easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

phragmocyttarous

continuousities

hofner

polymastodon

mcgovern

palcy

terebellidae

dirunitas

knockando

forsitanque

carom

psiloceratid

sneezewort

nonconviction

frogging

dicastery

demeque

latherers


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: thievishness
cipher variations:
uijfwjtioftt vjkgxkujpguu wklhylvkqhvv xlmizmwlriww ymnjanxmsjxx
znokboyntkyy aoplcpzoulzz bpqmdqapvmaa cqrnerbqwnbb drsofscrxocc
estpgtdsypdd ftuqhuetzqee guvrivfuarff hvwsjwgvbsgg iwxtkxhwcthh
jxyulyixduii kyzvmzjyevjj lzawnakzfwkk mabxoblagxll nbcypcmbhymm
ocdzqdnciznn pdeareodjaoo qefbsfpekbpp rfgctgqflcqq sghduhrgmdrr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: thievishness
Cipher: gsrverhsmvhh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: thievishness
Cipher: BAABA AABBB ABAAA AABAA BBBAB ABAAA BAAAB AABBB ABBAA AABAA BAAAB BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: thievishness
cipher variations:
uijfwjtiofttgwznmzdwonddskpvcpnkovnneyfdsfxyodxxqmvlivhmolhhcaltylraotrracrjerlcojllmqhruhvqorvv
yexzkxfeozffksnhanpsohppwgdpqdzgopzziutxgtjuoxjjvjkgxkujpguuhxaonaexpoeetlqwdqolpwoofzgetgyzpeyy
rnwmjwinpmiidbmuzmsbpussbdskfsmdpkmmnrisviwrpswwzfyalygfpaggltoiboqtpiqqxheqreahpqaajvuyhukvpykk
wklhylvkqhvviybpobfyqpffumrxerpmqxppgahfuhzaqfzzsoxnkxjoqnjjecnvantcqvttcetlgtneqlnnosjtwjxsqtxx
agzbmzhgqbhhmupjcpruqjrryifrsfbiqrbbkwvzivlwqzllxlmizmwlriwwjzcqpcgzrqggvnsyfsqnryqqhbigviabrgaa
tpyolykprokkfdowboudrwuudfumhuofrmooptkuxkytruyybhacnaihrciinvqkdqsvrksszjgstgcjrscclxwajwmxramm
ymnjanxmsjxxkadrqdhasrhhwotzgtroszrricjhwjbcshbbuqzpmzlqspllgepxcpvesxvvegvnivpgsnppqulvylzusvzz
cibdobjisdjjowrlertwslttakhtuhdkstddmyxbkxnysbnnznokboyntkyylbesreibtsiixpuahusptassjdkixkcdticc
vraqnamrtqmmhfqydqwftywwfhwojwqhtoqqrvmwzmavtwaadjcepckjtekkpxsmfsuxtmuubliuvieltueenzyclyoztcoo
aoplcpzoulzzmcftsfjcutjjyqvbivtqubttkeljyldeujddwsbrobnsurnnigrzerxguzxxgixpkxriuprrswnxanbwuxbb
ekdfqdlkufllqytngtvyunvvcmjvwjfmuvffoazdmzpaudppbpqmdqapvmaandgutgkdvukkzrwcjwurvcuulfmkzmefvkee
xtcspcotvsoojhsafsyhvayyhjyqlysjvqsstxoybocxvyccflegremlvgmmrzuohuwzvowwdnkwxkgnvwggpbaenaqbveqq
cqrnerbqwnbboehvuhlewvllasxdkxvswdvvmgnlanfgwlffyudtqdpuwtppkitbgtziwbzzikzrmztkwrttuypzcpdywzdd
gmfhsfnmwhnnsavpivxawpxxeolxylhowxhhqcbfobrcwfrrdrsofscrxoccpfiwvimfxwmmbtyelywtxewwnhomboghxmgg
zveureqvxuqqljuchuajxcaajlasnaulxsuuvzqadqezxaeehngitgonxiootbwqjwybxqyyfpmyzmipxyiirdcgpcsdxgss
estpgtdsypddqgjxwjngyxnncuzfmzxuyfxxoipncphiynhhawfvsfrwyvrrmkvdivbkydbbkmbtobvmytvvwarberfaybff
iohjuhpoyjppucxrkxzcyrzzgqnzanjqyzjjsedhqdteyhttftuqhuetzqeerhkyxkohzyoodvagnayvzgyypjqodqijzoii
bxgwtgsxzwssnlwejwclzecclncupcwnzuwwxbscfsgbzcggjpikviqpzkqqvdyslyadzsaahroabokrzakktfeireufziuu
guvrivfuarffsilzylpiazppewbhobzwahzzqkrperjkapjjcyhxuhtyaxttomxfkxdmafddmodvqdxoavxxyctdgthcadhh
kqjlwjrqalrrweztmzbeatbbispbcplsabllugfjsfvgajvvhvwsjwgvbsggtjmazmqjbaqqfxcipcaxbiaarlsqfsklbqkk
dziyviuzbyuupnyglyenbgeenpewreypbwyyzduehuidbeiilrkmxksrbmssxfaunacfbuccjtqcdqmtbcmmvhgktgwhbkww
iwxtkxhwcthhuknbanrkcbrrgydjqdbycjbbsmtrgtlmcrlleajzwjvaczvvqozhmzfochffoqfxsfzqcxzzaevfivjecfjj
mslnyltscnttygbvobdgcvddkurdernucdnnwihluhxiclxxjxyulyixduiivlocbosldcsshzekreczdkcctnushumndsmm
fbkaxkwbdawwrpainagpdiggprgytgardyaabfwgjwkfdgkkntmozmutdouuzhcwpcehdweelvsefsovdeooxjimviyjdmyy
kyzvmzjyevjjwmpdcptmedttiaflsfdaeldduovtivnoetnngclbylxcebxxsqbjobhqejhhqshzuhbsezbbcgxhkxlgehll
ounpanvuepvvaidxqdfiexffmwtfgtpwefppykjnwjzkenzzlzawnakzfwkkxnqedqunfeuujbgmtgebfmeevpwujwopfuoo
hdmczmydfcyytrckpcirfkiirtiavictfaccdhyilymhfimmpvoqbowvfqwwbjeyregjfyggnxughuqxfgqqzlkoxkalfoaa
mabxoblagxllyorfervogfvvkchnuhfcgnffwqxvkxpqgvppiendanzegdzzusdlqdjsgljjsujbwjdugbddeizjmznigjnn
qwprcpxwgrxxckfzsfhkgzhhoyvhivryghrramlpylbmgpbbnbcypcmbhymmzpsgfswphgwwldiovigdhoggxrywlyqrhwqq
jfoeboafheaavtemrekthmkktvkcxkevhceefjaknaojhkoorxqsdqyxhsyydlgatgilhaiipzwijwszhissbnmqzmcnhqcc
ocdzqdnciznnaqthgtxqihxxmejpwjheiphhyszxmzrsixrrkgpfcpbgifbbwufnsfluinlluwldylfwidffgkblobpkilpp
syrterzyitzzemhbuhjmibjjqaxjkxtaijttconrandoirddpdeareodjaoobruihuyrjiyynfkqxkifjqiiztaynastjyss
lhqgdqchjgccxvgotgmvjommvxmezmgxjegghlcmpcqljmqqtzsufsazjuaafnicviknjckkrbyklyubjkuudposboepjsee
qefbsfpekbppcsvjivzskjzzoglryljgkrjjaubzobtukzttmirherdikhddywhpuhnwkpnnwynfanhykfhhimdnqdrmknrr
uatvgtbakvbbgojdwjlokdllsczlmzvcklvveqptcpfqktffrfgctgqflcqqdtwkjwatlkaaphmszmkhlskkbvcapcuvlauu
njsifsejlieezxiqvioxlqooxzogboizlgiijneoresnlossvbuwhucblwcchpkexkmplemmtdamnawdlmwwfrqudqgrlugg
sghduhrgmdrreuxlkxbumlbbqintanlimtllcwdbqdvwmbvvoktjgtfkmjffayjrwjpymrppyaphcpjamhjjkofpsftomptt
wcvxivdcmxddiqlfylnqmfnnuebnobxemnxxgsrverhsmvhhthievishnessfvymlycvnmccrjoubomjnummdxecrewxncww
plukhuglnkggbzksxkqznsqqzbqidqkbnikklpgqtgupnquuxdwyjwednyeejrmgzmorngoovfcopcyfnoyyhtswfsitnwii

