvlee tigirlvele tigirlveel tigirllvee tigirllvee
tigirlleve tigirlleev tigirlleev tigirlleve tigirlevle tigirlevel tigirlelve tigirlelev tigirleelv tigirleevl tigirlelve
tigirlelev tigirlevle tigirlevel tigirleevl tigirleelv tigirlleve tigirlleev tigirllvee tigirllvee tigirlleve tigirlleev
tigirlvlee tigirlvlee tigirlvele tigirlveel tigirlveel tigirlvele tigirlelve tigirlelev tigirlevle tigirlevel tigirleevl
tigirleelv tigireellv tigireelvl tigireellv tigireelvl tigireevll tigireevll tigirelelv tigirelevl tigirellev tigirellve
tigirelvle tigirelvel tigirellev tigirellve tigirelelv tigirelevl tigirelvel tigirelvle tigirevlle tigirevlel tigirevlle
tigirevlel tigirevell tigirevell tigivrelle tigivrelel tigivrelle tigivrelel tigivreell tigivreell tigivrlele tigivrleel
tigivrllee tigivrllee tigivrlele tigivrleel tigivrllee tigivrllee tigivrlele tigivrleel tigivrleel tigivrlele tigivrelle
tigivrelel tigivrelle tigivrelel tigivreell tigivreell tigiverlle tigiverlel tigiverlle tigiverlel tigiverell tigiverell
tigivelrle tigivelrel tigivellre tigiveller tigivelelr tigivelerl tigivellre tigiveller tigivelrle tigivelrel tigivelerl
tigivelelr tigiveellr tigiveelrl tigiveellr tigiveelrl tigiveerll tigiveerll tigivlerle tigivlerel tigivlelre tigivleler
tigivleelr tigivleerl tigivlrele tigivlreel tigivlrlee tigivlrlee tigivlrele tigivlreel tigivllree tigivllree tigivllere
tigivlleer tigivlleer tigivllere tigivlerle tigivlerel tigivlelre tigivleler tigivleelr tigivleerl tigivlelre tigivleler
tigivlerle tigivlerel tigivleerl tigivleelr tigivllere tigivlleer tigivllree tigivllree tigivllere tigivlleer tigivlrlee
tigivlrlee tigivlrele tigivlreel tigivlreel tigivlrele tigivlelre tigivleler tigivlerle tigivlerel tigivleerl tigivleelr
tigiveellr tigiveelrl tigiveellr tigiveelrl tigiveerll tigiveerll tigivelelr tigivelerl tigiveller tigivellre tigivelrle
tigivelrel tigiveller tigivellre tigivelelr tigivelerl tigivelrel tigivelrle tigiverlle tigiverlel tigiverlle tigiverlel
tigiverell tigiverell tigievrlle tigievrlel tigievrlle tigievrlel tigievrell tigievrell tigievlrle tigievlrel tigievllre
tigievller tigievlelr tigievlerl tigievllre tigievller tigievlrle tigievlrel tigievlerl tigievlelr tigievellr tigievelrl
tigievellr tigievelrl tigieverll tigieverll tigiervlle tigiervlel tigiervlle tigiervlel tigiervell tigiervell tigierlvle
tigierlvel tigierllve tigierllev tigierlelv tigierlevl tigierllve tigierllev tigierlvle tigierlvel tigierlevl tigierlelv
tigierellv tigierelvl tigierellv tigierelvl tigierevll tigierevll tigielrvle tigielrvel tigielrlve tigielrlev tigielrelv
tigielrevl tigielvrle tigielvrel tigielvlre tigielvler tigielvelr tigielverl tigiellvre tigiellver tigiellrve tigiellrev
tigiellerv tigiellevr tigielevlr tigielevrl tigielelvr tigielelrv tigielerlv tigielervl tigielrlve tigielrlev tigielrvle
tigielrvel tigielrevl tigielrelv tigiellrve tigiellrev tigiellvre tigiellver tigiellevr tigiellerv tigielvlre tigielvler
tigielvrle tigielvrel tigielverl tigielvelr tigielelvr tigielelrv tigielevlr tigielevrl tigielervl tigielerlv tigieerllv
tigieerlvl tigieerllv tigieerlvl tigieervll tigieervll tigieelrlv tigieelrvl tigieellrv tigieellvr tigieelvlr tigieelvrl
tigieellrv tigieellvr tigieelrlv tigieelrvl tigieelvrl tigieelvlr tigieevllr tigieevlrl tigieevllr tigieevlrl tigieevrll
tigieevrll tigilverle tigilverel tigilvelre tigilveler tigilveelr tigilveerl tigilvrele tigilvreel tigilvrlee tigilvrlee
tigilvrele tigilvreel tigilvlree tigilvlree tigilvlere tigilvleer tigilvleer tigilvlere tigilverle tigilverel tigilvelre
tigilveler tigilveelr tigilveerl tigilevrle tigilevrel tigilevlre tigilevler tigilevelr tigileverl tigilervle tigilervel
tigilerlve tigilerlev tigilerelv tigilerevl tigilelrve tigilelrev tigilelvre tigilelver tigilelevr tigilelerv tigileerlv
tigileervl tigileelrv tigileelvr tigileevlr tigileevrl tigilrevle tigilrevel tigilrelve tigilrelev tigilreelv tigilreevl
