easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

taeniosomous

created

legalise

beliefful

civitatique

bonenberger

postcerebellar

butylation

opimaeque

wedig

ptolemaism

exscriptaque

volvoque

resonaretisque

previsional

repossessed

threeps

evilwishing


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: thrummers
cipher variations:
uisvnnfst vjtwoogtu wkuxpphuv xlvyqqivw ymwzrrjwx
znxasskxy aoybttlyz bpzcuumza cqadvvnab drbewwobc
escfxxpcd ftdgyyqde guehzzref hvfiaasfg iwgjbbtgh
jxhkccuhi kyilddvij lzjmeewjk maknffxkl nbloggylm
ocmphhzmn pdnqiiano qeorjjbop rfpskkcpq sgqtlldqr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: thrummers
Cipher: gsifnnvih

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: thrummers
Cipher: BAABA AABBB BAAAA BAABB ABABB ABABB AABAA BAAAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: thrummers
cipher variations:
uisvnnfstgwajllnadskixjjvineyqlhhdqxqmyzfflyhcagnddtgracwpzzjwlmqedxxrev
yemrvvzmfksuftthupwgctrrpcziukhppxkjvjtwoogtuhxbkmmobetljykkwjofzrmiiery
rnzaggmzidbhoeeuhsbdxqaakxmnrfeyysfwzfnswwangltvguuivqxhdussqdajvliqqylk
wkuxpphuviyclnnpcfumkzllxkpgasnjjfszsoabhhnajecipffvitceyrbblynosgfzztgx
agotxxbohmuwhvvjwryievttrebkwmjrrzmlxlvyqqivwjzdmooqdgvnlammylqhbtokkgta
tpbciiobkfdjqggwjudfzsccmzopthgaauhybhpuyycpinvxiwwkxszjfwuusfclxnkssanm
ymwzrrjwxkaenpprehwombnnzmricupllhubuqcdjjpclgekrhhxkvegatddnapquihbbviz
ciqvzzdqjowyjxxlytakgxvvtgdmyolttbonznxasskxylbfoqqsfixpncooansjdvqmmivc
vrdekkqdmhflsiiylwfhbueeobqrvjiccwjadjrwaaerkpxzkyymzublhywwuhenzpmuucpo
aoybttlyzmcgprrtgjyqodppbotkewrnnjwdwsefllrenigmtjjzmxgicvffpcrswkjddxkb
eksxbbfslqyalzznavcmizxxvifoaqnvvdqpbpzcuumzandhqssuhkzrpeqqcpulfxsookxe
xtfgmmsfojhnukkanyhjdwggqdstxlkeeylcfltyccgtmrzbmaaobwdnjayywjgpbrowwerq
cqadvvnaboeirttvilasqfrrdqvmgytpplyfyughnntgpkiovllbozikexhhretuymlffzmd
gmuzddhunsacnbbpcxeokbzzxkhqcspxxfsrdrbewwobcpfjsuuwjmbtrgsserwnhzuqqmzg
zvhioouhqljpwmmcpajlfyiisfuvznmgganehnvaeeivotbdoccqdyfplcaaylirdtqyygts
escfxxpcdqgktvvxkncushttfsxoiavrrnahawijppvirmkqxnndqbkmgzjjtgvwaonhhbof
iowbffjwpucepddrezgqmdbbzmjseurzzhutftdgyyqderhluwwylodvtiuugtypjbwssobi
bxjkqqwjsnlryooerclnhakkuhwxbpoiicpgjpxcggkxqvdfqeesfahrneccanktfvsaaivu
guehzzrefsimvxxzmpewujvvhuzqkcxttpcjcyklrrxktomszppfsdmoibllvixycqpjjdqh
kqydhhlyrwegrfftgbisofddbolugwtbbjwvhvfiaasfgtjnwyyanqfxvkwwivarldyuuqdk
dzlmssylupntaqqgtenpjcmmwjyzdrqkkerilrzeiimzsxfhsgguhcjtpgeecpmvhxucckxw
iwgjbbtghukoxzzborgywlxxjwbsmezvvreleamnttzmvqoubrrhufoqkdnnxkzaesrllfsj
msafjjnatygithhvidkuqhffdqnwiyvddlyxjxhkccuhivlpyaacpshzxmyykxctnfawwsfm
fbnouuanwrpvcssivgprleooylabftsmmgtkntbgkkobuzhjuiiwjelvriggeroxjzweemzy
kyilddvijwmqzbbdqtiaynzzlyduogbxxtgngcopvvboxsqwdttjwhqsmfppzmbcgutnnhul
ouchllpcvaikvjjxkfmwsjhhfspykaxffnazlzjmeewjkxnraccerujbzoaamzevphcyyuho
hdpqwwcpytrxeuukxirtngqqancdhvuooivmpvdimmqdwbjlwkkylgnxtkiigtqzlbyggoba
maknffxklyosbddfsvkcapbbnafwqidzzvipieqrxxdqzusyfvvlyjsuohrrbodeiwvppjwn
qwejnnrexckmxllzmhoyuljjhuramczhhpcbnbloggylmzptceegtwldbqccobgxrjeaawjq
jfrsyyeravtzgwwmzktvpisscpefjxwqqkxorxfkoosfydlnymmanipzvmkkivsbndaiiqdc
ocmphhzmnaqudffhuxmecrddpchyskfbbxkrkgstzzfsbwuahxxnaluwqjttdqfgkyxrrlyp
syglpptgzemoznnbojqawnlljwtcoebjjredpdnqiianobrveggivynfdseeqdiztlgccyls
lhtuaagtcxvbiyyobmvxrkuuerghlzyssmzqtzhmqquhafnpaoocpkrbxommkxudpfckksfe
qeorjjbopcswfhhjwzogetffrejaumhddzmtmiuvbbhudywcjzzpcnwyslvvfshimazttnar
uainrrvibgoqbppdqlscypnnlyveqgdlltgfrfpskkcpqdtxgiikxaphfuggsfkbvnieeanu
njvwccivezxdkaaqdoxztmwwgtijnbauuobsvbjosswjchprcqqermtdzqoomzwfrhemmuhg
sgqtlldqreuyhjjlybqigvhhtglcwojffbovokwxddjwfayelbbrepyaunxxhujkocbvvpct
wckpttxkdiqsdrrfsnuearppnaxgsifnnvihthrummersfvzikkmzcrjhwiiuhmdxpkggcpw
plxyeekxgbzfmccsfqzbvoyyivklpdcwwqduxdlquuylejrtessgtovfbsqqobyhtjgoowji

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: thrummers
Cipher: guehzzref

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: thrummers
Cipher: 443224542323512434

Extended Methods:
Method #1

Plaintext: thrummers
method variations:
ynwzrrkwxdsbewwpbcixgkbbughocmpggzmn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
t h r u m m e r s 
4 3 2 5 2 2 5 2 3 
4 2 4 4 3 3 1 4 4 
They are then read out in rows:
432522523424433144
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: thrummers
Cipher: owgksroct

Read more ...
Method #3

Plaintext: thrummers
method variations:
ogyihxfot gyihxfoto yihxfotog
ihxfotogy hxfotogyi xfotogyih
fotogyihx otogyihxf togyihxfo