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: thievishness
Cipher: guvrivfuarff

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: thievishness
Cipher: 443242511542343233513434

Extended Methods:
Method #1

Plaintext: thievishness
method variations:
ynokaoxnskxxdstpftcsxpccixyulyhxcuhhocdzqdnchznn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
t h i e v i s h n e s s 
4 3 4 5 1 4 3 3 3 5 3 3 
4 2 2 1 5 2 4 2 3 1 4 4 
They are then read out in rows:
434514333533422152423144
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: thievishness
Cipher: oyqnxnibkict

Read more ...
Method #3

Plaintext: thievishness
method variations:
orwaumomxlot rwaumomxloto waumomxlotor
aumomxlotorw umomxlotorwa momxlotorwau
omxlotorwaum mxlotorwaumo xlotorwaumom
lotorwaumomx otorwaumomxl torwaumomxlo

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: thievishness

first 5040 cipher variations(475687488 total)
thievishness thievishness thievishnses thievishnsse thievishnsse thievishnses thievishenss thievishenss thievishesns
thievishessn thievishessn thievishesns thievishsens thievishsesn thievishsnes thievishsnse thievishssne thievishssen
thievishsesn thievishsens thievishssen thievishssne thievishsnse thievishsnes thievisnhess thievisnhess thievisnhses
thievisnhsse thievisnhsse thievisnhses thievisnehss thievisnehss thievisneshs thievisnessh thievisnessh thievisneshs
thievisnsehs thievisnsesh thievisnshes thievisnshse thievisnsshe thievisnsseh thievisnsesh thievisnsehs thievisnsseh
thievisnsshe thievisnshse thievisnshes thievisenhss thievisenhss thievisenshs thievisenssh thievisenssh thievisenshs
thievisehnss thievisehnss thievisehsns thievisehssn thievisehssn thievisehsns thieviseshns thieviseshsn thievisesnhs
thievisesnsh thievisessnh thievisesshn thieviseshsn thieviseshns thievisesshn thievisessnh thievisesnsh thievisesnhs
thievissnehs thievissnesh thievissnhes thievissnhse thievissnshe thievissnseh thievissenhs thievissensh thievissehns
thievissehsn thievisseshn thievissesnh thievisshens thievisshesn thievisshnes thievisshnse thievisshsne thievisshsen
thievisssehn thievisssenh thievissshen thievissshne thievisssnhe thievisssneh thievissnesh thievissnehs thievissnseh
thievissnshe thievissnhse thievissnhes thievissensh thievissenhs thievissesnh thievisseshn thievissehsn thievissehns
thievisssenh thievisssehn thievisssneh thievisssnhe thievissshne thievissshen thievisshesn thievisshens thievisshsen
thievisshsne thievisshnse thievisshnes thievihsness thievihsness thievihsnses thievihsnsse thievihsnsse thievihsnses
thievihsenss thievihsenss thievihsesns thievihsessn thievihsessn thievihsesns thievihssens thievihssesn thievihssnes
thievihssnse thievihsssne thievihsssen thievihssesn thievihssens thievihsssen thievihsssne thievihssnse thievihssnes
thievihnsess thievihnsess thievihnsses thievihnssse thievihnssse thievihnsses thievihnesss thievihnesss thievihnesss
thievihnesss thievihnesss thievihnesss thievihnsess thievihnsess thievihnsses thievihnssse thievihnssse thievihnsses
thievihnsess thievihnsess thievihnsses thievihnssse thievihnssse thievihnsses thievihensss thievihensss thievihensss
thievihensss thievihensss thievihensss thievihesnss thievihesnss thievihessns thievihesssn thievihesssn thievihessns
thievihessns thievihesssn thievihesnss thievihesnss thievihessns thievihesssn thievihesssn thievihessns thievihesssn
thievihessns thievihesnss thievihesnss thievihsness thievihsness thievihsnses thievihsnsse thievihsnsse thievihsnses
thievihsenss thievihsenss thievihsesns thievihsessn thievihsessn thievihsesns thievihssens thievihssesn thievihssnes
thievihssnse thievihsssne thievihsssen thievihssesn thievihssens thievihsssen thievihsssne thievihssnse thievihssnes
thievihsness thievihsness thievihsnses thievihsnsse thievihsnsse thievihsnses thievihsenss thievihsenss thievihsesns
thievihsessn thievihsessn thievihsesns thievihssens thievihssesn thievihssnes thievihssnse thievihsssne thievihsssen
thievihssesn thievihssens thievihsssen thievihsssne thievihssnse thievihssnes thievinhsess thievinhsess thievinhsses
thievinhssse thievinhssse thievinhsses thievinhesss thievinhesss thievinhesss thievinhesss thievinhesss thievinhesss
thievinhsess thievinhsess thievinhsses thievinhssse thievinhssse thievinhsses thievinhsess thievinhsess thievinhsses
thievinhssse thievinhssse thievinhsses thievinshess thievinshess thievinshses thievinshsse thievinshsse thievinshses
thievinsehss thievinsehss thievinseshs thievinsessh thievinsessh thievinseshs thievinssehs thievinssesh thievinsshes
thievinsshse thievinssshe thievinssseh thievinssesh thievinssehs thievinssseh thievinssshe thievinsshse thievinsshes
thievineshss thievineshss thievinesshs thievinesssh thievinesssh thievinesshs thievinehsss thievinehsss thievinehsss
thievinehsss thievinehsss thievinehsss thievineshss thievineshss thievinesshs thievinesssh thievinesssh thievinesshs
thievineshss thievineshss thievinesshs thievinesssh thievinesssh thievinesshs thievinssehs thievinssesh thievinsshes
thievinsshse thievinssshe thievinssseh thievinseshs thievinsessh thievinsehss thievinsehss thievinseshs thievinsessh
thievinshess thievinshess thievinshses thievinshsse thievinshsse thievinshses thievinssehs thievinssesh thievinsshes
thievinsshse thievinssshe thievinssseh thievinssesh thievinssehs thievinssseh thievinssshe thievinsshse thievinsshes
thievinsessh thievinseshs thievinsessh thievinseshs thievinsehss thievinsehss thievinssesh thievinssehs thievinssseh
thievinssshe thievinsshse thievinsshes thievinshess thievinshess thievinshses thievinshsse thievinshsse thievinshses
thieviehnsss thieviehnsss thieviehnsss thieviehnsss thieviehnsss thieviehnsss thieviehsnss thieviehsnss thieviehssns
thieviehsssn thieviehsssn thieviehssns thieviehssns thieviehsssn thieviehsnss thieviehsnss thieviehssns thieviehsssn
thieviehsssn thieviehssns thieviehsssn thieviehssns thieviehsnss thieviehsnss thievienhsss thievienhsss thievienhsss