tigilrvele tigilrveel tigilrvlee tigilrvlee tigilrvele tigilrveel tigilrlvee tigilrlvee tigilrleve tigilrleev tigilrleev
tigilrleve tigilrevle tigilrevel tigilrelve tigilrelev tigilreelv tigilreevl tigillerve tigillerev tigillevre tigillever
tigilleevr tigilleerv tigillreve tigillreev tigillrvee tigillrvee tigillreve tigillreev tigillvree tigillvree tigillvere
tigillveer tigillveer tigillvere tigillerve tigillerev tigillevre tigillever tigilleevr tigilleerv tigileerlv tigileervl
tigileelrv tigileelvr tigileevlr tigileevrl tigilerelv tigilerevl tigilerlev tigilerlve tigilervle tigilervel tigilelrev
tigilelrve tigilelerv tigilelevr tigilelver tigilelvre tigilevrle tigilevrel tigilevlre tigilevler tigilevelr tigileverl
tigilvelre tigilveler tigilverle tigilverel tigilveerl tigilveelr tigilvlere tigilvleer tigilvlree tigilvlree tigilvlere
tigilvleer tigilvrlee tigilvrlee tigilvrele tigilvreel tigilvreel tigilvrele tigilvelre tigilveler tigilverle tigilverel
tigilveerl tigilveelr tigilevlre tigilevler tigilevrle tigilevrel tigileverl tigilevelr tigilelvre tigilelver tigilelrve
tigilelrev tigilelerv tigilelevr tigilerlve tigilerlev tigilervle tigilervel tigilerevl tigilerelv tigileelrv tigileelvr
tigileerlv tigileervl tigileevrl tigileevlr tigillevre tigillever tigillerve tigillerev tigilleerv tigilleevr tigillvere
tigillveer tigillvree tigillvree tigillvere tigillveer tigillrvee tigillrvee tigillreve tigillreev tigillreev tigillreve
tigillevre tigillever tigillerve tigillerev tigilleerv tigilleevr tigilrelve tigilrelev tigilrevle tigilrevel tigilreevl
tigilreelv tigilrleve tigilrleev tigilrlvee tigilrlvee tigilrleve tigilrleev tigilrvlee tigilrvlee tigilrvele tigilrveel
tigilrveel tigilrvele tigilrelve tigilrelev tigilrevle tigilrevel tigilreevl tigilreelv tigileelrv tigileelvr tigileerlv
tigileervl tigileevrl tigileevlr tigilelerv tigilelevr tigilelrev tigilelrve tigilelvre tigilelver tigilerlev tigilerlve
tigilerelv tigilerevl tigilervel tigilervle tigilevlre tigilevler tigilevrle tigilevrel tigileverl tigilevelr tigievellr
tigievelrl tigievellr tigievelrl tigieverll tigieverll tigievlelr tigievlerl tigievller tigievllre tigievlrle tigievlrel
tigievller tigievllre tigievlelr tigievlerl tigievlrel tigievlrle tigievrlle tigievrlel tigievrlle tigievrlel tigievrell
tigievrell tigieevllr tigieevlrl tigieevllr tigieevlrl tigieevrll tigieevrll tigieelvlr tigieelvrl tigieellvr tigieellrv
tigieelrlv tigieelrvl tigieellvr tigieellrv tigieelvlr tigieelvrl tigieelrvl tigieelrlv tigieerllv tigieerlvl tigieerllv
tigieerlvl tigieervll tigieervll tigielevlr tigielevrl tigielelvr tigielelrv tigielerlv tigielervl tigielvelr tigielverl
tigielvler tigielvlre tigielvrle tigielvrel tigiellver tigiellvre tigiellevr tigiellerv tigiellrev tigiellrve tigielrvle
tigielrvel tigielrlve tigielrlev tigielrelv tigielrevl tigielelvr tigielelrv tigielevlr tigielevrl tigielervl tigielerlv
tigiellevr tigiellerv tigiellver tigiellvre tigiellrve tigiellrev tigielvler tigielvlre tigielvelr tigielverl tigielvrel
tigielvrle tigielrlve tigielrlev tigielrvle tigielrvel tigielrevl tigielrelv tigierellv tigierelvl tigierellv tigierelvl
tigierevll tigierevll tigierlelv tigierlevl tigierllev tigierllve tigierlvle tigierlvel tigierllev tigierllve tigierlelv
tigierlevl tigierlvel tigierlvle tigiervlle tigiervlel tigiervlle tigiervlel tigiervell tigiervell tiglrviele tiglrvieel
tiglrvilee tiglrvilee tiglrviele tiglrvieel tiglrveile tiglrveiel tiglrvelie tiglrvelei tiglrveeli tiglrveeil tiglrvleie
tiglrvleei tiglrvliee tiglrvliee tiglrvleie tiglrvleei tiglrveeli tiglrveeil tiglrvelei tiglrvelie tiglrveile tiglrveiel
tiglrivele tiglriveel tiglrivlee tiglrivlee tiglrivele tiglriveel tiglrievle tiglrievel tiglrielve tiglrielev tiglrieelv
tiglrieevl tiglrileve tiglrileev tiglrilvee tiglrilvee tiglrileve tiglrileev tiglrieelv tiglrieevl tiglrielev tiglrielve