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: thrummers

first 5040 cipher variations(362880 total)
thrummers thrummesr thrummres thrummrse thrummsre thrummser thrumemrs thrumemsr thrumerms thrumersm thrumesrm
thrumesmr thrumrems thrumresm thrumrmes thrumrmse thrumrsme thrumrsem thrumserm thrumsemr thrumsrem thrumsrme
thrumsmre thrumsmer thrummers thrummesr thrummres thrummrse thrummsre thrummser thrumemrs thrumemsr thrumerms
thrumersm thrumesrm thrumesmr thrumrems thrumresm thrumrmes thrumrmse thrumrsme thrumrsem thrumserm thrumsemr
thrumsrem thrumsrme thrumsmre thrumsmer thruemmrs thruemmsr thruemrms thruemrsm thruemsrm thruemsmr thruemmrs
thruemmsr thruemrms thruemrsm thruemsrm thruemsmr thruermms thruermsm thruermms thruermsm thruersmm thruersmm
thruesmrm thruesmmr thruesrmm thruesrmm thruesmrm thruesmmr thrurmems thrurmesm thrurmmes thrurmmse thrurmsme
thrurmsem thruremms thruremsm thruremms thruremsm thruresmm thruresmm thrurmems thrurmesm thrurmmes thrurmmse
thrurmsme thrurmsem thrursemm thrursemm thrursmem thrursmme thrursmme thrursmem thrusmerm thrusmemr thrusmrem
thrusmrme thrusmmre thrusmmer thrusemrm thrusemmr thrusermm thrusermm thrusemrm thrusemmr thrusremm thrusremm
thrusrmem thrusrmme thrusrmme thrusrmem thrusmerm thrusmemr thrusmrem thrusmrme thrusmmre thrusmmer thrmumers
thrmumesr thrmumres thrmumrse thrmumsre thrmumser thrmuemrs thrmuemsr thrmuerms thrmuersm thrmuesrm thrmuesmr
thrmurems thrmuresm thrmurmes thrmurmse thrmursme thrmursem thrmuserm thrmusemr thrmusrem thrmusrme thrmusmre
thrmusmer thrmmuers thrmmuesr thrmmures thrmmurse thrmmusre thrmmuser thrmmeurs thrmmeusr thrmmerus thrmmersu
thrmmesru thrmmesur thrmmreus thrmmresu thrmmrues thrmmruse thrmmrsue thrmmrseu thrmmseru thrmmseur thrmmsreu
thrmmsrue thrmmsure thrmmsuer thrmemurs thrmemusr thrmemrus thrmemrsu thrmemsru thrmemsur thrmeumrs thrmeumsr
thrmeurms thrmeursm thrmeusrm thrmeusmr thrmerums thrmerusm thrmermus thrmermsu thrmersmu thrmersum thrmesurm
thrmesumr thrmesrum thrmesrmu thrmesmru thrmesmur thrmrmeus thrmrmesu thrmrmues thrmrmuse thrmrmsue thrmrmseu
thrmremus thrmremsu thrmreums thrmreusm thrmresum thrmresmu thrmruems thrmruesm thrmrumes thrmrumse thrmrusme
thrmrusem thrmrseum thrmrsemu thrmrsuem thrmrsume thrmrsmue thrmrsmeu thrmsmeru thrmsmeur thrmsmreu thrmsmrue
thrmsmure thrmsmuer thrmsemru thrmsemur thrmsermu thrmserum thrmseurm thrmseumr thrmsremu thrmsreum thrmsrmeu
thrmsrmue thrmsrume thrmsruem thrmsuerm thrmsuemr thrmsurem thrmsurme thrmsumre thrmsumer thrmmuers thrmmuesr
thrmmures thrmmurse thrmmusre thrmmuser thrmmeurs thrmmeusr thrmmerus thrmmersu thrmmesru thrmmesur thrmmreus
thrmmresu thrmmrues thrmmruse thrmmrsue thrmmrseu thrmmseru thrmmseur thrmmsreu thrmmsrue thrmmsure thrmmsuer
thrmumers thrmumesr thrmumres thrmumrse thrmumsre thrmumser thrmuemrs thrmuemsr thrmuerms thrmuersm thrmuesrm
thrmuesmr thrmurems thrmuresm thrmurmes thrmurmse thrmursme thrmursem thrmuserm thrmusemr thrmusrem thrmusrme
thrmusmre thrmusmer thrmeumrs thrmeumsr thrmeurms thrmeursm thrmeusrm thrmeusmr thrmemurs thrmemusr thrmemrus
thrmemrsu thrmemsru thrmemsur thrmermus thrmermsu thrmerums thrmerusm thrmersum thrmersmu thrmesmru thrmesmur
thrmesrmu thrmesrum thrmesurm thrmesumr thrmruems thrmruesm thrmrumes thrmrumse thrmrusme thrmrusem thrmreums
thrmreusm thrmremus thrmremsu thrmresmu thrmresum thrmrmeus thrmrmesu thrmrmues thrmrmuse thrmrmsue thrmrmseu
thrmrsemu thrmrseum thrmrsmeu thrmrsmue thrmrsume thrmrsuem thrmsuerm thrmsuemr thrmsurem thrmsurme thrmsumre
thrmsumer thrmseurm thrmseumr thrmserum thrmsermu thrmsemru thrmsemur thrmsreum thrmsremu thrmsruem thrmsrume
thrmsrmue thrmsrmeu thrmsmeru thrmsmeur thrmsmreu thrmsmrue thrmsmure thrmsmuer thremmurs thremmusr thremmrus
thremmrsu thremmsru thremmsur thremumrs thremumsr thremurms thremursm thremusrm thremusmr thremrums thremrusm
thremrmus thremrmsu thremrsmu thremrsum thremsurm thremsumr thremsrum thremsrmu thremsmru thremsmur thremmurs
thremmusr thremmrus thremmrsu thremmsru thremmsur thremumrs thremumsr thremurms thremursm thremusrm thremusmr
thremrums thremrusm thremrmus thremrmsu thremrsmu thremrsum thremsurm thremsumr thremsrum thremsrmu thremsmru
thremsmur threummrs threummsr threumrms threumrsm threumsrm threumsmr threummrs threummsr threumrms threumrsm
threumsrm threumsmr threurmms threurmsm threurmms threurmsm threursmm threursmm threusmrm threusmmr threusrmm
threusrmm threusmrm threusmmr thrermums thrermusm thrermmus thrermmsu thrermsmu thrermsum threrumms threrumsm
threrumms threrumsm threrusmm threrusmm thrermums thrermusm thrermmus thrermmsu thrermsmu thrermsum thrersumm
thrersumm thrersmum thrersmmu thrersmmu thrersmum thresmurm thresmumr thresmrum thresmrmu thresmmru thresmmur
thresumrm thresummr thresurmm thresurmm thresumrm thresummr thresrumm thresrumm thresrmum thresrmmu thresrmmu
thresrmum thresmurm thresmumr thresmrum thresmrmu thresmmru thresmmur thrrmmeus thrrmmesu thrrmmues thrrmmuse
thrrmmsue thrrmmseu thrrmemus thrrmemsu thrrmeums thrrmeusm thrrmesum thrrmesmu thrrmuems thrrmuesm thrrmumes
thrrmumse thrrmusme thrrmusem thrrmseum thrrmsemu thrrmsuem thrrmsume thrrmsmue thrrmsmeu thrrmmeus thrrmmesu
thrrmmues thrrmmuse thrrmmsue thrrmmseu thrrmemus thrrmemsu thrrmeums thrrmeusm thrrmesum thrrmesmu thrrmuems
thrrmuesm thrrmumes thrrmumse thrrmusme thrrmusem thrrmseum thrrmsemu thrrmsuem thrrmsume thrrmsmue thrrmsmeu
thrremmus thrremmsu thrremums thrremusm thrremsum thrremsmu thrremmus thrremmsu thrremums thrremusm thrremsum
thrremsmu thrreumms thrreumsm thrreumms thrreumsm thrreusmm thrreusmm thrresmum thrresmmu thrresumm thrresumm
thrresmum thrresmmu thrrumems thrrumesm thrrummes thrrummse thrrumsme thrrumsem thrruemms thrruemsm thrruemms
thrruemsm thrruesmm thrruesmm thrrumems thrrumesm thrrummes thrrummse thrrumsme thrrumsem thrrusemm thrrusemm
thrrusmem thrrusmme thrrusmme thrrusmem thrrsmeum thrrsmemu thrrsmuem thrrsmume thrrsmmue thrrsmmeu thrrsemum
thrrsemmu thrrseumm thrrseumm thrrsemum thrrsemmu thrrsuemm thrrsuemm thrrsumem thrrsumme thrrsumme thrrsumem
thrrsmeum thrrsmemu thrrsmuem thrrsmume thrrsmmue thrrsmmeu thrsmmeru thrsmmeur thrsmmreu thrsmmrue thrsmmure
thrsmmuer thrsmemru thrsmemur thrsmermu thrsmerum thrsmeurm thrsmeumr thrsmremu thrsmreum thrsmrmeu thrsmrmue
thrsmrume thrsmruem thrsmuerm thrsmuemr thrsmurem thrsmurme thrsmumre thrsmumer thrsmmeru thrsmmeur thrsmmreu
thrsmmrue thrsmmure thrsmmuer thrsmemru thrsmemur thrsmermu thrsmerum thrsmeurm thrsmeumr thrsmremu thrsmreum
thrsmrmeu thrsmrmue thrsmrume thrsmruem thrsmuerm thrsmuemr thrsmurem thrsmurme thrsmumre thrsmumer thrsemmru
thrsemmur thrsemrmu thrsemrum thrsemurm thrsemumr thrsemmru thrsemmur thrsemrmu thrsemrum thrsemurm thrsemumr
thrsermmu thrsermum thrsermmu thrsermum thrserumm thrserumm thrseumrm thrseummr thrseurmm thrseurmm thrseumrm
thrseummr thrsrmemu thrsrmeum thrsrmmeu thrsrmmue thrsrmume thrsrmuem thrsremmu thrsremum thrsremmu thrsremum
thrsreumm thrsreumm thrsrmemu thrsrmeum thrsrmmeu thrsrmmue thrsrmume thrsrmuem thrsruemm thrsruemm thrsrumem
thrsrumme thrsrumme thrsrumem thrsumerm thrsumemr thrsumrem thrsumrme thrsummre thrsummer thrsuemrm thrsuemmr
thrsuermm thrsuermm thrsuemrm thrsuemmr thrsuremm thrsuremm thrsurmem thrsurmme thrsurmme thrsurmem thrsumerm