thievienhsss thievienhsss thievienhsss thievienshss thievienshss thieviensshs thieviensssh thieviensssh thieviensshs
thieviensshs thieviensssh thievienshss thievienshss thieviensshs thieviensssh thieviensssh thieviensshs thieviensssh
thieviensshs thievienshss thievienshss thieviesnhss thieviesnhss thieviesnshs thieviesnssh thieviesnssh thieviesnshs
thievieshnss thievieshnss thievieshsns thievieshssn thievieshssn thievieshsns thieviesshns thieviesshsn thieviessnhs
thieviessnsh thieviesssnh thieviessshn thieviesshsn thieviesshns thieviessshn thieviesssnh thieviessnsh thieviessnhs
thieviesnshs thieviesnssh thieviesnhss thieviesnhss thieviesnshs thieviesnssh thieviessnhs thieviessnsh thieviesshns
thieviesshsn thieviessshn thieviesssnh thievieshsns thievieshssn thievieshnss thievieshnss thievieshsns thievieshssn
thieviessshn thieviesssnh thieviesshsn thieviesshns thieviessnhs thieviessnsh thieviesnssh thieviesnshs thieviesnssh
thieviesnshs thieviesnhss thieviesnhss thieviessnsh thieviessnhs thieviesssnh thieviessshn thieviesshsn thieviesshns
thieviesssnh thieviessshn thieviessnsh thieviessnhs thieviesshns thieviesshsn thievieshssn thievieshsns thievieshssn
thievieshsns thievieshnss thievieshnss thievishness thievishness thievishnses thievishnsse thievishnsse thievishnses
thievishenss thievishenss thievishesns thievishessn thievishessn thievishesns thievishsens thievishsesn thievishsnes
thievishsnse thievishssne thievishssen thievishsesn thievishsens thievishssen thievishssne thievishsnse thievishsnes
thievisnhess thievisnhess thievisnhses thievisnhsse thievisnhsse thievisnhses thievisnehss thievisnehss thievisneshs
thievisnessh thievisnessh thievisneshs thievisnsehs thievisnsesh thievisnshes thievisnshse thievisnsshe thievisnsseh
thievisnsesh thievisnsehs thievisnsseh thievisnsshe thievisnshse thievisnshes thievisenhss thievisenhss thievisenshs
thievisenssh thievisenssh thievisenshs thievisehnss thievisehnss thievisehsns thievisehssn thievisehssn thievisehsns
thieviseshns thieviseshsn thievisesnhs thievisesnsh thievisessnh thievisesshn thieviseshsn thieviseshns thievisesshn
thievisessnh thievisesnsh thievisesnhs thievissnehs thievissnesh thievissnhes thievissnhse thievissnshe thievissnseh
thievissenhs thievissensh thievissehns thievissehsn thievisseshn thievissesnh thievisshens thievisshesn thievisshnes
thievisshnse thievisshsne thievisshsen thievisssehn thievisssenh thievissshen thievissshne thievisssnhe thievisssneh
thievissnesh thievissnehs thievissnseh thievissnshe thievissnhse thievissnhes thievissensh thievissenhs thievissesnh
thievisseshn thievissehsn thievissehns thievisssenh thievisssehn thievisssneh thievisssnhe thievissshne thievissshen
thievisshesn thievisshens thievisshsen thievisshsne thievisshnse thievisshnes thievishness thievishness thievishnses
thievishnsse thievishnsse thievishnses thievishenss thievishenss thievishesns thievishessn thievishessn thievishesns
thievishsens thievishsesn thievishsnes thievishsnse thievishssne thievishssen thievishsesn thievishsens thievishssen
thievishssne thievishsnse thievishsnes thievisnhess thievisnhess thievisnhses thievisnhsse thievisnhsse thievisnhses
thievisnehss thievisnehss thievisneshs thievisnessh thievisnessh thievisneshs thievisnsehs thievisnsesh thievisnshes
thievisnshse thievisnsshe thievisnsseh thievisnsesh thievisnsehs thievisnsseh thievisnsshe thievisnshse thievisnshes
thievisenhss thievisenhss thievisenshs thievisenssh thievisenssh thievisenshs thievisehnss thievisehnss thievisehsns
thievisehssn thievisehssn thievisehsns thieviseshns thieviseshsn thievisesnhs thievisesnsh thievisessnh thievisesshn
thieviseshsn thieviseshns thievisesshn thievisessnh thievisesnsh thievisesnhs thievissnehs thievissnesh thievissnhes
thievissnhse thievissnshe thievissnseh thievissenhs thievissensh thievissehns thievissehsn thievisseshn thievissesnh
thievisshens thievisshesn thievisshnes thievisshnse thievisshsne thievisshsen thievisssehn thievisssenh thievissshen
thievissshne thievisssnhe thievisssneh thievissnesh thievissnehs thievissnseh thievissnshe thievissnhse thievissnhes
thievissensh thievissenhs thievissesnh thievisseshn thievissehsn thievissehns thievisssenh thievisssehn thievisssneh
thievisssnhe thievissshne thievissshen thievisshesn thievisshens thievisshsen thievisshsne thievisshnse thievisshnes
thievsihness thievsihness thievsihnses thievsihnsse thievsihnsse thievsihnses thievsihenss thievsihenss thievsihesns
thievsihessn thievsihessn thievsihesns thievsihsens thievsihsesn thievsihsnes thievsihsnse thievsihssne thievsihssen
thievsihsesn thievsihsens thievsihssen thievsihssne thievsihsnse thievsihsnes thievsinhess thievsinhess thievsinhses
thievsinhsse thievsinhsse thievsinhses thievsinehss thievsinehss thievsineshs thievsinessh thievsinessh thievsineshs
thievsinsehs thievsinsesh thievsinshes thievsinshse thievsinsshe thievsinsseh thievsinsesh thievsinsehs thievsinsseh
thievsinsshe thievsinshse thievsinshes thievsienhss thievsienhss thievsienshs thievsienssh thievsienssh thievsienshs
thievsiehnss thievsiehnss thievsiehsns thievsiehssn thievsiehssn thievsiehsns thievsieshns thievsieshsn thievsiesnhs
thievsiesnsh thievsiessnh thievsiesshn thievsieshsn thievsieshns thievsiesshn thievsiessnh thievsiesnsh thievsiesnhs
thievsisnehs thievsisnesh thievsisnhes thievsisnhse thievsisnshe thievsisnseh thievsisenhs thievsisensh thievsisehns
thievsisehsn thievsiseshn thievsisesnh thievsishens thievsishesn thievsishnes thievsishnse thievsishsne thievsishsen
thievsissehn thievsissenh thievsisshen thievsisshne thievsissnhe thievsissneh thievsisnesh thievsisnehs thievsisnseh
thievsisnshe thievsisnhse thievsisnhes thievsisensh thievsisenhs thievsisesnh thievsiseshn thievsisehsn thievsisehns
thievsissenh thievsissehn thievsissneh thievsissnhe thievsisshne thievsisshen thievsishesn thievsishens thievsishsen
thievsishsne thievsishnse thievsishnes thievshiness thievshiness thievshinses thievshinsse thievshinsse thievshinses
thievshienss thievshienss thievshiesns thievshiessn thievshiessn thievshiesns thievshisens thievshisesn thievshisnes