tiglrievle tiglrievel tiglreivle tiglreivel tiglreilve tiglreilev tiglreielv tiglreievl tiglrevile tiglreviel tiglrevlie
tiglrevlei tiglreveli tiglreveil tiglrelvie tiglrelvei tiglrelive tiglreliev tiglreleiv tiglrelevi tiglreevli tiglreevil
tiglreelvi tiglreeliv tiglreeilv tiglreeivl tiglrlieve tiglrlieev tiglrlivee tiglrlivee tiglrlieve tiglrlieev tiglrleive
tiglrleiev tiglrlevie tiglrlevei tiglrleevi tiglrleeiv tiglrlveie tiglrlveei tiglrlviee tiglrlviee tiglrlveie tiglrlveei
tiglrleevi tiglrleeiv tiglrlevei tiglrlevie tiglrleive tiglrleiev tiglreielv tiglreievl tiglreilev tiglreilve tiglreivle
tiglreivel tiglreeilv tiglreeivl tiglreeliv tiglreelvi tiglreevli tiglreevil tiglreleiv tiglrelevi tiglreliev tiglrelive
tiglrelvie tiglrelvei tiglreveli tiglreveil tiglrevlei tiglrevlie tiglrevile tiglreviel tiglvriele tiglvrieel tiglvrilee
tiglvrilee tiglvriele tiglvrieel tiglvreile tiglvreiel tiglvrelie tiglvrelei tiglvreeli tiglvreeil tiglvrleie tiglvrleei
tiglvrliee tiglvrliee tiglvrleie tiglvrleei tiglvreeli tiglvreeil tiglvrelei tiglvrelie tiglvreile tiglvreiel tiglvirele
tiglvireel tiglvirlee tiglvirlee tiglvirele tiglvireel tiglvierle tiglvierel tiglvielre tiglvieler tiglvieelr tiglvieerl
tiglvilere tiglvileer tiglvilree tiglvilree tiglvilere tiglvileer tiglvieelr tiglvieerl tiglvieler tiglvielre tiglvierle
tiglvierel tiglveirle tiglveirel tiglveilre tiglveiler tiglveielr tiglveierl tiglverile tiglveriel tiglverlie tiglverlei
tiglvereli tiglvereil tiglvelrie tiglvelrei tiglvelire tiglvelier tiglveleir tiglveleri tiglveerli tiglveeril tiglveelri
tiglveelir tiglveeilr tiglveeirl tiglvliere tiglvlieer tiglvliree tiglvliree tiglvliere tiglvlieer tiglvleire tiglvleier
tiglvlerie tiglvlerei tiglvleeri tiglvleeir tiglvlreie tiglvlreei tiglvlriee tiglvlriee tiglvlreie tiglvlreei tiglvleeri
tiglvleeir tiglvlerei tiglvlerie tiglvleire tiglvleier tiglveielr tiglveierl tiglveiler tiglveilre tiglveirle tiglveirel
tiglveeilr tiglveeirl tiglveelir tiglveelri tiglveerli tiglveeril tiglveleir tiglveleri tiglvelier tiglvelire tiglvelrie
tiglvelrei tiglvereli tiglvereil tiglverlei tiglverlie tiglverile tiglveriel tiglivrele tiglivreel tiglivrlee tiglivrlee
tiglivrele tiglivreel tigliverle tigliverel tiglivelre tigliveler tigliveelr tigliveerl tiglivlere tiglivleer tiglivlree
tiglivlree tiglivlere tiglivleer tigliveelr tigliveerl tigliveler tiglivelre tigliverle tigliverel tiglirvele tiglirveel
tiglirvlee tiglirvlee tiglirvele tiglirveel tiglirevle tiglirevel tiglirelve tiglirelev tiglireelv tiglireevl tiglirleve
tiglirleev tiglirlvee tiglirlvee tiglirleve tiglirleev tiglireelv tiglireevl tiglirelev tiglirelve tiglirevle tiglirevel
tigliervle tigliervel tiglierlve tiglierlev tiglierelv tiglierevl tiglievrle tiglievrel tiglievlre tiglievler tiglievelr
tiglieverl tiglielvre tiglielver tiglielrve tiglielrev tiglielerv tiglielevr tiglieevlr tiglieevrl tiglieelvr tiglieelrv
tiglieerlv tiglieervl tiglilreve tiglilreev tiglilrvee tiglilrvee tiglilreve tiglilreev tiglilerve tiglilerev tiglilevre
tiglilever tiglileevr tiglileerv tiglilvere tiglilveer tiglilvree tiglilvree tiglilvere tiglilveer tiglileevr tiglileerv
tiglilever tiglilevre tiglilerve tiglilerev tiglierelv tiglierevl tiglierlev tiglierlve tigliervle tigliervel tiglieerlv
tiglieervl tiglieelrv tiglieelvr tiglieevlr tiglieevrl tiglielerv tiglielevr tiglielrev tiglielrve tiglielvre tiglielver
tiglievelr tiglieverl tiglievler tiglievlre tiglievrle tiglievrel tiglevirle tiglevirel tiglevilre tigleviler tiglevielr
tiglevierl tiglevrile tiglevriel tiglevrlie tiglevrlei tiglevreli tiglevreil tiglevlrie tiglevlrei tiglevlire tiglevlier
tiglevleir tiglevleri tigleverli tigleveril tiglevelri tiglevelir tigleveilr tigleveirl tigleivrle tigleivrel tigleivlre
tigleivler tigleivelr tigleiverl tigleirvle tigleirvel tigleirlve tigleirlev tigleirelv tigleirevl tigleilrve tigleilrev