thrsumemr thrsumrem thrsumrme thrsummre thrsummer thurmmers thurmmesr thurmmres thurmmrse thurmmsre thurmmser
thurmemrs thurmemsr thurmerms thurmersm thurmesrm thurmesmr thurmrems thurmresm thurmrmes thurmrmse thurmrsme
thurmrsem thurmserm thurmsemr thurmsrem thurmsrme thurmsmre thurmsmer thurmmers thurmmesr thurmmres thurmmrse
thurmmsre thurmmser thurmemrs thurmemsr thurmerms thurmersm thurmesrm thurmesmr thurmrems thurmresm thurmrmes
thurmrmse thurmrsme thurmrsem thurmserm thurmsemr thurmsrem thurmsrme thurmsmre thurmsmer thuremmrs thuremmsr
thuremrms thuremrsm thuremsrm thuremsmr thuremmrs thuremmsr thuremrms thuremrsm thuremsrm thuremsmr thurermms
thurermsm thurermms thurermsm thurersmm thurersmm thuresmrm thuresmmr thuresrmm thuresrmm thuresmrm thuresmmr
thurrmems thurrmesm thurrmmes thurrmmse thurrmsme thurrmsem thurremms thurremsm thurremms thurremsm thurresmm
thurresmm thurrmems thurrmesm thurrmmes thurrmmse thurrmsme thurrmsem thurrsemm thurrsemm thurrsmem thurrsmme
thurrsmme thurrsmem thursmerm thursmemr thursmrem thursmrme thursmmre thursmmer thursemrm thursemmr thursermm
thursermm thursemrm thursemmr thursremm thursremm thursrmem thursrmme thursrmme thursrmem thursmerm thursmemr
thursmrem thursmrme thursmmre thursmmer thumrmers thumrmesr thumrmres thumrmrse thumrmsre thumrmser thumremrs
thumremsr thumrerms thumrersm thumresrm thumresmr thumrrems thumrresm thumrrmes thumrrmse thumrrsme thumrrsem
thumrserm thumrsemr thumrsrem thumrsrme thumrsmre thumrsmer thummrers thummresr thummrres thummrrse thummrsre
thummrser thummerrs thummersr thummerrs thummersr thummesrr thummesrr thummrers thummresr thummrres thummrrse
thummrsre thummrser thummserr thummserr thummsrer thummsrre thummsrre thummsrer thumemrrs thumemrsr thumemrrs
thumemrsr thumemsrr thumemsrr thumermrs thumermsr thumerrms thumerrsm thumersrm thumersmr thumerrms thumerrsm
thumermrs thumermsr thumersmr thumersrm thumesrrm thumesrmr thumesrrm thumesrmr thumesmrr thumesmrr thumrmers
thumrmesr thumrmres thumrmrse thumrmsre thumrmser thumremrs thumremsr thumrerms thumrersm thumresrm thumresmr
thumrrems thumrresm thumrrmes thumrrmse thumrrsme thumrrsem thumrserm thumrsemr thumrsrem thumrsrme thumrsmre
thumrsmer thumsmerr thumsmerr thumsmrer thumsmrre thumsmrre thumsmrer thumsemrr thumsemrr thumsermr thumserrm
thumserrm thumsermr thumsremr thumsrerm thumsrmer thumsrmre thumsrrme thumsrrem thumsrerm thumsremr thumsrrem
thumsrrme thumsrmre thumsrmer thummrers thummresr thummrres thummrrse thummrsre thummrser thummerrs thummersr
thummerrs thummersr thummesrr thummesrr thummrers thummresr thummrres thummrrse thummrsre thummrser thummserr
thummserr thummsrer thummsrre thummsrre thummsrer thumrmers thumrmesr thumrmres thumrmrse thumrmsre thumrmser
thumremrs thumremsr thumrerms thumrersm thumresrm thumresmr thumrrems thumrresm thumrrmes thumrrmse thumrrsme
thumrrsem thumrserm thumrsemr thumrsrem thumrsrme thumrsmre thumrsmer thumermrs thumermsr thumerrms thumerrsm
thumersrm thumersmr thumemrrs thumemrsr thumemrrs thumemrsr thumemsrr thumemsrr thumermrs thumermsr thumerrms
thumerrsm thumersrm thumersmr thumesmrr thumesmrr thumesrmr thumesrrm thumesrrm thumesrmr thumrrems thumrresm
thumrrmes thumrrmse thumrrsme thumrrsem thumrerms thumrersm thumremrs thumremsr thumresmr thumresrm thumrmers
thumrmesr thumrmres thumrmrse thumrmsre thumrmser thumrsemr thumrserm thumrsmer thumrsmre thumrsrme thumrsrem
thumsrerm thumsremr thumsrrem thumsrrme thumsrmre thumsrmer thumserrm thumsermr thumserrm thumsermr thumsemrr
thumsemrr thumsrerm thumsremr thumsrrem thumsrrme thumsrmre thumsrmer thumsmerr thumsmerr thumsmrer thumsmrre
thumsmrre thumsmrer thuemmrrs thuemmrsr thuemmrrs thuemmrsr thuemmsrr thuemmsrr thuemrmrs thuemrmsr thuemrrms
thuemrrsm thuemrsrm thuemrsmr thuemrrms thuemrrsm thuemrmrs thuemrmsr thuemrsmr thuemrsrm thuemsrrm thuemsrmr
thuemsrrm thuemsrmr thuemsmrr thuemsmrr thuemmrrs thuemmrsr thuemmrrs thuemmrsr thuemmsrr thuemmsrr thuemrmrs
thuemrmsr thuemrrms thuemrrsm thuemrsrm thuemrsmr thuemrrms thuemrrsm thuemrmrs thuemrmsr thuemrsmr thuemrsrm
thuemsrrm thuemsrmr thuemsrrm thuemsrmr thuemsmrr thuemsmrr thuermmrs thuermmsr thuermrms thuermrsm thuermsrm
thuermsmr thuermmrs thuermmsr thuermrms thuermrsm thuermsrm thuermsmr thuerrmms thuerrmsm thuerrmms thuerrmsm
thuerrsmm thuerrsmm thuersmrm thuersmmr thuersrmm thuersrmm thuersmrm thuersmmr thuermrms thuermrsm thuermmrs
thuermmsr thuermsmr thuermsrm thuerrmms thuerrmsm thuerrmms thuerrmsm thuerrsmm thuerrsmm thuermrms thuermrsm
thuermmrs thuermmsr thuermsmr thuermsrm thuersrmm thuersrmm thuersmrm thuersmmr thuersmmr thuersmrm thuesmrrm
thuesmrmr thuesmrrm thuesmrmr thuesmmrr thuesmmrr thuesrmrm thuesrmmr thuesrrmm thuesrrmm thuesrmrm thuesrmmr
thuesrrmm thuesrrmm thuesrmrm thuesrmmr thuesrmmr thuesrmrm thuesmrrm thuesmrmr thuesmrrm thuesmrmr thuesmmrr
thuesmmrr thurmmers thurmmesr thurmmres thurmmrse thurmmsre thurmmser thurmemrs thurmemsr thurmerms thurmersm
thurmesrm thurmesmr thurmrems thurmresm thurmrmes thurmrmse thurmrsme thurmrsem thurmserm thurmsemr thurmsrem
thurmsrme thurmsmre thurmsmer thurmmers thurmmesr thurmmres thurmmrse thurmmsre thurmmser thurmemrs thurmemsr
thurmerms thurmersm thurmesrm thurmesmr thurmrems thurmresm thurmrmes thurmrmse thurmrsme thurmrsem thurmserm
thurmsemr thurmsrem thurmsrme thurmsmre thurmsmer thuremmrs thuremmsr thuremrms thuremrsm thuremsrm thuremsmr
thuremmrs thuremmsr thuremrms thuremrsm thuremsrm thuremsmr thurermms thurermsm thurermms thurermsm thurersmm
thurersmm thuresmrm thuresmmr thuresrmm thuresrmm thuresmrm thuresmmr thurrmems thurrmesm thurrmmes thurrmmse
thurrmsme thurrmsem thurremms thurremsm thurremms thurremsm thurresmm thurresmm thurrmems thurrmesm thurrmmes
thurrmmse thurrmsme thurrmsem thurrsemm thurrsemm thurrsmem thurrsmme thurrsmme thurrsmem thursmerm thursmemr
thursmrem thursmrme thursmmre thursmmer thursemrm thursemmr thursermm thursermm thursemrm thursemmr thursremm
thursremm thursrmem thursrmme thursrmme thursrmem thursmerm thursmemr thursmrem thursmrme thursmmre thursmmer
thusmmerr thusmmerr thusmmrer thusmmrre thusmmrre thusmmrer thusmemrr thusmemrr thusmermr thusmerrm thusmerrm
thusmermr thusmremr thusmrerm thusmrmer thusmrmre thusmrrme thusmrrem thusmrerm thusmremr thusmrrem thusmrrme
thusmrmre thusmrmer thusmmerr thusmmerr thusmmrer thusmmrre thusmmrre thusmmrer thusmemrr thusmemrr thusmermr
thusmerrm thusmerrm thusmermr thusmremr thusmrerm thusmrmer thusmrmre thusmrrme thusmrrem thusmrerm thusmremr
thusmrrem thusmrrme thusmrmre thusmrmer thusemmrr thusemmrr thusemrmr thusemrrm thusemrrm thusemrmr thusemmrr
thusemmrr thusemrmr thusemrrm thusemrrm thusemrmr thusermmr thusermrm thusermmr thusermrm thuserrmm thuserrmm
thusermrm thusermmr thuserrmm thuserrmm thusermrm thusermmr thusrmemr thusrmerm thusrmmer thusrmmre thusrmrme
thusrmrem thusremmr thusremrm thusremmr thusremrm thusrermm thusrermm thusrmemr thusrmerm thusrmmer thusrmmre
thusrmrme thusrmrem thusrremm thusrremm thusrrmem thusrrmme thusrrmme thusrrmem thusrmerm thusrmemr thusrmrem
thusrmrme thusrmmre thusrmmer thusremrm thusremmr thusrermm thusrermm thusremrm thusremmr thusrremm thusrremm