thievshisnse thievshissne thievshissen thievshisesn thievshisens thievshissen thievshissne thievshisnse thievshisnes
thievshniess thievshniess thievshnises thievshnisse thievshnisse thievshnises thievshneiss thievshneiss thievshnesis
thievshnessi thievshnessi thievshnesis thievshnseis thievshnsesi thievshnsies thievshnsise thievshnssie thievshnssei
thievshnsesi thievshnseis thievshnssei thievshnssie thievshnsise thievshnsies thievsheniss thievsheniss thievshensis
thievshenssi thievshenssi thievshensis thievsheinss thievsheinss thievsheisns thievsheissn thievsheissn thievsheisns
thievshesins thievshesisn thievshesnis thievshesnsi thievshessni thievshessin thievshesisn thievshesins thievshessin
thievshessni thievshesnsi thievshesnis thievshsneis thievshsnesi thievshsnies thievshsnise thievshsnsie thievshsnsei
thievshsenis thievshsensi thievshseins thievshseisn thievshsesin thievshsesni thievshsiens thievshsiesn thievshsines
thievshsinse thievshsisne thievshsisen thievshssein thievshsseni thievshssien thievshssine thievshssnie thievshssnei
thievshsnesi thievshsneis thievshsnsei thievshsnsie thievshsnise thievshsnies thievshsensi thievshsenis thievshsesni
thievshsesin thievshseisn thievshseins thievshsseni thievshssein thievshssnei thievshssnie thievshssine thievshssien
thievshsiesn thievshsiens thievshsisen thievshsisne thievshsinse thievshsines thievsnhiess thievsnhiess thievsnhises
thievsnhisse thievsnhisse thievsnhises thievsnheiss thievsnheiss thievsnhesis thievsnhessi thievsnhessi thievsnhesis
thievsnhseis thievsnhsesi thievsnhsies thievsnhsise thievsnhssie thievsnhssei thievsnhsesi thievsnhseis thievsnhssei
thievsnhssie thievsnhsise thievsnhsies thievsnihess thievsnihess thievsnihses thievsnihsse thievsnihsse thievsnihses
thievsniehss thievsniehss thievsnieshs thievsniessh thievsniessh thievsnieshs thievsnisehs thievsnisesh thievsnishes
thievsnishse thievsnisshe thievsnisseh thievsnisesh thievsnisehs thievsnisseh thievsnisshe thievsnishse thievsnishes
thievsneihss thievsneihss thievsneishs thievsneissh thievsneissh thievsneishs thievsnehiss thievsnehiss thievsnehsis
thievsnehssi thievsnehssi thievsnehsis thievsneshis thievsneshsi thievsnesihs thievsnesish thievsnessih thievsnesshi
thievsneshsi thievsneshis thievsnesshi thievsnessih thievsnesish thievsnesihs thievsnsiehs thievsnsiesh thievsnsihes
thievsnsihse thievsnsishe thievsnsiseh thievsnseihs thievsnseish thievsnsehis thievsnsehsi thievsnseshi thievsnsesih
thievsnsheis thievsnshesi thievsnshies thievsnshise thievsnshsie thievsnshsei thievsnssehi thievsnsseih thievsnsshei
thievsnsshie thievsnssihe thievsnssieh thievsnsiesh thievsnsiehs thievsnsiseh thievsnsishe thievsnsihse thievsnsihes
thievsnseish thievsnseihs thievsnsesih thievsnseshi thievsnsehsi thievsnsehis thievsnsseih thievsnssehi thievsnssieh
thievsnssihe thievsnsshie thievsnsshei thievsnshesi thievsnsheis thievsnshsei thievsnshsie thievsnshise thievsnshies
thievsehniss thievsehniss thievsehnsis thievsehnssi thievsehnssi thievsehnsis thievsehinss thievsehinss thievsehisns
thievsehissn thievsehissn thievsehisns thievsehsins thievsehsisn thievsehsnis thievsehsnsi thievsehssni thievsehssin
thievsehsisn thievsehsins thievsehssin thievsehssni thievsehsnsi thievsehsnis thievsenhiss thievsenhiss thievsenhsis
thievsenhssi thievsenhssi thievsenhsis thievsenihss thievsenihss thievsenishs thievsenissh thievsenissh thievsenishs
thievsensihs thievsensish thievsenshis thievsenshsi thievsensshi thievsenssih thievsensish thievsensihs thievsenssih
thievsensshi thievsenshsi thievsenshis thievseinhss thievseinhss thievseinshs thievseinssh thievseinssh thievseinshs
thievseihnss thievseihnss thievseihsns thievseihssn thievseihssn thievseihsns thievseishns thievseishsn thievseisnhs
thievseisnsh thievseissnh thievseisshn thievseishsn thievseishns thievseisshn thievseissnh thievseisnsh thievseisnhs
thievsesnihs thievsesnish thievsesnhis thievsesnhsi thievsesnshi thievsesnsih thievsesinhs thievsesinsh thievsesihns
thievsesihsn thievsesishn thievsesisnh thievseshins thievseshisn thievseshnis thievseshnsi thievseshsni thievseshsin
thievsessihn thievsessinh thievsesshin thievsesshni thievsessnhi thievsessnih thievsesnish thievsesnihs thievsesnsih
thievsesnshi thievsesnhsi thievsesnhis thievsesinsh thievsesinhs thievsesisnh thievsesishn thievsesihsn thievsesihns
thievsessinh thievsessihn thievsessnih thievsessnhi thievsesshni thievsesshin thievseshisn thievseshins thievseshsin
thievseshsni thievseshnsi thievseshnis thievsshneis thievsshnesi thievsshnies thievsshnise thievsshnsie thievsshnsei
thievsshenis thievsshensi thievssheins thievssheisn thievsshesin thievsshesni thievsshiens thievsshiesn thievsshines
thievsshinse thievsshisne thievsshisen thievsshsein thievsshseni thievsshsien thievsshsine thievsshsnie thievsshsnei
thievssnheis thievssnhesi thievssnhies thievssnhise thievssnhsie thievssnhsei thievssnehis thievssnehsi thievssneihs
thievssneish thievssnesih thievssneshi thievssniehs thievssniesh thievssnihes thievssnihse thievssnishe thievssniseh
thievssnseih thievssnsehi thievssnsieh thievssnsihe thievssnshie thievssnshei thievssenhis thievssenhsi thievssenihs
thievssenish thievssensih thievssenshi thievssehnis thievssehnsi thievssehins thievssehisn thievssehsin thievssehsni
thievsseihns thievsseihsn thievsseinhs thievsseinsh thievsseisnh thievsseishn thievsseshin thievsseshni thievssesihn
thievssesinh thievssesnih thievssesnhi thievssinehs thievssinesh thievssinhes thievssinhse thievssinshe thievssinseh
thievssienhs thievssiensh thievssiehns thievssiehsn thievssieshn thievssiesnh thievssihens thievssihesn thievssihnes
thievssihnse thievssihsne thievssihsen thievssisehn thievssisenh thievssishen thievssishne thievssisnhe thievssisneh
thievsssneih thievsssnehi thievsssnieh thievsssnihe thievsssnhie thievsssnhei thievsssenih thievsssenhi thievssseinh
thievssseihn thievsssehin thievsssehni thievsssienh thievsssiehn thievsssineh thievsssinhe thievsssihne thievsssihen