tigleilvre tigleilver tigleilevr tigleilerv tigleierlv tigleiervl tigleielrv tigleielvr tigleievlr tigleievrl tiglerivle
tiglerivel tiglerilve tiglerilev tiglerielv tiglerievl tiglervile tiglerviel tiglervlie tiglervlei tiglerveli tiglerveil
tiglerlvie tiglerlvei tiglerlive tiglerliev tiglerleiv tiglerlevi tiglerevli tiglerevil tiglerelvi tiglereliv tiglereilv
tiglereivl tiglelirve tiglelirev tiglelivre tigleliver tiglelievr tiglelierv tiglelrive tiglelriev tiglelrvie tiglelrvei
tiglelrevi tiglelreiv tiglelvrie tiglelvrei tiglelvire tiglelvier tiglelveir tiglelveri tiglelervi tigleleriv tiglelevri
tiglelevir tigleleivr tigleleirv tigleeirlv tigleeirvl tigleeilrv tigleeilvr tigleeivlr tigleeivrl tigleerilv tigleerivl
tigleerliv tigleerlvi tigleervli tigleervil tigleelriv tigleelrvi tigleelirv tigleelivr tigleelvir tigleelvri tigleevrli
tigleevril tigleevlri tigleevlir tigleevilr tigleevirl tigllviere tigllvieer tigllviree tigllviree tigllviere tigllvieer
tigllveire tigllveier tigllverie tigllverei tigllveeri tigllveeir tigllvreie tigllvreei tigllvriee tigllvriee tigllvreie
tigllvreei tigllveeri tigllveeir tigllverei tigllverie tigllveire tigllveier tigllivere tiglliveer tigllivree tigllivree
tigllivere tiglliveer tigllievre tiglliever tigllierve tigllierev tigllieerv tigllieevr tigllireve tigllireev tigllirvee
tigllirvee tigllireve tigllireev tigllieerv tigllieevr tigllierev tigllierve tigllievre tiglliever tiglleivre tiglleiver
tiglleirve tiglleirev tiglleierv tiglleievr tigllevire tigllevier tigllevrie tigllevrei tiglleveri tiglleveir tigllervie
tigllervei tigllerive tiglleriev tigllereiv tigllerevi tiglleevri tiglleevir tiglleervi tiglleeriv tiglleeirv tiglleeivr
tigllrieve tigllrieev tigllrivee tigllrivee tigllrieve tigllrieev tigllreive tigllreiev tigllrevie tigllrevei tigllreevi
tigllreeiv tigllrveie tigllrveei tigllrviee tigllrviee tigllrveie tigllrveei tigllreevi tigllreeiv tigllrevei tigllrevie
tigllreive tigllreiev tiglleierv tiglleievr tiglleirev tiglleirve tiglleivre tiglleiver tiglleeirv tiglleeivr tiglleeriv
tiglleervi tiglleevri tiglleevir tigllereiv tigllerevi tiglleriev tigllerive tigllervie tigllervei tiglleveri tiglleveir
tigllevrei tigllevrie tigllevire tigllevier tiglevielr tiglevierl tigleviler tiglevilre tiglevirle tiglevirel tigleveilr
tigleveirl tiglevelir tiglevelri tigleverli tigleveril tiglevleir tiglevleri tiglevlier tiglevlire tiglevlrie tiglevlrei
tiglevreli tiglevreil tiglevrlei tiglevrlie tiglevrile tiglevriel tigleivelr tigleiverl tigleivler tigleivlre tigleivrle
tigleivrel tigleievlr tigleievrl tigleielvr tigleielrv tigleierlv tigleiervl tigleilevr tigleilerv tigleilver tigleilvre
tigleilrve tigleilrev tigleirelv tigleirevl tigleirlev tigleirlve tigleirvle tigleirvel tigleeivlr tigleeivrl tigleeilvr
tigleeilrv tigleeirlv tigleeirvl tigleevilr tigleevirl tigleevlir tigleevlri tigleevrli tigleevril tigleelvir tigleelvri
tigleelivr tigleelirv tigleelriv tigleelrvi tigleervli tigleervil tigleerlvi tigleerliv tigleerilv tigleerivl tiglelievr
tiglelierv tigleliver tiglelivre tiglelirve tiglelirev tigleleivr tigleleirv tiglelevir tiglelevri tiglelervi tigleleriv
tiglelveir tiglelveri tiglelvier tiglelvire tiglelvrie tiglelvrei tiglelrevi tiglelreiv tiglelrvei tiglelrvie tiglelrive
tiglelriev tiglerielv tiglerievl tiglerilev tiglerilve tiglerivle tiglerivel tiglereilv tiglereivl tiglereliv tiglerelvi
tiglerevli tiglerevil tiglerleiv tiglerlevi tiglerliev tiglerlive tiglerlvie tiglerlvei tiglerveli tiglerveil tiglervlei
tiglervlie tiglervile tiglerviel tiglrvilee tiglrvilee tiglrviele tiglrvieel tiglrvieel tiglrviele tiglrvliee tiglrvliee
tiglrvleie tiglrvleei tiglrvleei tiglrvleie tiglrvelie tiglrvelei tiglrveile tiglrveiel tiglrveeil tiglrveeli tiglrvelei
tiglrvelie tiglrveeli tiglrveeil tiglrveiel tiglrveile tiglrivlee tiglrivlee tiglrivele tiglriveel tiglriveel tiglrivele