thusrrmem thusrrmme thusrrmme thusrrmem thusrmerm thusrmemr thusrmrem thusrmrme thusrmmre thusrmmer thmurmers
thmurmesr thmurmres thmurmrse thmurmsre thmurmser thmuremrs thmuremsr thmurerms thmurersm thmuresrm thmuresmr
thmurrems thmurresm thmurrmes thmurrmse thmurrsme thmurrsem thmurserm thmursemr thmursrem thmursrme thmursmre
thmursmer thmumrers thmumresr thmumrres thmumrrse thmumrsre thmumrser thmumerrs thmumersr thmumerrs thmumersr
thmumesrr thmumesrr thmumrers thmumresr thmumrres thmumrrse thmumrsre thmumrser thmumserr thmumserr thmumsrer
thmumsrre thmumsrre thmumsrer thmuemrrs thmuemrsr thmuemrrs thmuemrsr thmuemsrr thmuemsrr thmuermrs thmuermsr
thmuerrms thmuerrsm thmuersrm thmuersmr thmuerrms thmuerrsm thmuermrs thmuermsr thmuersmr thmuersrm thmuesrrm
thmuesrmr thmuesrrm thmuesrmr thmuesmrr thmuesmrr thmurmers thmurmesr thmurmres thmurmrse thmurmsre thmurmser
thmuremrs thmuremsr thmurerms thmurersm thmuresrm thmuresmr thmurrems thmurresm thmurrmes thmurrmse thmurrsme
thmurrsem thmurserm thmursemr thmursrem thmursrme thmursmre thmursmer thmusmerr thmusmerr thmusmrer thmusmrre
thmusmrre thmusmrer thmusemrr thmusemrr thmusermr thmuserrm thmuserrm thmusermr thmusremr thmusrerm thmusrmer
thmusrmre thmusrrme thmusrrem thmusrerm thmusremr thmusrrem thmusrrme thmusrmre thmusrmer thmrumers thmrumesr
thmrumres thmrumrse thmrumsre thmrumser thmruemrs thmruemsr thmruerms thmruersm thmruesrm thmruesmr thmrurems
thmruresm thmrurmes thmrurmse thmrursme thmrursem thmruserm thmrusemr thmrusrem thmrusrme thmrusmre thmrusmer
thmrmuers thmrmuesr thmrmures thmrmurse thmrmusre thmrmuser thmrmeurs thmrmeusr thmrmerus thmrmersu thmrmesru
thmrmesur thmrmreus thmrmresu thmrmrues thmrmruse thmrmrsue thmrmrseu thmrmseru thmrmseur thmrmsreu thmrmsrue
thmrmsure thmrmsuer thmremurs thmremusr thmremrus thmremrsu thmremsru thmremsur thmreumrs thmreumsr thmreurms
thmreursm thmreusrm thmreusmr thmrerums thmrerusm thmrermus thmrermsu thmrersmu thmrersum thmresurm thmresumr
thmresrum thmresrmu thmresmru thmresmur thmrrmeus thmrrmesu thmrrmues thmrrmuse thmrrmsue thmrrmseu thmrremus
thmrremsu thmrreums thmrreusm thmrresum thmrresmu thmrruems thmrruesm thmrrumes thmrrumse thmrrusme thmrrusem
thmrrseum thmrrsemu thmrrsuem thmrrsume thmrrsmue thmrrsmeu thmrsmeru thmrsmeur thmrsmreu thmrsmrue thmrsmure
thmrsmuer thmrsemru thmrsemur thmrsermu thmrserum thmrseurm thmrseumr thmrsremu thmrsreum thmrsrmeu thmrsrmue
thmrsrume thmrsruem thmrsuerm thmrsuemr thmrsurem thmrsurme thmrsumre thmrsumer thmmruers thmmruesr thmmrures
thmmrurse thmmrusre thmmruser thmmreurs thmmreusr thmmrerus thmmrersu thmmresru thmmresur thmmrreus thmmrresu
thmmrrues thmmrruse thmmrrsue thmmrrseu thmmrseru thmmrseur thmmrsreu thmmrsrue thmmrsure thmmrsuer thmmurers
thmmuresr thmmurres thmmurrse thmmursre thmmurser thmmuerrs thmmuersr thmmuerrs thmmuersr thmmuesrr thmmuesrr
thmmurers thmmuresr thmmurres thmmurrse thmmursre thmmurser thmmuserr thmmuserr thmmusrer thmmusrre thmmusrre
thmmusrer thmmeurrs thmmeursr thmmeurrs thmmeursr thmmeusrr thmmeusrr thmmerurs thmmerusr thmmerrus thmmerrsu
thmmersru thmmersur thmmerrus thmmerrsu thmmerurs thmmerusr thmmersur thmmersru thmmesrru thmmesrur thmmesrru
thmmesrur thmmesurr thmmesurr thmmruers thmmruesr thmmrures thmmrurse thmmrusre thmmruser thmmreurs thmmreusr
thmmrerus thmmrersu thmmresru thmmresur thmmrreus thmmrresu thmmrrues thmmrruse thmmrrsue thmmrrseu thmmrseru
thmmrseur thmmrsreu thmmrsrue thmmrsure thmmrsuer thmmsuerr thmmsuerr thmmsurer thmmsurre thmmsurre thmmsurer
thmmseurr thmmseurr thmmserur thmmserru thmmserru thmmserur thmmsreur thmmsreru thmmsruer thmmsrure thmmsrrue
thmmsrreu thmmsreru thmmsreur thmmsrreu thmmsrrue thmmsrure thmmsruer thmermurs thmermusr thmermrus thmermrsu
thmermsru thmermsur thmerumrs thmerumsr thmerurms thmerursm thmerusrm thmerusmr thmerrums thmerrusm thmerrmus
thmerrmsu thmerrsmu thmerrsum thmersurm thmersumr thmersrum thmersrmu thmersmru thmersmur thmemrurs thmemrusr
thmemrrus thmemrrsu thmemrsru thmemrsur thmemurrs thmemursr thmemurrs thmemursr thmemusrr thmemusrr thmemrurs
thmemrusr thmemrrus thmemrrsu thmemrsru thmemrsur thmemsurr thmemsurr thmemsrur thmemsrru thmemsrru thmemsrur
thmeumrrs thmeumrsr thmeumrrs thmeumrsr thmeumsrr thmeumsrr thmeurmrs thmeurmsr thmeurrms thmeurrsm thmeursrm
thmeursmr thmeurrms thmeurrsm thmeurmrs thmeurmsr thmeursmr thmeursrm thmeusrrm thmeusrmr thmeusrrm thmeusrmr
thmeusmrr thmeusmrr thmermurs thmermusr thmermrus thmermrsu thmermsru thmermsur thmerumrs thmerumsr thmerurms
thmerursm thmerusrm thmerusmr thmerrums thmerrusm thmerrmus thmerrmsu thmerrsmu thmerrsum thmersurm thmersumr
thmersrum thmersrmu thmersmru thmersmur thmesmurr thmesmurr thmesmrur thmesmrru thmesmrru thmesmrur thmesumrr
thmesumrr thmesurmr thmesurrm thmesurrm thmesurmr thmesrumr thmesrurm thmesrmur thmesrmru thmesrrmu thmesrrum
thmesrurm thmesrumr thmesrrum thmesrrmu thmesrmru thmesrmur thmrrmeus thmrrmesu thmrrmues thmrrmuse thmrrmsue
thmrrmseu thmrremus thmrremsu thmrreums thmrreusm thmrresum thmrresmu thmrruems thmrruesm thmrrumes thmrrumse
thmrrusme thmrrusem thmrrseum thmrrsemu thmrrsuem thmrrsume thmrrsmue thmrrsmeu thmrmreus thmrmresu thmrmrues
thmrmruse thmrmrsue thmrmrseu thmrmerus thmrmersu thmrmeurs thmrmeusr thmrmesur thmrmesru thmrmuers thmrmuesr
thmrmures thmrmurse thmrmusre thmrmuser thmrmseur thmrmseru thmrmsuer thmrmsure thmrmsrue thmrmsreu thmremrus
thmremrsu thmremurs thmremusr thmremsur thmremsru thmrermus thmrermsu thmrerums thmrerusm thmrersum thmrersmu
thmreurms thmreursm thmreumrs thmreumsr thmreusmr thmreusrm thmresrum thmresrmu thmresurm thmresumr thmresmur
thmresmru thmrumers thmrumesr thmrumres thmrumrse thmrumsre thmrumser thmruemrs thmruemsr thmruerms thmruersm
thmruesrm thmruesmr thmrurems thmruresm thmrurmes thmrurmse thmrursme thmrursem thmruserm thmrusemr thmrusrem
thmrusrme thmrusmre thmrusmer thmrsmeur thmrsmeru thmrsmuer thmrsmure thmrsmrue thmrsmreu thmrsemur thmrsemru
thmrseumr thmrseurm thmrserum thmrsermu thmrsuemr thmrsuerm thmrsumer thmrsumre thmrsurme thmrsurem thmrsreum
thmrsremu thmrsruem thmrsrume thmrsrmue thmrsrmeu thmsrmeru thmsrmeur thmsrmreu thmsrmrue thmsrmure thmsrmuer
thmsremru thmsremur thmsrermu thmsrerum thmsreurm thmsreumr thmsrremu thmsrreum thmsrrmeu thmsrrmue thmsrrume
thmsrruem thmsruerm thmsruemr thmsrurem thmsrurme thmsrumre thmsrumer thmsmreru thmsmreur thmsmrreu thmsmrrue
thmsmrure thmsmruer thmsmerru thmsmerur thmsmerru thmsmerur thmsmeurr thmsmeurr thmsmreru thmsmreur thmsmrreu
thmsmrrue thmsmrure thmsmruer thmsmuerr thmsmuerr thmsmurer thmsmurre thmsmurre thmsmurer thmsemrru thmsemrur
thmsemrru thmsemrur thmsemurr thmsemurr thmsermru thmsermur thmserrmu thmserrum thmserurm thmserumr thmserrmu
thmserrum thmsermru thmsermur thmserumr thmserurm thmseurrm thmseurmr thmseurrm thmseurmr thmseumrr thmseumrr
thmsrmeru thmsrmeur thmsrmreu thmsrmrue thmsrmure thmsrmuer thmsremru thmsremur thmsrermu thmsrerum thmsreurm
thmsreumr thmsrremu thmsrreum thmsrrmeu thmsrrmue thmsrrume thmsrruem thmsruerm thmsruemr thmsrurem thmsrurme
thmsrumre thmsrumer thmsumerr thmsumerr thmsumrer thmsumrre thmsumrre thmsumrer thmsuemrr thmsuemrr thmsuermr
thmsuerrm thmsuerrm thmsuermr thmsuremr thmsurerm thmsurmer thmsurmre thmsurrme thmsurrem thmsurerm thmsuremr