thievssshein thievsssheni thievssshien thievssshine thievssshnie thievssshnei thievsshnesi thievsshneis thievsshnsei
thievsshnsie thievsshnise thievsshnies thievsshensi thievsshenis thievsshesni thievsshesin thievssheisn thievssheins
thievsshseni thievsshsein thievsshsnei thievsshsnie thievsshsine thievsshsien thievsshiesn thievsshiens thievsshisen
thievsshisne thievsshinse thievsshines thievssnhesi thievssnheis thievssnhsei thievssnhsie thievssnhise thievssnhies
thievssnehsi thievssnehis thievssneshi thievssnesih thievssneish thievssneihs thievssnsehi thievssnseih thievssnshei
thievssnshie thievssnsihe thievssnsieh thievssniesh thievssniehs thievssniseh thievssnishe thievssnihse thievssnihes
thievssenhsi thievssenhis thievssenshi thievssensih thievssenish thievssenihs thievssehnsi thievssehnis thievssehsni
thievssehsin thievssehisn thievssehins thievsseshni thievsseshin thievssesnhi thievssesnih thievssesinh thievssesihn
thievsseihsn thievsseihns thievsseishn thievsseisnh thievsseinsh thievsseinhs thievsssnehi thievsssneih thievsssnhei
thievsssnhie thievsssnihe thievsssnieh thievsssenhi thievsssenih thievsssehni thievsssehin thievssseihn thievssseinh
thievsssheni thievssshein thievssshnei thievssshnie thievssshine thievssshien thievsssiehn thievsssienh thievsssihen
thievsssihne thievsssinhe thievsssineh thievssinesh thievssinehs thievssinseh thievssinshe thievssinhse thievssinhes
thievssiensh thievssienhs thievssiesnh thievssieshn thievssiehsn thievssiehns thievssisenh thievssisehn thievssisneh
thievssisnhe thievssishne thievssishen thievssihesn thievssihens thievssihsen thievssihsne thievssihnse thievssihnes
thievhsiness thievhsiness thievhsinses thievhsinsse thievhsinsse thievhsinses thievhsienss thievhsienss thievhsiesns
thievhsiessn thievhsiessn thievhsiesns thievhsisens thievhsisesn thievhsisnes thievhsisnse thievhsissne thievhsissen
thievhsisesn thievhsisens thievhsissen thievhsissne thievhsisnse thievhsisnes thievhsniess thievhsniess thievhsnises
thievhsnisse thievhsnisse thievhsnises thievhsneiss thievhsneiss thievhsnesis thievhsnessi thievhsnessi thievhsnesis
thievhsnseis thievhsnsesi thievhsnsies thievhsnsise thievhsnssie thievhsnssei thievhsnsesi thievhsnseis thievhsnssei
thievhsnssie thievhsnsise thievhsnsies thievhseniss thievhseniss thievhsensis thievhsenssi thievhsenssi thievhsensis
thievhseinss thievhseinss thievhseisns thievhseissn thievhseissn thievhseisns thievhsesins thievhsesisn thievhsesnis
thievhsesnsi thievhsessni thievhsessin thievhsesisn thievhsesins thievhsessin thievhsessni thievhsesnsi thievhsesnis
thievhssneis thievhssnesi thievhssnies thievhssnise thievhssnsie thievhssnsei thievhssenis thievhssensi thievhsseins
thievhsseisn thievhssesin thievhssesni thievhssiens thievhssiesn thievhssines thievhssinse thievhssisne thievhssisen
thievhsssein thievhssseni thievhsssien thievhsssine thievhsssnie thievhsssnei thievhssnesi thievhssneis thievhssnsei
thievhssnsie thievhssnise thievhssnies thievhssensi thievhssenis thievhssesni thievhssesin thievhsseisn thievhsseins
thievhssseni thievhsssein thievhsssnei thievhsssnie thievhsssine thievhsssien thievhssiesn thievhssiens thievhssisen
thievhssisne thievhssinse thievhssines thievhisness thievhisness thievhisnses thievhisnsse thievhisnsse thievhisnses
thievhisenss thievhisenss thievhisesns thievhisessn thievhisessn thievhisesns thievhissens thievhissesn thievhissnes
thievhissnse thievhisssne thievhisssen thievhissesn thievhissens thievhisssen thievhisssne thievhissnse thievhissnes
thievhinsess thievhinsess thievhinsses thievhinssse thievhinssse thievhinsses thievhinesss thievhinesss thievhinesss
thievhinesss thievhinesss thievhinesss thievhinsess thievhinsess thievhinsses thievhinssse thievhinssse thievhinsses
thievhinsess thievhinsess thievhinsses thievhinssse thievhinssse thievhinsses thievhiensss thievhiensss thievhiensss
thievhiensss thievhiensss thievhiensss thievhiesnss thievhiesnss thievhiessns thievhiesssn thievhiesssn thievhiessns
thievhiessns thievhiesssn thievhiesnss thievhiesnss thievhiessns thievhiesssn thievhiesssn thievhiessns thievhiesssn
thievhiessns thievhiesnss thievhiesnss thievhisness thievhisness thievhisnses thievhisnsse thievhisnsse thievhisnses
thievhisenss thievhisenss thievhisesns thievhisessn thievhisessn thievhisesns thievhissens thievhissesn thievhissnes
thievhissnse thievhisssne thievhisssen thievhissesn thievhissens thievhisssen thievhisssne thievhissnse thievhissnes
thievhisness thievhisness thievhisnses thievhisnsse thievhisnsse thievhisnses thievhisenss thievhisenss thievhisesns
thievhisessn thievhisessn thievhisesns thievhissens thievhissesn thievhissnes thievhissnse thievhisssne thievhisssen
thievhissesn thievhissens thievhisssen thievhisssne thievhissnse thievhissnes thievhnisess thievhnisess thievhnisses
thievhnissse thievhnissse thievhnisses thievhniesss thievhniesss thievhniesss thievhniesss thievhniesss thievhniesss
thievhnisess thievhnisess thievhnisses thievhnissse thievhnissse thievhnisses thievhnisess thievhnisess thievhnisses
thievhnissse thievhnissse thievhnisses thievhnsiess thievhnsiess thievhnsises thievhnsisse thievhnsisse thievhnsises
thievhnseiss thievhnseiss thievhnsesis thievhnsessi thievhnsessi thievhnsesis thievhnsseis thievhnssesi thievhnssies
thievhnssise thievhnsssie thievhnsssei thievhnssesi thievhnsseis thievhnsssei thievhnsssie thievhnssise thievhnssies
thievhnesiss thievhnesiss thievhnessis thievhnesssi thievhnesssi thievhnessis thievhneisss thievhneisss thievhneisss
thievhneisss thievhneisss thievhneisss thievhnesiss thievhnesiss thievhnessis thievhnesssi thievhnesssi thievhnessis
thievhnesiss thievhnesiss thievhnessis thievhnesssi thievhnesssi thievhnessis thievhnsseis thievhnssesi thievhnssies
thievhnssise thievhnsssie thievhnsssei thievhnsesis thievhnsessi thievhnseiss thievhnseiss thievhnsesis thievhnsessi
thievhnsiess thievhnsiess thievhnsises thievhnsisse thievhnsisse thievhnsises thievhnsseis thievhnssesi thievhnssies