tiglrilvee tiglrilvee tiglrileve tiglrileev tiglrileev tiglrileve tiglrielve tiglrielev tiglrievle tiglrievel tiglrieevl
tiglrieelv tiglrielev tiglrielve tiglrieelv tiglrieevl tiglrievel tiglrievle tiglrlivee tiglrlivee tiglrlieve tiglrlieev
tiglrlieev tiglrlieve tiglrlviee tiglrlviee tiglrlveie tiglrlveei tiglrlveei tiglrlveie tiglrlevie tiglrlevei tiglrleive
tiglrleiev tiglrleeiv tiglrleevi tiglrlevei tiglrlevie tiglrleevi tiglrleeiv tiglrleiev tiglrleive tiglreilve tiglreilev
tiglreivle tiglreivel tiglreievl tiglreielv tiglrelive tiglreliev tiglrelvie tiglrelvei tiglrelevi tiglreleiv tiglrevlie
tiglrevlei tiglrevile tiglreviel tiglreveil tiglreveli tiglreelvi tiglreeliv tiglreevli tiglreevil tiglreeivl tiglreeilv
tiglreilev tiglreilve tiglreielv tiglreievl tiglreivel tiglreivle tiglreliev tiglrelive tiglreleiv tiglrelevi tiglrelvei
tiglrelvie tiglreeliv tiglreelvi tiglreeilv tiglreeivl tiglreevil tiglreevli tiglrevlei tiglrevlie tiglreveli tiglreveil
tiglreviel tiglrevile tiglvrilee tiglvrilee tiglvriele tiglvrieel tiglvrieel tiglvriele tiglvrliee tiglvrliee tiglvrleie
tiglvrleei tiglvrleei tiglvrleie tiglvrelie tiglvrelei tiglvreile tiglvreiel tiglvreeil tiglvreeli tiglvrelei tiglvrelie
tiglvreeli tiglvreeil tiglvreiel tiglvreile tiglvirlee tiglvirlee tiglvirele tiglvireel tiglvireel tiglvirele tiglvilree
tiglvilree tiglvilere tiglvileer tiglvileer tiglvilere tiglvielre tiglvieler tiglvierle tiglvierel tiglvieerl tiglvieelr
tiglvieler tiglvielre tiglvieelr tiglvieerl tiglvierel tiglvierle tiglvliree tiglvliree tiglvliere tiglvlieer tiglvlieer
tiglvliere tiglvlriee tiglvlriee tiglvlreie tiglvlreei tiglvlreei tiglvlreie tiglvlerie tiglvlerei tiglvleire tiglvleier
tiglvleeir tiglvleeri tiglvlerei tiglvlerie tiglvleeri tiglvleeir tiglvleier tiglvleire tiglveilre tiglveiler tiglveirle
tiglveirel tiglveierl tiglveielr tiglvelire tiglvelier tiglvelrie tiglvelrei tiglveleri tiglveleir tiglverlie tiglverlei
tiglverile tiglveriel tiglvereil tiglvereli tiglveelri tiglveelir tiglveerli tiglveeril tiglveeirl tiglveeilr tiglveiler
tiglveilre tiglveielr tiglveierl tiglveirel tiglveirle tiglvelier tiglvelire tiglveleir tiglveleri tiglvelrei tiglvelrie
tiglveelir tiglveelri tiglveeilr tiglveeirl tiglveeril tiglveerli tiglverlei tiglverlie tiglvereli tiglvereil tiglveriel
tiglverile tiglivrlee tiglivrlee tiglivrele tiglivreel tiglivreel tiglivrele tiglivlree tiglivlree tiglivlere tiglivleer
tiglivleer tiglivlere tiglivelre tigliveler tigliverle tigliverel tigliveerl tigliveelr tigliveler tiglivelre tigliveelr
tigliveerl tigliverel tigliverle tiglirvlee tiglirvlee tiglirvele tiglirveel tiglirveel tiglirvele tiglirlvee tiglirlvee
tiglirleve tiglirleev tiglirleev tiglirleve tiglirelve tiglirelev tiglirevle tiglirevel tiglireevl tiglireelv tiglirelev
tiglirelve tiglireelv tiglireevl tiglirevel tiglirevle tiglilrvee tiglilrvee tiglilreve tiglilreev tiglilreev tiglilreve
tiglilvree tiglilvree tiglilvere tiglilveer tiglilveer tiglilvere tiglilevre tiglilever tiglilerve tiglilerev tiglileerv
tiglileevr tiglilever tiglilevre tiglileevr tiglileerv tiglilerev tiglilerve tiglierlve tiglierlev tigliervle tigliervel
tiglierevl tiglierelv tiglielrve tiglielrev tiglielvre tiglielver tiglielevr tiglielerv tiglievlre tiglievler tiglievrle
tiglievrel tiglieverl tiglievelr tiglieelvr tiglieelrv tiglieevlr tiglieevrl tiglieervl tiglieerlv tiglierlev tiglierlve
tiglierelv tiglierevl tigliervel tigliervle tiglielrev tiglielrve tiglielerv tiglielevr tiglielver tiglielvre tiglieelrv
tiglieelvr tiglieerlv tiglieervl tiglieevrl tiglieevlr tiglievler tiglievlre tiglievelr tiglieverl tiglievrel tiglievrle
tigllviree tigllviree tigllviere tigllvieer tigllvieer tigllviere tigllvriee tigllvriee tigllvreie tigllvreei tigllvreei
tigllvreie tigllverie tigllverei tigllveire tigllveier tigllveeir tigllveeri tigllverei tigllverie tigllveeri tigllveeir