thmsurrem thmsurrme thmsurmre thmsurmer thmumrers thmumresr thmumrres thmumrrse thmumrsre thmumrser thmumerrs
thmumersr thmumerrs thmumersr thmumesrr thmumesrr thmumrers thmumresr thmumrres thmumrrse thmumrsre thmumrser
thmumserr thmumserr thmumsrer thmumsrre thmumsrre thmumsrer thmurmers thmurmesr thmurmres thmurmrse thmurmsre
thmurmser thmuremrs thmuremsr thmurerms thmurersm thmuresrm thmuresmr thmurrems thmurresm thmurrmes thmurrmse
thmurrsme thmurrsem thmurserm thmursemr thmursrem thmursrme thmursmre thmursmer thmuermrs thmuermsr thmuerrms
thmuerrsm thmuersrm thmuersmr thmuemrrs thmuemrsr thmuemrrs thmuemrsr thmuemsrr thmuemsrr thmuermrs thmuermsr
thmuerrms thmuerrsm thmuersrm thmuersmr thmuesmrr thmuesmrr thmuesrmr thmuesrrm thmuesrrm thmuesrmr thmurrems
thmurresm thmurrmes thmurrmse thmurrsme thmurrsem thmurerms thmurersm thmuremrs thmuremsr thmuresmr thmuresrm
thmurmers thmurmesr thmurmres thmurmrse thmurmsre thmurmser thmursemr thmurserm thmursmer thmursmre thmursrme
thmursrem thmusrerm thmusremr thmusrrem thmusrrme thmusrmre thmusrmer thmuserrm thmusermr thmuserrm thmusermr
thmusemrr thmusemrr thmusrerm thmusremr thmusrrem thmusrrme thmusrmre thmusrmer thmusmerr thmusmerr thmusmrer
thmusmrre thmusmrre thmusmrer thmmurers thmmuresr thmmurres thmmurrse thmmursre thmmurser thmmuerrs thmmuersr
thmmuerrs thmmuersr thmmuesrr thmmuesrr thmmurers thmmuresr thmmurres thmmurrse thmmursre thmmurser thmmuserr
thmmuserr thmmusrer thmmusrre thmmusrre thmmusrer thmmruers thmmruesr thmmrures thmmrurse thmmrusre thmmruser
thmmreurs thmmreusr thmmrerus thmmrersu thmmresru thmmresur thmmrreus thmmrresu thmmrrues thmmrruse thmmrrsue
thmmrrseu thmmrseru thmmrseur thmmrsreu thmmrsrue thmmrsure thmmrsuer thmmerurs thmmerusr thmmerrus thmmerrsu
thmmersru thmmersur thmmeurrs thmmeursr thmmeurrs thmmeursr thmmeusrr thmmeusrr thmmerurs thmmerusr thmmerrus
thmmerrsu thmmersru thmmersur thmmesurr thmmesurr thmmesrur thmmesrru thmmesrru thmmesrur thmmrreus thmmrresu
thmmrrues thmmrruse thmmrrsue thmmrrseu thmmrerus thmmrersu thmmreurs thmmreusr thmmresur thmmresru thmmruers
thmmruesr thmmrures thmmrurse thmmrusre thmmruser thmmrseur thmmrseru thmmrsuer thmmrsure thmmrsrue thmmrsreu
thmmsreru thmmsreur thmmsrreu thmmsrrue thmmsrure thmmsruer thmmserru thmmserur thmmserru thmmserur thmmseurr
thmmseurr thmmsreru thmmsreur thmmsrreu thmmsrrue thmmsrure thmmsruer thmmsuerr thmmsuerr thmmsurer thmmsurre
thmmsurre thmmsurer thmrmuers thmrmuesr thmrmures thmrmurse thmrmusre thmrmuser thmrmeurs thmrmeusr thmrmerus
thmrmersu thmrmesru thmrmesur thmrmreus thmrmresu thmrmrues thmrmruse thmrmrsue thmrmrseu thmrmseru thmrmseur
thmrmsreu thmrmsrue thmrmsure thmrmsuer thmrumers thmrumesr thmrumres thmrumrse thmrumsre thmrumser thmruemrs
thmruemsr thmruerms thmruersm thmruesrm thmruesmr thmrurems thmruresm thmrurmes thmrurmse thmrursme thmrursem
thmruserm thmrusemr thmrusrem thmrusrme thmrusmre thmrusmer thmreumrs thmreumsr thmreurms thmreursm thmreusrm
thmreusmr thmremurs thmremusr thmremrus thmremrsu thmremsru thmremsur thmrermus thmrermsu thmrerums thmrerusm
thmrersum thmrersmu thmresmru thmresmur thmresrmu thmresrum thmresurm thmresumr thmrruems thmrruesm thmrrumes
thmrrumse thmrrusme thmrrusem thmrreums thmrreusm thmrremus thmrremsu thmrresmu thmrresum thmrrmeus thmrrmesu
thmrrmues thmrrmuse thmrrmsue thmrrmseu thmrrsemu thmrrseum thmrrsmeu thmrrsmue thmrrsume thmrrsuem thmrsuerm
thmrsuemr thmrsurem thmrsurme thmrsumre thmrsumer thmrseurm thmrseumr thmrserum thmrsermu thmrsemru thmrsemur
thmrsreum thmrsremu thmrsruem thmrsrume thmrsrmue thmrsrmeu thmrsmeru thmrsmeur thmrsmreu thmrsmrue thmrsmure
thmrsmuer thmemrurs thmemrusr thmemrrus thmemrrsu thmemrsru thmemrsur thmemurrs thmemursr thmemurrs thmemursr
thmemusrr thmemusrr thmemrurs thmemrusr thmemrrus thmemrrsu thmemrsru thmemrsur thmemsurr thmemsurr thmemsrur
thmemsrru thmemsrru thmemsrur thmermurs thmermusr thmermrus thmermrsu thmermsru thmermsur thmerumrs thmerumsr
thmerurms thmerursm thmerusrm thmerusmr thmerrums thmerrusm thmerrmus thmerrmsu thmerrsmu thmerrsum thmersurm
thmersumr thmersrum thmersrmu thmersmru thmersmur thmeurmrs thmeurmsr thmeurrms thmeurrsm thmeursrm thmeursmr
thmeumrrs thmeumrsr thmeumrrs thmeumrsr thmeumsrr thmeumsrr thmeurmrs thmeurmsr thmeurrms thmeurrsm thmeursrm
thmeursmr thmeusmrr thmeusmrr thmeusrmr thmeusrrm thmeusrrm thmeusrmr thmerrums thmerrusm thmerrmus thmerrmsu
thmerrsmu thmerrsum thmerurms thmerursm thmerumrs thmerumsr thmerusmr thmerusrm thmermurs thmermusr thmermrus
thmermrsu thmermsru thmermsur thmersumr thmersurm thmersmur thmersmru thmersrmu thmersrum thmesrurm thmesrumr
thmesrrum thmesrrmu thmesrmru thmesrmur thmesurrm thmesurmr thmesurrm thmesurmr thmesumrr thmesumrr thmesrurm
thmesrumr thmesrrum thmesrrmu thmesrmru thmesrmur thmesmurr thmesmurr thmesmrur thmesmrru thmesmrru thmesmrur
thmrmreus thmrmresu thmrmrues thmrmruse thmrmrsue thmrmrseu thmrmerus thmrmersu thmrmeurs thmrmeusr thmrmesur
thmrmesru thmrmuers thmrmuesr thmrmures thmrmurse thmrmusre thmrmuser thmrmseur thmrmseru thmrmsuer thmrmsure
thmrmsrue thmrmsreu thmrrmeus thmrrmesu thmrrmues thmrrmuse thmrrmsue thmrrmseu thmrremus thmrremsu thmrreums
thmrreusm thmrresum thmrresmu thmrruems thmrruesm thmrrumes thmrrumse thmrrusme thmrrusem thmrrseum thmrrsemu
thmrrsuem thmrrsume thmrrsmue thmrrsmeu thmrermus thmrermsu thmrerums thmrerusm thmrersum thmrersmu thmremrus
thmremrsu thmremurs thmremusr thmremsur thmremsru thmreumrs thmreumsr thmreurms thmreursm thmreusrm thmreusmr
thmresmur thmresmru thmresumr thmresurm thmresrum thmresrmu thmrurems thmruresm thmrurmes thmrurmse thmrursme
thmrursem thmruerms thmruersm thmruemrs thmruemsr thmruesmr thmruesrm thmrumers thmrumesr thmrumres thmrumrse
thmrumsre thmrumser thmrusemr thmruserm thmrusmer thmrusmre thmrusrme thmrusrem thmrsreum thmrsremu thmrsruem
thmrsrume thmrsrmue thmrsrmeu thmrserum thmrsermu thmrseurm thmrseumr thmrsemur thmrsemru thmrsuerm thmrsuemr
thmrsurem thmrsurme thmrsumre thmrsumer thmrsmeur thmrsmeru thmrsmuer thmrsmure thmrsmrue thmrsmreu thmsmreru
thmsmreur thmsmrreu thmsmrrue thmsmrure thmsmruer thmsmerru thmsmerur thmsmerru thmsmerur thmsmeurr thmsmeurr
thmsmreru thmsmreur thmsmrreu thmsmrrue thmsmrure thmsmruer thmsmuerr thmsmuerr thmsmurer thmsmurre thmsmurre
thmsmurer thmsrmeru thmsrmeur thmsrmreu thmsrmrue thmsrmure thmsrmuer thmsremru thmsremur thmsrermu thmsrerum
thmsreurm thmsreumr thmsrremu thmsrreum thmsrrmeu thmsrrmue thmsrrume thmsrruem thmsruerm thmsruemr thmsrurem
thmsrurme thmsrumre thmsrumer thmsermru thmsermur thmserrmu thmserrum thmserurm thmserumr thmsemrru thmsemrur
thmsemrru thmsemrur thmsemurr thmsemurr thmsermru thmsermur thmserrmu thmserrum thmserurm thmserumr thmseumrr
thmseumrr thmseurmr thmseurrm thmseurrm thmseurmr thmsrremu thmsrreum thmsrrmeu thmsrrmue thmsrrume thmsrruem
thmsrermu thmsrerum thmsremru thmsremur thmsreumr thmsreurm thmsrmeru thmsrmeur thmsrmreu thmsrmrue thmsrmure
thmsrmuer thmsruemr thmsruerm thmsrumer thmsrumre thmsrurme thmsrurem thmsurerm thmsuremr thmsurrem thmsurrme
thmsurmre thmsurmer thmsuerrm thmsuermr thmsuerrm thmsuermr thmsuemrr thmsuemrr thmsurerm thmsuremr thmsurrem
thmsurrme thmsurmre thmsurmer thmsumerr thmsumerr thmsumrer thmsumrre thmsumrre thmsumrer theummrrs theummrsr