thievhnssise thievhnsssie thievhnsssei thievhnssesi thievhnsseis thievhnsssei thievhnsssie thievhnssise thievhnssies
thievhnsessi thievhnsesis thievhnsessi thievhnsesis thievhnseiss thievhnseiss thievhnssesi thievhnsseis thievhnsssei
thievhnsssie thievhnssise thievhnssies thievhnsiess thievhnsiess thievhnsises thievhnsisse thievhnsisse thievhnsises
thievheinsss thievheinsss thievheinsss thievheinsss thievheinsss thievheinsss thievheisnss thievheisnss thievheissns
thievheisssn thievheisssn thievheissns thievheissns thievheisssn thievheisnss thievheisnss thievheissns thievheisssn
thievheisssn thievheissns thievheisssn thievheissns thievheisnss thievheisnss thievhenisss thievhenisss thievhenisss
thievhenisss thievhenisss thievhenisss thievhensiss thievhensiss thievhenssis thievhensssi thievhensssi thievhenssis
thievhenssis thievhensssi thievhensiss thievhensiss thievhenssis thievhensssi thievhensssi thievhenssis thievhensssi
thievhenssis thievhensiss thievhensiss thievhesniss thievhesniss thievhesnsis thievhesnssi thievhesnssi thievhesnsis
thievhesinss thievhesinss thievhesisns thievhesissn thievhesissn thievhesisns thievhessins thievhessisn thievhessnis
thievhessnsi thievhesssni thievhesssin thievhessisn thievhessins thievhesssin thievhesssni thievhessnsi thievhessnis
thievhesnsis thievhesnssi thievhesniss thievhesniss thievhesnsis thievhesnssi thievhessnis thievhessnsi thievhessins
thievhessisn thievhesssin thievhesssni thievhesisns thievhesissn thievhesinss thievhesinss thievhesisns thievhesissn
thievhesssin thievhesssni thievhessisn thievhessins thievhessnis thievhessnsi thievhesnssi thievhesnsis thievhesnssi
thievhesnsis thievhesniss thievhesniss thievhessnsi thievhessnis thievhesssni thievhesssin thievhessisn thievhessins
thievhesssni thievhesssin thievhessnsi thievhessnis thievhessins thievhessisn thievhesissn thievhesisns thievhesissn
thievhesisns thievhesinss thievhesinss thievhsiness thievhsiness thievhsinses thievhsinsse thievhsinsse thievhsinses
thievhsienss thievhsienss thievhsiesns thievhsiessn thievhsiessn thievhsiesns thievhsisens thievhsisesn thievhsisnes
thievhsisnse thievhsissne thievhsissen thievhsisesn thievhsisens thievhsissen thievhsissne thievhsisnse thievhsisnes
thievhsniess thievhsniess thievhsnises thievhsnisse thievhsnisse thievhsnises thievhsneiss thievhsneiss thievhsnesis
thievhsnessi thievhsnessi thievhsnesis thievhsnseis thievhsnsesi thievhsnsies thievhsnsise thievhsnssie thievhsnssei
thievhsnsesi thievhsnseis thievhsnssei thievhsnssie thievhsnsise thievhsnsies thievhseniss thievhseniss thievhsensis
thievhsenssi thievhsenssi thievhsensis thievhseinss thievhseinss thievhseisns thievhseissn thievhseissn thievhseisns
thievhsesins thievhsesisn thievhsesnis thievhsesnsi thievhsessni thievhsessin thievhsesisn thievhsesins thievhsessin
thievhsessni thievhsesnsi thievhsesnis thievhssneis thievhssnesi thievhssnies thievhssnise thievhssnsie thievhssnsei
thievhssenis thievhssensi thievhsseins thievhsseisn thievhssesin thievhssesni thievhssiens thievhssiesn thievhssines
thievhssinse thievhssisne thievhssisen thievhsssein thievhssseni thievhsssien thievhsssine thievhsssnie thievhsssnei
thievhssnesi thievhssneis thievhssnsei thievhssnsie thievhssnise thievhssnies thievhssensi thievhssenis thievhssesni
thievhssesin thievhsseisn thievhsseins thievhssseni thievhsssein thievhsssnei thievhsssnie thievhsssine thievhsssien
thievhssiesn thievhssiens thievhssisen thievhssisne thievhssinse thievhssines thievhsiness thievhsiness thievhsinses
thievhsinsse thievhsinsse thievhsinses thievhsienss thievhsienss thievhsiesns thievhsiessn thievhsiessn thievhsiesns
thievhsisens thievhsisesn thievhsisnes thievhsisnse thievhsissne thievhsissen thievhsisesn thievhsisens thievhsissen
thievhsissne thievhsisnse thievhsisnes thievhsniess thievhsniess thievhsnises thievhsnisse thievhsnisse thievhsnises
thievhsneiss thievhsneiss thievhsnesis thievhsnessi thievhsnessi thievhsnesis thievhsnseis thievhsnsesi thievhsnsies
thievhsnsise thievhsnssie thievhsnssei thievhsnsesi thievhsnseis thievhsnssei thievhsnssie thievhsnsise thievhsnsies
thievhseniss thievhseniss thievhsensis thievhsenssi thievhsenssi thievhsensis thievhseinss thievhseinss thievhseisns
thievhseissn thievhseissn thievhseisns thievhsesins thievhsesisn thievhsesnis thievhsesnsi thievhsessni thievhsessin
thievhsesisn thievhsesins thievhsessin thievhsessni thievhsesnsi thievhsesnis thievhssneis thievhssnesi thievhssnies
thievhssnise thievhssnsie thievhssnsei thievhssenis thievhssensi thievhsseins thievhsseisn thievhssesin thievhssesni
thievhssiens thievhssiesn thievhssines thievhssinse thievhssisne thievhssisen thievhsssein thievhssseni thievhsssien
thievhsssine thievhsssnie thievhsssnei thievhssnesi thievhssneis thievhssnsei thievhssnsie thievhssnise thievhssnies
thievhssensi thievhssenis thievhssesni thievhssesin thievhsseisn thievhsseins thievhssseni thievhsssein thievhsssnei
thievhsssnie thievhsssine thievhsssien thievhssiesn thievhssiens thievhssisen thievhssisne thievhssinse thievhssines
thievnshiess thievnshiess thievnshises thievnshisse thievnshisse thievnshises thievnsheiss thievnsheiss thievnshesis
thievnshessi thievnshessi thievnshesis thievnshseis thievnshsesi thievnshsies thievnshsise thievnshssie thievnshssei
thievnshsesi thievnshseis thievnshssei thievnshssie thievnshsise thievnshsies thievnsihess thievnsihess thievnsihses
thievnsihsse thievnsihsse thievnsihses thievnsiehss thievnsiehss thievnsieshs thievnsiessh thievnsiessh thievnsieshs
thievnsisehs thievnsisesh thievnsishes thievnsishse thievnsisshe thievnsisseh thievnsisesh thievnsisehs thievnsisseh
thievnsisshe thievnsishse thievnsishes thievnseihss thievnseihss thievnseishs thievnseissh thievnseissh thievnseishs
thievnsehiss thievnsehiss thievnsehsis thievnsehssi thievnsehssi thievnsehsis thievnseshis thievnseshsi thievnsesihs
thievnsesish thievnsessih thievnsesshi thievnseshsi thievnseshis thievnsesshi thievnsessih thievnsesish thievnsesihs
thievnssiehs thievnssiesh thievnssihes thievnssihse thievnssishe thievnssiseh thievnsseihs thievnsseish thievnssehis