tigllveier tigllveire tigllivree tigllivree tigllivere tiglliveer tiglliveer tigllivere tigllirvee tigllirvee tigllireve
tigllireev tigllireev tigllireve tigllierve tigllierev tigllievre tiglliever tigllieevr tigllieerv tigllierev tigllierve
tigllieerv tigllieevr tiglliever tigllievre tigllrivee tigllrivee tigllrieve tigllrieev tigllrieev tigllrieve tigllrviee
tigllrviee tigllrveie tigllrveei tigllrveei tigllrveie tigllrevie tigllrevei tigllreive tigllreiev tigllreeiv tigllreevi
tigllrevei tigllrevie tigllreevi tigllreeiv tigllreiev tigllreive tiglleirve tiglleirev tiglleivre tiglleiver tiglleievr
tiglleierv tigllerive tiglleriev tigllervie tigllervei tigllerevi tigllereiv tigllevrie tigllevrei tigllevire tigllevier
tiglleveir tiglleveri tiglleervi tiglleeriv tiglleevri tiglleevir tiglleeivr tiglleeirv tiglleirev tiglleirve tiglleierv
tiglleievr tiglleiver tiglleivre tiglleriev tigllerive tigllereiv tigllerevi tigllervei tigllervie tiglleeriv tiglleervi
tiglleeirv tiglleeivr tiglleevir tiglleevri tigllevrei tigllevrie tiglleveri tiglleveir tigllevier tigllevire tiglevilre
tigleviler tiglevirle tiglevirel tiglevierl tiglevielr tiglevlire tiglevlier tiglevlrie tiglevlrei tiglevleri tiglevleir
tiglevrlie tiglevrlei tiglevrile tiglevriel tiglevreil tiglevreli tiglevelri tiglevelir tigleverli tigleveril tigleveirl
tigleveilr tigleivlre tigleivler tigleivrle tigleivrel tigleiverl tigleivelr tigleilvre tigleilver tigleilrve tigleilrev
tigleilerv tigleilevr tigleirlve tigleirlev tigleirvle tigleirvel tigleirevl tigleirelv tigleielrv tigleielvr tigleierlv
tigleiervl tigleievrl tigleievlr tiglelivre tigleliver tiglelirve tiglelirev tiglelierv tiglelievr tiglelvire tiglelvier
tiglelvrie tiglelvrei tiglelveri tiglelveir tiglelrvie tiglelrvei tiglelrive tiglelriev tiglelreiv tiglelrevi tiglelevri
tiglelevir tiglelervi tigleleriv tigleleirv tigleleivr tiglerilve tiglerilev tiglerivle tiglerivel tiglerievl tiglerielv
tiglerlive tiglerliev tiglerlvie tiglerlvei tiglerlevi tiglerleiv tiglervlie tiglervlei tiglervile tiglerviel tiglerveil
tiglerveli tiglerelvi tiglereliv tiglerevli tiglerevil tiglereivl tiglereilv tigleeilrv tigleeilvr tigleeirlv tigleeirvl
tigleeivrl tigleeivlr tigleelirv tigleelivr tigleelriv tigleelrvi tigleelvri tigleelvir tigleerliv tigleerlvi tigleerilv
tigleerivl tigleervil tigleervli tigleevlri tigleevlir tigleevrli tigleevril tigleevirl tigleevilr tigleviler tiglevilre
tiglevielr tiglevierl tiglevirel tiglevirle tiglevlier tiglevlire tiglevleir tiglevleri tiglevlrei tiglevlrie tiglevelir
tiglevelri tigleveilr tigleveirl tigleveril tigleverli tiglevrlei tiglevrlie tiglevreli tiglevreil tiglevriel tiglevrile
tigleivler tigleivlre tigleivelr tigleiverl tigleivrel tigleivrle tigleilver tigleilvre tigleilevr tigleilerv tigleilrev
tigleilrve tigleielvr tigleielrv tigleievlr tigleievrl tigleiervl tigleierlv tigleirlev tigleirlve tigleirelv tigleirevl
tigleirvel tigleirvle tigleliver tiglelivre tiglelievr tiglelierv tiglelirev tiglelirve tiglelvier tiglelvire tiglelveir
tiglelveri tiglelvrei tiglelvrie tiglelevir tiglelevri tigleleivr tigleleirv tigleleriv tiglelervi tiglelrvei tiglelrvie
tiglelrevi tiglelreiv tiglelriev tiglelrive tigleeilvr tigleeilrv tigleeivlr tigleeivrl tigleeirvl tigleeirlv tigleelivr
tigleelirv tigleelvir tigleelvri tigleelrvi tigleelriv tigleevlir tigleevlri tigleevilr tigleevirl tigleevril tigleevrli
tigleerlvi tigleerliv tigleervli tigleervil tigleerivl tigleerilv tiglerilev tiglerilve tiglerielv tiglerievl tiglerivel
tiglerivle tiglerliev tiglerlive tiglerleiv tiglerlevi tiglerlvei tiglerlvie tiglereliv tiglerelvi tiglereilv tiglereivl
tiglerevil tiglerevli tiglervlei tiglervlie tiglerveli tiglerveil tiglerviel tiglervile tigerville tigervilel tigerville
tigervilel tigerviell tigerviell tigervlile tigervliel tigervllie tigervllei tigervleli tigervleil tigervllie tigervllei