theummrrs theummrsr theummsrr theummsrr theumrmrs theumrmsr theumrrms theumrrsm theumrsrm theumrsmr theumrrms
theumrrsm theumrmrs theumrmsr theumrsmr theumrsrm theumsrrm theumsrmr theumsrrm theumsrmr theumsmrr theumsmrr
theummrrs theummrsr theummrrs theummrsr theummsrr theummsrr theumrmrs theumrmsr theumrrms theumrrsm theumrsrm
theumrsmr theumrrms theumrrsm theumrmrs theumrmsr theumrsmr theumrsrm theumsrrm theumsrmr theumsrrm theumsrmr
theumsmrr theumsmrr theurmmrs theurmmsr theurmrms theurmrsm theurmsrm theurmsmr theurmmrs theurmmsr theurmrms
theurmrsm theurmsrm theurmsmr theurrmms theurrmsm theurrmms theurrmsm theurrsmm theurrsmm theursmrm theursmmr
theursrmm theursrmm theursmrm theursmmr theurmrms theurmrsm theurmmrs theurmmsr theurmsmr theurmsrm theurrmms
theurrmsm theurrmms theurrmsm theurrsmm theurrsmm theurmrms theurmrsm theurmmrs theurmmsr theurmsmr theurmsrm
theursrmm theursrmm theursmrm theursmmr theursmmr theursmrm theusmrrm theusmrmr theusmrrm theusmrmr theusmmrr
theusmmrr theusrmrm theusrmmr theusrrmm theusrrmm theusrmrm theusrmmr theusrrmm theusrrmm theusrmrm theusrmmr
theusrmmr theusrmrm theusmrrm theusmrmr theusmrrm theusmrmr theusmmrr theusmmrr themumrrs themumrsr themumrrs
themumrsr themumsrr themumsrr themurmrs themurmsr themurrms themurrsm themursrm themursmr themurrms themurrsm
themurmrs themurmsr themursmr themursrm themusrrm themusrmr themusrrm themusrmr themusmrr themusmrr themmurrs
themmursr themmurrs themmursr themmusrr themmusrr themmrurs themmrusr themmrrus themmrrsu themmrsru themmrsur
themmrrus themmrrsu themmrurs themmrusr themmrsur themmrsru themmsrru themmsrur themmsrru themmsrur themmsurr
themmsurr themrmurs themrmusr themrmrus themrmrsu themrmsru themrmsur themrumrs themrumsr themrurms themrursm
themrusrm themrusmr themrrums themrrusm themrrmus themrrmsu themrrsmu themrrsum themrsurm themrsumr themrsrum
themrsrmu themrsmru themrsmur themrmrus themrmrsu themrmurs themrmusr themrmsur themrmsru themrrmus themrrmsu
themrrums themrrusm themrrsum themrrsmu themrurms themrursm themrumrs themrumsr themrusmr themrusrm themrsrum
themrsrmu themrsurm themrsumr themrsmur themrsmru themsmrru themsmrur themsmrru themsmrur themsmurr themsmurr
themsrmru themsrmur themsrrmu themsrrum themsrurm themsrumr themsrrmu themsrrum themsrmru themsrmur themsrumr
themsrurm themsurrm themsurmr themsurrm themsurmr themsumrr themsumrr themmurrs themmursr themmurrs themmursr
themmusrr themmusrr themmrurs themmrusr themmrrus themmrrsu themmrsru themmrsur themmrrus themmrrsu themmrurs
themmrusr themmrsur themmrsru themmsrru themmsrur themmsrru themmsrur themmsurr themmsurr themumrrs themumrsr
themumrrs themumrsr themumsrr themumsrr themurmrs themurmsr themurrms themurrsm themursrm themursmr themurrms
themurrsm themurmrs themurmsr themursmr themursrm themusrrm themusrmr themusrrm themusrmr themusmrr themusmrr
themrumrs themrumsr themrurms themrursm themrusrm themrusmr themrmurs themrmusr themrmrus themrmrsu themrmsru
themrmsur themrrmus themrrmsu themrrums themrrusm themrrsum themrrsmu themrsmru themrsmur themrsrmu themrsrum
themrsurm themrsumr themrurms themrursm themrumrs themrumsr themrusmr themrusrm themrrums themrrusm themrrmus
themrrmsu themrrsmu themrrsum themrmrus themrmrsu themrmurs themrmusr themrmsur themrmsru themrsrmu themrsrum
themrsmru themrsmur themrsumr themrsurm themsurrm themsurmr themsurrm themsurmr themsumrr themsumrr themsrurm
themsrumr themsrrum themsrrmu themsrmru themsrmur themsrrum themsrrmu themsrurm themsrumr themsrmur themsrmru
themsmrru themsmrur themsmrru themsmrur themsmurr themsmurr thermmurs thermmusr thermmrus thermmrsu thermmsru
thermmsur thermumrs thermumsr thermurms thermursm thermusrm thermusmr thermrums thermrusm thermrmus thermrmsu
thermrsmu thermrsum thermsurm thermsumr thermsrum thermsrmu thermsmru thermsmur thermmurs thermmusr thermmrus
thermmrsu thermmsru thermmsur thermumrs thermumsr thermurms thermursm thermusrm thermusmr thermrums thermrusm
thermrmus thermrmsu thermrsmu thermrsum thermsurm thermsumr thermsrum thermsrmu thermsmru thermsmur therummrs
therummsr therumrms therumrsm therumsrm therumsmr therummrs therummsr therumrms therumrsm therumsrm therumsmr
therurmms therurmsm therurmms therurmsm therursmm therursmm therusmrm therusmmr therusrmm therusrmm therusmrm
therusmmr therrmums therrmusm therrmmus therrmmsu therrmsmu therrmsum therrumms therrumsm therrumms therrumsm
therrusmm therrusmm therrmums therrmusm therrmmus therrmmsu therrmsmu therrmsum therrsumm therrsumm therrsmum
therrsmmu therrsmmu therrsmum thersmurm thersmumr thersmrum thersmrmu thersmmru thersmmur thersumrm thersummr
thersurmm thersurmm thersumrm thersummr thersrumm thersrumm thersrmum thersrmmu thersrmmu thersrmum thersmurm
thersmumr thersmrum thersmrmu thersmmru thersmmur thermmrus thermmrsu thermmurs thermmusr thermmsur thermmsru
thermrmus thermrmsu thermrums thermrusm thermrsum thermrsmu thermurms thermursm thermumrs thermumsr thermusmr
thermusrm thermsrum thermsrmu thermsurm thermsumr thermsmur thermsmru thermmrus thermmrsu thermmurs thermmusr
thermmsur thermmsru thermrmus thermrmsu thermrums thermrusm thermrsum thermrsmu thermurms thermursm thermumrs
thermumsr thermusmr thermusrm thermsrum thermsrmu thermsurm thermsumr thermsmur thermsmru therrmmus therrmmsu
therrmums therrmusm therrmsum therrmsmu therrmmus therrmmsu therrmums therrmusm therrmsum therrmsmu therrumms
therrumsm therrumms therrumsm therrusmm therrusmm therrsmum therrsmmu therrsumm therrsumm therrsmum therrsmmu
therumrms therumrsm therummrs therummsr therumsmr therumsrm therurmms therurmsm therurmms therurmsm therursmm
therursmm therumrms therumrsm therummrs therummsr therumsmr therumsrm therusrmm therusrmm therusmrm therusmmr
therusmmr therusmrm thersmrum thersmrmu thersmurm thersmumr thersmmur thersmmru thersrmum thersrmmu thersrumm
thersrumm thersrmum thersrmmu thersurmm thersurmm thersumrm thersummr thersummr thersumrm thersmrum thersmrmu
thersmurm thersmumr thersmmur thersmmru thesmmrru thesmmrur thesmmrru thesmmrur thesmmurr thesmmurr thesmrmru
thesmrmur thesmrrmu thesmrrum thesmrurm thesmrumr thesmrrmu thesmrrum thesmrmru thesmrmur thesmrumr thesmrurm
thesmurrm thesmurmr thesmurrm thesmurmr thesmumrr thesmumrr thesmmrru thesmmrur thesmmrru thesmmrur thesmmurr
thesmmurr thesmrmru thesmrmur thesmrrmu thesmrrum thesmrurm thesmrumr thesmrrmu thesmrrum thesmrmru thesmrmur
thesmrumr thesmrurm thesmurrm thesmurmr thesmurrm thesmurmr thesmumrr thesmumrr thesrmmru thesrmmur thesrmrmu
thesrmrum thesrmurm thesrmumr thesrmmru thesrmmur thesrmrmu thesrmrum thesrmurm thesrmumr thesrrmmu thesrrmum
thesrrmmu thesrrmum thesrrumm thesrrumm thesrumrm thesrummr thesrurmm thesrurmm thesrumrm thesrummr thesrmrmu
thesrmrum thesrmmru thesrmmur thesrmumr thesrmurm thesrrmmu thesrrmum thesrrmmu thesrrmum thesrrumm thesrrumm
thesrmrmu thesrmrum thesrmmru thesrmmur thesrmumr thesrmurm thesrurmm thesrurmm thesrumrm thesrummr thesrummr
thesrumrm thesumrrm thesumrmr thesumrrm thesumrmr thesummrr thesummrr thesurmrm thesurmmr thesurrmm thesurrmm
thesurmrm thesurmmr thesurrmm thesurrmm thesurmrm thesurmmr thesurmmr thesurmrm thesumrrm thesumrmr thesumrrm