thievnssehsi thievnsseshi thievnssesih thievnssheis thievnsshesi thievnsshies thievnsshise thievnsshsie thievnsshsei
thievnsssehi thievnssseih thievnssshei thievnssshie thievnsssihe thievnsssieh thievnssiesh thievnssiehs thievnssiseh
thievnssishe thievnssihse thievnssihes thievnsseish thievnsseihs thievnssesih thievnsseshi thievnssehsi thievnssehis
thievnssseih thievnsssehi thievnsssieh thievnsssihe thievnssshie thievnssshei thievnsshesi thievnssheis thievnsshsei
thievnsshsie thievnsshise thievnsshies thievnhsiess thievnhsiess thievnhsises thievnhsisse thievnhsisse thievnhsises
thievnhseiss thievnhseiss thievnhsesis thievnhsessi thievnhsessi thievnhsesis thievnhsseis thievnhssesi thievnhssies
thievnhssise thievnhsssie thievnhsssei thievnhssesi thievnhsseis thievnhsssei thievnhsssie thievnhssise thievnhssies
thievnhisess thievnhisess thievnhisses thievnhissse thievnhissse thievnhisses thievnhiesss thievnhiesss thievnhiesss
thievnhiesss thievnhiesss thievnhiesss thievnhisess thievnhisess thievnhisses thievnhissse thievnhissse thievnhisses
thievnhisess thievnhisess thievnhisses thievnhissse thievnhissse thievnhisses thievnheisss thievnheisss thievnheisss
thievnheisss thievnheisss thievnheisss thievnhesiss thievnhesiss thievnhessis thievnhesssi thievnhesssi thievnhessis
thievnhessis thievnhesssi thievnhesiss thievnhesiss thievnhessis thievnhesssi thievnhesssi thievnhessis thievnhesssi
thievnhessis thievnhesiss thievnhesiss thievnhsiess thievnhsiess thievnhsises thievnhsisse thievnhsisse thievnhsises
thievnhseiss thievnhseiss thievnhsesis thievnhsessi thievnhsessi thievnhsesis thievnhsseis thievnhssesi thievnhssies
thievnhssise thievnhsssie thievnhsssei thievnhssesi thievnhsseis thievnhsssei thievnhsssie thievnhssise thievnhssies
thievnhsiess thievnhsiess thievnhsises thievnhsisse thievnhsisse thievnhsises thievnhseiss thievnhseiss thievnhsesis
thievnhsessi thievnhsessi thievnhsesis thievnhsseis thievnhssesi thievnhssies thievnhssise thievnhsssie thievnhsssei
thievnhssesi thievnhsseis thievnhsssei thievnhsssie thievnhssise thievnhssies thievnihsess thievnihsess thievnihsses
thievnihssse thievnihssse thievnihsses thievnihesss thievnihesss thievnihesss thievnihesss thievnihesss thievnihesss
thievnihsess thievnihsess thievnihsses thievnihssse thievnihssse thievnihsses thievnihsess thievnihsess thievnihsses
thievnihssse thievnihssse thievnihsses thievnishess thievnishess thievnishses thievnishsse thievnishsse thievnishses
thievnisehss thievnisehss thievniseshs thievnisessh thievnisessh thievniseshs thievnissehs thievnissesh thievnisshes
thievnisshse thievnissshe thievnissseh thievnissesh thievnissehs thievnissseh thievnissshe thievnisshse thievnisshes
thievnieshss thievnieshss thievniesshs thievniesssh thievniesssh thievniesshs thievniehsss thievniehsss thievniehsss
thievniehsss thievniehsss thievniehsss thievnieshss thievnieshss thievniesshs thievniesssh thievniesssh thievniesshs
thievnieshss thievnieshss thievniesshs thievniesssh thievniesssh thievniesshs thievnissehs thievnissesh thievnisshes
thievnisshse thievnissshe thievnissseh thievniseshs thievnisessh thievnisehss thievnisehss thievniseshs thievnisessh
thievnishess thievnishess thievnishses thievnishsse thievnishsse thievnishses thievnissehs thievnissesh thievnisshes
thievnisshse thievnissshe thievnissseh thievnissesh thievnissehs thievnissseh thievnissshe thievnisshse thievnisshes
thievnisessh thievniseshs thievnisessh thievniseshs thievnisehss thievnisehss thievnissesh thievnissehs thievnissseh
thievnissshe thievnisshse thievnisshes thievnishess thievnishess thievnishses thievnishsse thievnishsse thievnishses
thievnehisss thievnehisss thievnehisss thievnehisss thievnehisss thievnehisss thievnehsiss thievnehsiss thievnehssis
thievnehsssi thievnehsssi thievnehssis thievnehssis thievnehsssi thievnehsiss thievnehsiss thievnehssis thievnehsssi
thievnehsssi thievnehssis thievnehsssi thievnehssis thievnehsiss thievnehsiss thievneihsss thievneihsss thievneihsss
thievneihsss thievneihsss thievneihsss thievneishss thievneishss thievneisshs thievneisssh thievneisssh thievneisshs
thievneisshs thievneisssh thievneishss thievneishss thievneisshs thievneisssh thievneisssh thievneisshs thievneisssh
thievneisshs thievneishss thievneishss thievnesihss thievnesihss thievnesishs thievnesissh thievnesissh thievnesishs
thievneshiss thievneshiss thievneshsis thievneshssi thievneshssi thievneshsis thievnesshis thievnesshsi thievnessihs
thievnessish thievnesssih thievnessshi thievnesshsi thievnesshis thievnessshi thievnesssih thievnessish thievnessihs
thievnesishs thievnesissh thievnesihss thievnesihss thievnesishs thievnesissh thievnessihs thievnessish thievnesshis
thievnesshsi thievnessshi thievnesssih thievneshsis thievneshssi thievneshiss thievneshiss thievneshsis thievneshssi
thievnessshi thievnesssih thievnesshsi thievnesshis thievnessihs thievnessish thievnesissh thievnesishs thievnesissh
thievnesishs thievnesihss thievnesihss thievnessish thievnessihs thievnesssih thievnessshi thievnesshsi thievnesshis
thievnesssih thievnessshi thievnessish thievnessihs thievnesshis thievnesshsi thievneshssi thievneshsis thievneshssi
thievneshsis thievneshiss thievneshiss thievnshiess thievnshiess thievnshises thievnshisse thievnshisse thievnshises
thievnsheiss thievnsheiss thievnshesis thievnshessi thievnshessi thievnshesis thievnshseis thievnshsesi thievnshsies
thievnshsise thievnshssie thievnshssei thievnshsesi thievnshseis thievnshssei thievnshssie thievnshsise thievnshsies
thievnsihess thievnsihess thievnsihses thievnsihsse thievnsihsse thievnsihses thievnsiehss thievnsiehss thievnsieshs
thievnsiessh thievnsiessh thievnsieshs thievnsisehs thievnsisesh thievnsishes thievnsishse thievnsisshe thievnsisseh
thievnsisesh thievnsisehs thievnsisseh thievnsisshe thievnsishse thievnsishes thievnseihss thievnseihss thievnseishs
thievnseissh thievnseissh thievnseishs thievnsehiss thievnsehiss thievnsehsis thievnsehssi thievnsehssi thievnsehsis