tigervlile tigervliel tigervleil tigervleli tigervelli tigervelil tigervelli tigervelil tigerveill tigerveill tigerivlle
tigerivlel tigerivlle tigerivlel tigerivell tigerivell tigerilvle tigerilvel tigerillve tigerillev tigerilelv tigerilevl
tigerillve tigerillev tigerilvle tigerilvel tigerilevl tigerilelv tigeriellv tigerielvl tigeriellv tigerielvl tigerievll
tigerievll tigerlivle tigerlivel tigerlilve tigerlilev tigerlielv tigerlievl tigerlvile tigerlviel tigerlvlie tigerlvlei
tigerlveli tigerlveil tigerllvie tigerllvei tigerllive tigerlliev tigerlleiv tigerllevi tigerlevli tigerlevil tigerlelvi
tigerleliv tigerleilv tigerleivl tigerlilve tigerlilev tigerlivle tigerlivel tigerlievl tigerlielv tigerllive tigerlliev
tigerllvie tigerllvei tigerllevi tigerlleiv tigerlvlie tigerlvlei tigerlvile tigerlviel tigerlveil tigerlveli tigerlelvi
tigerleliv tigerlevli tigerlevil tigerleivl tigerleilv tigereillv tigereilvl tigereillv tigereilvl tigereivll tigereivll
tigerelilv tigerelivl tigerelliv tigerellvi tigerelvli tigerelvil tigerelliv tigerellvi tigerelilv tigerelivl tigerelvil
tigerelvli tigerevlli tigerevlil tigerevlli tigerevlil tigerevill tigerevill tigevrille tigevrilel tigevrille tigevrilel
tigevriell tigevriell tigevrlile tigevrliel tigevrllie tigevrllei tigevrleli tigevrleil tigevrllie tigevrllei tigevrlile
tigevrliel tigevrleil tigevrleli tigevrelli tigevrelil tigevrelli tigevrelil tigevreill tigevreill tigevirlle tigevirlel
tigevirlle tigevirlel tigevirell tigevirell tigevilrle tigevilrel tigevillre tigeviller tigevilelr tigevilerl tigevillre
tigeviller tigevilrle tigevilrel tigevilerl tigevilelr tigeviellr tigevielrl tigeviellr tigevielrl tigevierll tigevierll
tigevlirle tigevlirel tigevlilre tigevliler tigevlielr tigevlierl tigevlrile tigevlriel tigevlrlie tigevlrlei tigevlreli
tigevlreil tigevllrie tigevllrei tigevllire tigevllier tigevlleir tigevlleri tigevlerli tigevleril tigevlelri tigevlelir
tigevleilr tigevleirl tigevlilre tigevliler tigevlirle tigevlirel tigevlierl tigevlielr tigevllire tigevllier tigevllrie
tigevllrei tigevlleri tigevlleir tigevlrlie tigevlrlei tigevlrile tigevlriel tigevlreil tigevlreli tigevlelri tigevlelir
tigevlerli tigevleril tigevleirl tigevleilr tigeveillr tigeveilrl tigeveillr tigeveilrl tigeveirll tigeveirll tigevelilr
tigevelirl tigevellir tigevellri tigevelrli tigevelril tigevellir tigevellri tigevelilr tigevelirl tigevelril tigevelrli
tigeverlli tigeverlil tigeverlli tigeverlil tigeverill tigeverill tigeivrlle tigeivrlel tigeivrlle tigeivrlel tigeivrell
tigeivrell tigeivlrle tigeivlrel tigeivllre tigeivller tigeivlelr tigeivlerl tigeivllre tigeivller tigeivlrle tigeivlrel
tigeivlerl tigeivlelr tigeivellr tigeivelrl tigeivellr tigeivelrl tigeiverll tigeiverll tigeirvlle tigeirvlel tigeirvlle
tigeirvlel tigeirvell tigeirvell tigeirlvle tigeirlvel tigeirllve tigeirllev tigeirlelv tigeirlevl tigeirllve tigeirllev
tigeirlvle tigeirlvel tigeirlevl tigeirlelv tigeirellv tigeirelvl tigeirellv tigeirelvl tigeirevll tigeirevll tigeilrvle
tigeilrvel tigeilrlve tigeilrlev tigeilrelv tigeilrevl tigeilvrle tigeilvrel tigeilvlre tigeilvler tigeilvelr tigeilverl
tigeillvre tigeillver tigeillrve tigeillrev tigeillerv tigeillevr tigeilevlr tigeilevrl tigeilelvr tigeilelrv tigeilerlv
tigeilervl tigeilrlve tigeilrlev tigeilrvle tigeilrvel tigeilrevl tigeilrelv tigeillrve tigeillrev tigeillvre tigeillver
tigeillevr tigeillerv tigeilvlre tigeilvler tigeilvrle tigeilvrel tigeilverl tigeilvelr tigeilelvr tigeilelrv tigeilevlr
tigeilevrl tigeilervl tigeilerlv tigeierllv tigeierlvl tigeierllv tigeierlvl tigeiervll tigeiervll tigeielrlv tigeielrvl
tigeiellrv tigeiellvr tigeielvlr tigeielvrl tigeiellrv tigeiellvr tigeielrlv tigeielrvl tigeielvrl tigeielvlr tigeievllr
tigeievlrl tigeievllr tigeievlrl tigeievrll tigeievrll tigelvirle tigelvirel tigelvilre tigelviler tigelvielr tigelvierl
tigelvrile tigelvriel tigelvrlie tigelvrlei tigelvreli tigelvreil tigelvlrie tigelvlrei tigelvlire tigelvlier tigelvleir