thesumrmr thesummrr thesummrr thrummers thrummesr thrummres thrummrse thrummsre thrummser thrumemrs thrumemsr
thrumerms thrumersm thrumesrm thrumesmr thrumrems thrumresm thrumrmes thrumrmse thrumrsme thrumrsem thrumserm
thrumsemr thrumsrem thrumsrme thrumsmre thrumsmer thrummers thrummesr thrummres thrummrse thrummsre thrummser
thrumemrs thrumemsr thrumerms thrumersm thrumesrm thrumesmr thrumrems thrumresm thrumrmes thrumrmse thrumrsme
thrumrsem thrumserm thrumsemr thrumsrem thrumsrme thrumsmre thrumsmer thruemmrs thruemmsr thruemrms thruemrsm
thruemsrm thruemsmr thruemmrs thruemmsr thruemrms thruemrsm thruemsrm thruemsmr thruermms thruermsm thruermms
thruermsm thruersmm thruersmm thruesmrm thruesmmr thruesrmm thruesrmm thruesmrm thruesmmr thrurmems thrurmesm
thrurmmes thrurmmse thrurmsme thrurmsem thruremms thruremsm thruremms thruremsm thruresmm thruresmm thrurmems
thrurmesm thrurmmes thrurmmse thrurmsme thrurmsem thrursemm thrursemm thrursmem thrursmme thrursmme thrursmem
thrusmerm thrusmemr thrusmrem thrusmrme thrusmmre thrusmmer thrusemrm thrusemmr thrusermm thrusermm thrusemrm
thrusemmr thrusremm thrusremm thrusrmem thrusrmme thrusrmme thrusrmem thrusmerm thrusmemr thrusmrem thrusmrme
thrusmmre thrusmmer thrmumers thrmumesr thrmumres thrmumrse thrmumsre thrmumser thrmuemrs thrmuemsr thrmuerms
thrmuersm thrmuesrm thrmuesmr thrmurems thrmuresm thrmurmes thrmurmse thrmursme thrmursem thrmuserm thrmusemr
thrmusrem thrmusrme thrmusmre thrmusmer thrmmuers thrmmuesr thrmmures thrmmurse thrmmusre thrmmuser thrmmeurs
thrmmeusr thrmmerus thrmmersu thrmmesru thrmmesur thrmmreus thrmmresu thrmmrues thrmmruse thrmmrsue thrmmrseu
thrmmseru thrmmseur thrmmsreu thrmmsrue thrmmsure thrmmsuer thrmemurs thrmemusr thrmemrus thrmemrsu thrmemsru
thrmemsur thrmeumrs thrmeumsr thrmeurms thrmeursm thrmeusrm thrmeusmr thrmerums thrmerusm thrmermus thrmermsu
thrmersmu thrmersum thrmesurm thrmesumr thrmesrum thrmesrmu thrmesmru thrmesmur thrmrmeus thrmrmesu thrmrmues
thrmrmuse thrmrmsue thrmrmseu thrmremus thrmremsu thrmreums thrmreusm thrmresum thrmresmu thrmruems thrmruesm
thrmrumes thrmrumse thrmrusme thrmrusem thrmrseum thrmrsemu thrmrsuem thrmrsume thrmrsmue thrmrsmeu thrmsmeru
thrmsmeur thrmsmreu thrmsmrue thrmsmure thrmsmuer thrmsemru thrmsemur thrmsermu thrmserum thrmseurm thrmseumr
thrmsremu thrmsreum thrmsrmeu thrmsrmue thrmsrume thrmsruem thrmsuerm thrmsuemr thrmsurem thrmsurme thrmsumre
thrmsumer thrmmuers thrmmuesr thrmmures thrmmurse thrmmusre thrmmuser thrmmeurs thrmmeusr thrmmerus thrmmersu
thrmmesru thrmmesur thrmmreus thrmmresu thrmmrues thrmmruse thrmmrsue thrmmrseu thrmmseru thrmmseur thrmmsreu
thrmmsrue thrmmsure thrmmsuer thrmumers thrmumesr thrmumres thrmumrse thrmumsre thrmumser thrmuemrs thrmuemsr
thrmuerms thrmuersm thrmuesrm thrmuesmr thrmurems thrmuresm thrmurmes thrmurmse thrmursme thrmursem thrmuserm
thrmusemr thrmusrem thrmusrme thrmusmre thrmusmer thrmeumrs thrmeumsr thrmeurms thrmeursm thrmeusrm thrmeusmr
thrmemurs thrmemusr thrmemrus thrmemrsu thrmemsru thrmemsur thrmermus thrmermsu thrmerums thrmerusm thrmersum
thrmersmu thrmesmru thrmesmur thrmesrmu thrmesrum thrmesurm thrmesumr thrmruems thrmruesm thrmrumes thrmrumse
thrmrusme thrmrusem thrmreums thrmreusm thrmremus thrmremsu thrmresmu thrmresum thrmrmeus thrmrmesu thrmrmues
thrmrmuse thrmrmsue thrmrmseu thrmrsemu thrmrseum thrmrsmeu thrmrsmue thrmrsume thrmrsuem thrmsuerm thrmsuemr
thrmsurem thrmsurme thrmsumre thrmsumer thrmseurm thrmseumr thrmserum thrmsermu thrmsemru thrmsemur thrmsreum
thrmsremu thrmsruem thrmsrume thrmsrmue thrmsrmeu thrmsmeru thrmsmeur thrmsmreu thrmsmrue thrmsmure thrmsmuer
thremmurs thremmusr thremmrus thremmrsu thremmsru thremmsur thremumrs thremumsr thremurms thremursm thremusrm
thremusmr thremrums thremrusm thremrmus thremrmsu thremrsmu thremrsum thremsurm thremsumr thremsrum thremsrmu
thremsmru thremsmur thremmurs thremmusr thremmrus thremmrsu thremmsru thremmsur thremumrs thremumsr thremurms
thremursm thremusrm thremusmr thremrums thremrusm thremrmus thremrmsu thremrsmu thremrsum thremsurm thremsumr
thremsrum thremsrmu thremsmru thremsmur threummrs threummsr threumrms threumrsm threumsrm threumsmr threummrs
threummsr threumrms threumrsm threumsrm threumsmr threurmms threurmsm threurmms threurmsm threursmm threursmm
threusmrm threusmmr threusrmm threusrmm threusmrm threusmmr thrermums thrermusm thrermmus thrermmsu thrermsmu
thrermsum threrumms threrumsm threrumms threrumsm threrusmm threrusmm thrermums thrermusm thrermmus thrermmsu
thrermsmu thrermsum thrersumm thrersumm thrersmum thrersmmu thrersmmu thrersmum thresmurm thresmumr thresmrum
thresmrmu thresmmru thresmmur thresumrm thresummr thresurmm thresurmm thresumrm thresummr thresrumm thresrumm
thresrmum thresrmmu thresrmmu thresrmum thresmurm thresmumr thresmrum thresmrmu thresmmru thresmmur thrrmmeus
thrrmmesu thrrmmues thrrmmuse thrrmmsue thrrmmseu thrrmemus thrrmemsu thrrmeums thrrmeusm thrrmesum thrrmesmu
thrrmuems thrrmuesm thrrmumes thrrmumse thrrmusme thrrmusem thrrmseum thrrmsemu thrrmsuem thrrmsume thrrmsmue
thrrmsmeu thrrmmeus thrrmmesu thrrmmues thrrmmuse thrrmmsue thrrmmseu thrrmemus thrrmemsu thrrmeums thrrmeusm
thrrmesum thrrmesmu thrrmuems thrrmuesm thrrmumes thrrmumse thrrmusme thrrmusem thrrmseum thrrmsemu thrrmsuem
thrrmsume thrrmsmue thrrmsmeu thrremmus thrremmsu thrremums thrremusm thrremsum thrremsmu thrremmus thrremmsu
thrremums thrremusm thrremsum thrremsmu thrreumms thrreumsm thrreumms thrreumsm thrreusmm thrreusmm thrresmum
thrresmmu thrresumm thrresumm thrresmum thrresmmu thrrumems thrrumesm thrrummes thrrummse thrrumsme thrrumsem
thrruemms thrruemsm thrruemms thrruemsm thrruesmm thrruesmm thrrumems thrrumesm thrrummes thrrummse thrrumsme
thrrumsem thrrusemm thrrusemm thrrusmem thrrusmme thrrusmme thrrusmem thrrsmeum thrrsmemu thrrsmuem thrrsmume
thrrsmmue thrrsmmeu thrrsemum thrrsemmu thrrseumm thrrseumm thrrsemum thrrsemmu thrrsuemm thrrsuemm thrrsumem
thrrsumme thrrsumme thrrsumem thrrsmeum thrrsmemu thrrsmuem thrrsmume thrrsmmue thrrsmmeu thrsmmeru thrsmmeur
thrsmmreu thrsmmrue thrsmmure thrsmmuer thrsmemru thrsmemur thrsmermu thrsmerum thrsmeurm thrsmeumr thrsmremu
thrsmreum thrsmrmeu thrsmrmue thrsmrume thrsmruem thrsmuerm thrsmuemr thrsmurem thrsmurme thrsmumre thrsmumer
thrsmmeru thrsmmeur thrsmmreu thrsmmrue thrsmmure thrsmmuer thrsmemru thrsmemur thrsmermu thrsmerum thrsmeurm
thrsmeumr thrsmremu thrsmreum thrsmrmeu thrsmrmue thrsmrume thrsmruem thrsmuerm thrsmuemr thrsmurem thrsmurme
thrsmumre thrsmumer thrsemmru thrsemmur thrsemrmu thrsemrum thrsemurm thrsemumr thrsemmru thrsemmur thrsemrmu
thrsemrum thrsemurm thrsemumr thrsermmu thrsermum thrsermmu thrsermum thrserumm thrserumm thrseumrm thrseummr
thrseurmm thrseurmm thrseumrm thrseummr thrsrmemu thrsrmeum thrsrmmeu thrsrmmue thrsrmume thrsrmuem thrsremmu
thrsremum thrsremmu thrsremum thrsreumm thrsreumm thrsrmemu thrsrmeum thrsrmmeu thrsrmmue thrsrmume thrsrmuem
thrsruemm thrsruemm thrsrumem thrsrumme thrsrumme thrsrumem thrsumerm thrsumemr thrsumrem thrsumrme thrsummre
thrsummer thrsuemrm thrsuemmr thrsuermm thrsuermm thrsuemrm thrsuemmr thrsuremm thrsuremm thrsurmem thrsurmme
thrsurmme thrsurmem thrsumerm thrsumemr thrsumrem thrsumrme thrsummre thrsummer thsummerr thsummerr thsummrer
thsummrre thsummrre thsummrer thsumemrr thsumemrr thsumermr thsumerrm thsumerrm thsumermr thsumremr thsumrerm
thsumrmer thsumrmre thsumrrme thsumrrem thsumrerm thsumremr thsumrrem thsumrrme thsumrmre thsumrmer thsummerr
thsummerr thsummrer thsummrre thsummrre thsummrer thsumemrr thsumemrr thsumermr thsumerrm thsumerrm thsumermr
thsumremr thsumrerm thsumrmer thsumrmre thsumrrme thsumrrem thsumrerm thsumremr thsumrrem thsumrrme thsumrmre
thsumrmer thsuemmrr thsuemmrr thsuemrmr thsuemrrm thsuemrrm thsuemrmr thsuemmrr thsuemmrr thsuemrmr thsuemrrm
thsuemrrm thsuemrmr thsuermmr thsuermrm thsuermmr thsuermrm thsuerrmm thsuerrmm thsuermrm thsuermmr thsuerrmm
thsuerrmm thsuermrm thsuermmr thsurmemr thsurmerm thsurmmer thsurmmre thsurmrme thsurmrem thsuremmr thsuremrm
thsuremmr thsuremrm thsurermm thsurermm thsurmemr thsurmerm thsurmmer thsurmmre thsurmrme thsurmrem thsurremm
thsurremm thsurrmem thsurrmme thsurrmme thsurrmem thsurmerm thsurmemr thsurmrem thsurmrme thsurmmre thsurmmer
thsuremrm thsuremmr thsurermm thsurermm thsuremrm thsuremmr thsurremm thsurremm thsurrmem thsurrmme thsurrmme
thsurrmem thsurmerm thsurmemr thsurmrem thsurmrme thsurmmre thsurmmer thsmumerr thsmumerr thsmumrer thsmumrre
thsmumrre thsmumrer thsmuemrr thsmuemrr thsmuermr thsmuerrm thsmuerrm thsmuermr thsmuremr thsmurerm thsmurmer
thsmurmre thsmurrme thsmurrem thsmurerm thsmuremr thsmurrem thsmurrme thsmurmre thsmurmer thsmmuerr thsmmuerr
thsmmurer thsmmurre thsmmurre thsmmurer thsmmeurr thsmmeurr thsmmerur thsmmerru thsmmerru thsmmerur thsmmreur
thsmmreru thsmmruer thsmmrure thsmmrrue thsmmrreu thsmmreru thsmmreur thsmmrreu thsmmrrue thsmmrure thsmmruer
thsmemurr thsmemurr thsmemrur thsmemrru thsmemrru thsmemrur thsmeumrr thsmeumrr thsmeurmr thsmeurrm thsmeurrm
thsmeurmr thsmerumr thsmerurm thsmermur thsmermru thsmerrmu thsmerrum thsmerurm thsmerumr thsmerrum thsmerrmu
thsmermru thsmermur thsmrmeur thsmrmeru thsmrmuer thsmrmure thsmrmrue thsmrmreu thsmremur thsmremru thsmreumr
thsmreurm thsmrerum thsmrermu thsmruemr thsmruerm thsmrumer thsmrumre thsmrurme thsmrurem thsmrreum thsmrremu
thsmrruem thsmrrume thsmrrmue thsmrrmeu thsmrmeru thsmrmeur thsmrmreu thsmrmrue thsmrmure thsmrmuer thsmremru
thsmremur thsmrermu thsmrerum thsmreurm thsmreumr thsmrremu thsmrreum thsmrrmeu thsmrrmue thsmrrume thsmrruem
thsmruerm thsmruemr thsmrurem thsmrurme thsmrumre thsmrumer thsmmuerr thsmmuerr thsmmurer thsmmurre thsmmurre
thsmmurer thsmmeurr thsmmeurr thsmmerur thsmmerru thsmmerru thsmmerur thsmmreur thsmmreru thsmmruer thsmmrure
thsmmrrue thsmmrreu thsmmreru thsmmreur thsmmrreu thsmmrrue thsmmrure thsmmruer thsmumerr thsmumerr thsmumrer
thsmumrre thsmumrre thsmumrer thsmuemrr thsmuemrr thsmuermr thsmuerrm thsmuerrm thsmuermr thsmuremr thsmurerm
thsmurmer thsmurmre thsmurrme thsmurrem thsmurerm thsmuremr thsmurrem thsmurrme thsmurmre thsmurmer thsmeumrr
thsmeumrr thsmeurmr thsmeurrm thsmeurrm thsmeurmr thsmemurr thsmemurr thsmemrur thsmemrru thsmemrru thsmemrur
thsmermur thsmermru thsmerumr thsmerurm thsmerrum thsmerrmu thsmermru thsmermur thsmerrmu thsmerrum thsmerurm
thsmerumr thsmruemr thsmruerm thsmrumer thsmrumre thsmrurme thsmrurem thsmreumr thsmreurm thsmremur thsmremru
thsmrermu thsmrerum thsmrmeur thsmrmeru thsmrmuer thsmrmure thsmrmrue thsmrmreu thsmrremu thsmrreum thsmrrmeu
thsmrrmue thsmrrume thsmrruem thsmruerm thsmruemr thsmrurem thsmrurme thsmrumre thsmrumer thsmreurm thsmreumr
thsmrerum thsmrermu thsmremru thsmremur thsmrreum thsmrremu thsmrruem thsmrrume thsmrrmue thsmrrmeu thsmrmeru
thsmrmeur thsmrmreu thsmrmrue thsmrmure thsmrmuer thsemmurr thsemmurr thsemmrur thsemmrru thsemmrru thsemmrur
thsemumrr thsemumrr thsemurmr thsemurrm thsemurrm thsemurmr thsemrumr thsemrurm thsemrmur thsemrmru thsemrrmu
thsemrrum thsemrurm thsemrumr thsemrrum thsemrrmu thsemrmru thsemrmur thsemmurr thsemmurr thsemmrur thsemmrru
thsemmrru thsemmrur thsemumrr thsemumrr thsemurmr thsemurrm thsemurrm thsemurmr thsemrumr thsemrurm thsemrmur
thsemrmru thsemrrmu thsemrrum thsemrurm thsemrumr thsemrrum thsemrrmu thsemrmru thsemrmur thseummrr thseummrr
thseumrmr thseumrrm thseumrrm thseumrmr thseummrr thseummrr thseumrmr thseumrrm thseumrrm thseumrmr thseurmmr
thseurmrm thseurmmr thseurmrm thseurrmm thseurrmm thseurmrm thseurmmr thseurrmm thseurrmm thseurmrm thseurmmr
thsermumr thsermurm thsermmur thsermmru thsermrmu thsermrum thserummr thserumrm thserummr thserumrm thserurmm
thserurmm thsermumr thsermurm thsermmur thsermmru thsermrmu thsermrum thserrumm thserrumm thserrmum thserrmmu
thserrmmu thserrmum thsermurm thsermumr thsermrum thsermrmu thsermmru thsermmur thserumrm thserummr thserurmm
thserurmm thserumrm thserummr thserrumm thserrumm thserrmum thserrmmu thserrmmu thserrmum thsermurm thsermumr
thsermrum thsermrmu thsermmru thsermmur thsrmmeur thsrmmeru thsrmmuer thsrmmure thsrmmrue thsrmmreu thsrmemur
thsrmemru thsrmeumr thsrmeurm thsrmerum thsrmermu thsrmuemr thsrmuerm thsrmumer thsrmumre thsrmurme thsrmurem
thsrmreum thsrmremu thsrmruem thsrmrume thsrmrmue thsrmrmeu thsrmmeur thsrmmeru thsrmmuer thsrmmure thsrmmrue
thsrmmreu thsrmemur thsrmemru thsrmeumr thsrmeurm thsrmerum thsrmermu thsrmuemr thsrmuerm thsrmumer thsrmumre
thsrmurme thsrmurem thsrmreum thsrmremu thsrmruem thsrmrume thsrmrmue thsrmrmeu thsremmur thsremmru thsremumr
thsremurm thsremrum thsremrmu thsremmur thsremmru thsremumr thsremurm thsremrum thsremrmu thsreummr thsreumrm
thsreummr thsreumrm thsreurmm thsreurmm thsrermum thsrermmu thsrerumm thsrerumm thsrermum thsrermmu thsrumemr
thsrumerm thsrummer thsrummre thsrumrme thsrumrem thsruemmr thsruemrm thsruemmr thsruemrm thsruermm thsruermm
thsrumemr thsrumerm thsrummer thsrummre thsrumrme thsrumrem thsruremm thsruremm thsrurmem thsrurmme thsrurmme
thsrurmem thsrrmeum thsrrmemu thsrrmuem thsrrmume thsrrmmue thsrrmmeu thsrremum thsrremmu thsrreumm thsrreumm
thsrremum thsrremmu thsrruemm thsrruemm thsrrumem thsrrumme thsrrumme thsrrumem thsrrmeum thsrrmemu thsrrmuem
thsrrmume thsrrmmue thsrrmmeu thsrmmeru thsrmmeur thsrmmreu thsrmmrue thsrmmure thsrmmuer thsrmemru thsrmemur
thsrmermu thsrmerum thsrmeurm thsrmeumr thsrmremu thsrmreum thsrmrmeu thsrmrmue thsrmrume thsrmruem thsrmuerm
thsrmuemr thsrmurem thsrmurme thsrmumre thsrmumer thsrmmeru thsrmmeur thsrmmreu thsrmmrue thsrmmure thsrmmuer
thsrmemru thsrmemur thsrmermu thsrmerum thsrmeurm thsrmeumr thsrmremu thsrmreum thsrmrmeu thsrmrmue thsrmrume
thsrmruem thsrmuerm thsrmuemr thsrmurem thsrmurme thsrmumre thsrmumer thsremmru thsremmur thsremrmu thsremrum
thsremurm thsremumr thsremmru thsremmur thsremrmu thsremrum thsremurm thsremumr thsrermmu thsrermum thsrermmu
thsrermum thsrerumm thsrerumm thsreumrm thsreummr thsreurmm thsreurmm thsreumrm thsreummr thsrrmemu thsrrmeum
thsrrmmeu thsrrmmue thsrrmume thsrrmuem thsrremmu thsrremum thsrremmu thsrremum thsrreumm thsrreumm thsrrmemu
thsrrmeum thsrrmmeu thsrrmmue thsrrmume thsrrmuem thsrruemm thsrruemm thsrrumem thsrrumme thsrrumme thsrrumem
thsrumerm thsrumemr thsrumrem thsrumrme thsrummre thsrummer thsruemrm thsruemmr thsruermm thsruermm thsruemrm
thsruemmr thsruremm thsruremm thsrurmem thsrurmme thsrurmme thsrurmem thsrumerm thsrumemr thsrumrem thsrumrme
thsrummre thsrummer

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us