tigelvleri tigelverli tigelveril tigelvelri tigelvelir tigelveilr tigelveirl tigelivrle tigelivrel tigelivlre tigelivler
tigelivelr tigeliverl tigelirvle tigelirvel tigelirlve tigelirlev tigelirelv tigelirevl tigelilrve tigelilrev tigelilvre
tigelilver tigelilevr tigelilerv tigelierlv tigeliervl tigelielrv tigelielvr tigelievlr tigelievrl tigelrivle tigelrivel
tigelrilve tigelrilev tigelrielv tigelrievl tigelrvile tigelrviel tigelrvlie tigelrvlei tigelrveli tigelrveil tigelrlvie
tigelrlvei tigelrlive tigelrliev tigelrleiv tigelrlevi tigelrevli tigelrevil tigelrelvi tigelreliv tigelreilv tigelreivl
tigellirve tigellirev tigellivre tigelliver tigellievr tigellierv tigellrive tigellriev tigellrvie tigellrvei tigellrevi
tigellreiv tigellvrie tigellvrei tigellvire tigellvier tigellveir tigellveri tigellervi tigelleriv tigellevri tigellevir
tigelleivr tigelleirv tigeleirlv tigeleirvl tigeleilrv tigeleilvr tigeleivlr tigeleivrl tigelerilv tigelerivl tigelerliv
tigelerlvi tigelervli tigelervil tigelelriv tigelelrvi tigelelirv tigelelivr tigelelvir tigelelvri tigelevrli tigelevril
tigelevlri tigelevlir tigelevilr tigelevirl tigelvilre tigelviler tigelvirle tigelvirel tigelvierl tigelvielr tigelvlire
tigelvlier tigelvlrie tigelvlrei tigelvleri tigelvleir tigelvrlie tigelvrlei tigelvrile tigelvriel tigelvreil tigelvreli
tigelvelri tigelvelir tigelverli tigelveril tigelveirl tigelveilr tigelivlre tigelivler tigelivrle tigelivrel tigeliverl
tigelivelr tigelilvre tigelilver tigelilrve tigelilrev tigelilerv tigelilevr tigelirlve tigelirlev tigelirvle tigelirvel
tigelirevl tigelirelv tigelielrv tigelielvr tigelierlv tigeliervl tigelievrl tigelievlr tigellivre tigelliver tigellirve
tigellirev tigellierv tigellievr tigellvire tigellvier tigellvrie tigellvrei tigellveri tigellveir tigellrvie tigellrvei
tigellrive tigellriev tigellreiv tigellrevi tigellevri tigellevir tigellervi tigelleriv tigelleirv tigelleivr tigelrilve
tigelrilev tigelrivle tigelrivel tigelrievl tigelrielv tigelrlive tigelrliev tigelrlvie tigelrlvei tigelrlevi tigelrleiv
tigelrvlie tigelrvlei tigelrvile tigelrviel tigelrveil tigelrveli tigelrelvi tigelreliv tigelrevli tigelrevil tigelreivl
tigelreilv tigeleilrv tigeleilvr tigeleirlv tigeleirvl tigeleivrl tigeleivlr tigelelirv tigelelivr tigelelriv tigelelrvi
tigelelvri tigelelvir tigelerliv tigelerlvi tigelerilv tigelerivl tigelervil tigelervli tigelevlri tigelevlir tigelevrli
tigelevril tigelevirl tigelevilr tigeevillr tigeevilrl tigeevillr tigeevilrl tigeevirll tigeevirll tigeevlilr tigeevlirl
tigeevllir tigeevllri tigeevlrli tigeevlril tigeevllir tigeevllri tigeevlilr tigeevlirl tigeevlril tigeevlrli tigeevrlli
tigeevrlil tigeevrlli tigeevrlil tigeevrill tigeevrill tigeeivllr tigeeivlrl tigeeivllr tigeeivlrl tigeeivrll tigeeivrll
tigeeilvlr tigeeilvrl tigeeillvr tigeeillrv tigeeilrlv tigeeilrvl tigeeillvr tigeeillrv tigeeilvlr tigeeilvrl tigeeilrvl
tigeeilrlv tigeeirllv tigeeirlvl tigeeirllv tigeeirlvl tigeeirvll tigeeirvll tigeelivlr tigeelivrl tigeelilvr tigeelilrv
tigeelirlv tigeelirvl tigeelvilr tigeelvirl tigeelvlir tigeelvlri tigeelvrli tigeelvril tigeellvir tigeellvri tigeellivr
tigeellirv tigeellriv tigeellrvi tigeelrvli tigeelrvil tigeelrlvi tigeelrliv tigeelrilv tigeelrivl tigeelilvr tigeelilrv
tigeelivlr tigeelivrl tigeelirvl tigeelirlv tigeellivr tigeellirv tigeellvir tigeellvri tigeellrvi tigeellriv tigeelvlir
tigeelvlri tigeelvilr tigeelvirl tigeelvril tigeelvrli tigeelrlvi tigeelrliv tigeelrvli tigeelrvil tigeelrivl tigeelrilv
tigeerillv tigeerilvl tigeerillv tigeerilvl tigeerivll tigeerivll tigeerlilv tigeerlivl tigeerlliv tigeerllvi tigeerlvli
tigeerlvil tigeerlliv tigeerllvi tigeerlilv tigeerlivl tigeerlvil tigeerlvli tigeervlli tigeervlil tigeervlli tigeervlil
tigeervill tigeervill

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us