thievnseshis thievnseshsi thievnsesihs thievnsesish thievnsessih thievnsesshi thievnseshsi thievnseshis thievnsesshi
thievnsessih thievnsesish thievnsesihs thievnssiehs thievnssiesh thievnssihes thievnssihse thievnssishe thievnssiseh
thievnsseihs thievnsseish thievnssehis thievnssehsi thievnsseshi thievnssesih thievnssheis thievnsshesi thievnsshies
thievnsshise thievnsshsie thievnsshsei thievnsssehi thievnssseih thievnssshei thievnssshie thievnsssihe thievnsssieh
thievnssiesh thievnssiehs thievnssiseh thievnssishe thievnssihse thievnssihes thievnsseish thievnsseihs thievnssesih
thievnsseshi thievnssehsi thievnssehis thievnssseih thievnsssehi thievnsssieh thievnsssihe thievnssshie thievnssshei
thievnsshesi thievnssheis thievnsshsei thievnsshsie thievnsshise thievnsshies thievnshiess thievnshiess thievnshises
thievnshisse thievnshisse thievnshises thievnsheiss thievnsheiss thievnshesis thievnshessi thievnshessi thievnshesis
thievnshseis thievnshsesi thievnshsies thievnshsise thievnshssie thievnshssei thievnshsesi thievnshseis thievnshssei
thievnshssie thievnshsise thievnshsies thievnsihess thievnsihess thievnsihses thievnsihsse thievnsihsse thievnsihses
thievnsiehss thievnsiehss thievnsieshs thievnsiessh thievnsiessh thievnsieshs thievnsisehs thievnsisesh thievnsishes
thievnsishse thievnsisshe thievnsisseh thievnsisesh thievnsisehs thievnsisseh thievnsisshe thievnsishse thievnsishes
thievnseihss thievnseihss thievnseishs thievnseissh thievnseissh thievnseishs thievnsehiss thievnsehiss thievnsehsis
thievnsehssi thievnsehssi thievnsehsis thievnseshis thievnseshsi thievnsesihs thievnsesish thievnsessih thievnsesshi
thievnseshsi thievnseshis thievnsesshi thievnsessih thievnsesish thievnsesihs thievnssiehs thievnssiesh thievnssihes
thievnssihse thievnssishe thievnssiseh thievnsseihs thievnsseish thievnssehis thievnssehsi thievnsseshi thievnssesih
thievnssheis thievnsshesi thievnsshies thievnsshise thievnsshsie thievnsshsei thievnsssehi thievnssseih thievnssshei
thievnssshie thievnsssihe thievnsssieh thievnssiesh thievnssiehs thievnssiseh thievnssishe thievnssihse thievnssihes
thievnsseish thievnsseihs thievnssesih thievnsseshi thievnssehsi thievnssehis thievnssseih thievnsssehi thievnsssieh
thievnsssihe thievnssshie thievnssshei thievnsshesi thievnssheis thievnsshsei thievnsshsie thievnsshise thievnsshies
thieveshniss thieveshniss thieveshnsis thieveshnssi thieveshnssi thieveshnsis thieveshinss thieveshinss thieveshisns
thieveshissn thieveshissn thieveshisns thieveshsins thieveshsisn thieveshsnis thieveshsnsi thieveshssni thieveshssin
thieveshsisn thieveshsins thieveshssin thieveshssni thieveshsnsi thieveshsnis thievesnhiss thievesnhiss thievesnhsis
thievesnhssi thievesnhssi thievesnhsis thievesnihss thievesnihss thievesnishs thievesnissh thievesnissh thievesnishs
thievesnsihs thievesnsish thievesnshis thievesnshsi thievesnsshi thievesnssih thievesnsish thievesnsihs thievesnssih
thievesnsshi thievesnshsi thievesnshis thievesinhss thievesinhss thievesinshs thievesinssh thievesinssh thievesinshs
thievesihnss thievesihnss thievesihsns thievesihssn thievesihssn thievesihsns thievesishns thievesishsn thievesisnhs
thievesisnsh thievesissnh thievesisshn thievesishsn thievesishns thievesisshn thievesissnh thievesisnsh thievesisnhs
thievessnihs thievessnish thievessnhis thievessnhsi thievessnshi thievessnsih thievessinhs thievessinsh thievessihns
thievessihsn thievessishn thievessisnh thievesshins thievesshisn thievesshnis thievesshnsi thievesshsni thievesshsin
thievesssihn thievesssinh thievessshin thievessshni thievesssnhi thievesssnih thievessnish thievessnihs thievessnsih
thievessnshi thievessnhsi thievessnhis thievessinsh thievessinhs thievessisnh thievessishn thievessihsn thievessihns
thievesssinh thievesssihn thievesssnih thievesssnhi thievessshni thievessshin thievesshisn thievesshins thievesshsin
thievesshsni thievesshnsi thievesshnis thievehsniss thievehsniss thievehsnsis thievehsnssi thievehsnssi thievehsnsis
thievehsinss thievehsinss thievehsisns thievehsissn thievehsissn thievehsisns thievehssins thievehssisn thievehssnis
thievehssnsi thievehsssni thievehsssin thievehssisn thievehssins thievehsssin thievehsssni thievehssnsi thievehssnis
thievehnsiss thievehnsiss thievehnssis thievehnsssi thievehnsssi thievehnssis thievehnisss thievehnisss thievehnisss
thievehnisss thievehnisss thievehnisss thievehnsiss thievehnsiss thievehnssis thievehnsssi thievehnsssi thievehnssis
thievehnsiss thievehnsiss thievehnssis thievehnsssi thievehnsssi thievehnssis thievehinsss thievehinsss thievehinsss
thievehinsss thievehinsss thievehinsss thievehisnss thievehisnss thievehissns thievehisssn thievehisssn thievehissns
thievehissns thievehisssn thievehisnss thievehisnss thievehissns thievehisssn thievehisssn thievehissns thievehisssn
thievehissns thievehisnss thievehisnss thievehsniss thievehsniss thievehsnsis thievehsnssi thievehsnssi thievehsnsis
thievehsinss thievehsinss thievehsisns thievehsissn thievehsissn thievehsisns thievehssins thievehssisn thievehssnis
thievehssnsi thievehsssni thievehsssin thievehssisn thievehssins thievehsssin thievehsssni thievehssnsi thievehssnis
thievehsniss thievehsniss thievehsnsis thievehsnssi thievehsnssi thievehsnsis thievehsinss thievehsinss thievehsisns
thievehsissn thievehsissn thievehsisns thievehssins thievehssisn thievehssnis thievehssnsi thievehsssni thievehsssin
thievehssisn thievehssins thievehsssin thievehsssni thievehssnsi thievehssnis thievenhsiss thievenhsiss thievenhssis
thievenhsssi thievenhsssi thievenhssis thievenhisss thievenhisss thievenhisss thievenhisss thievenhisss thievenhisss
thievenhsiss thievenhsiss thievenhssis thievenhsssi thievenhsssi thievenhssis thievenhsiss thievenhsiss thievenhssis
thievenhsssi thievenhsssi thievenhssis thievenshiss thievenshiss thievenshsis thievenshssi thievenshssi thievenshsis
thievensihss thievensihss thievensishs thievensissh thievensissh thievensishs thievenssihs thievenssish thievensshis
thievensshsi thievenssshi thievensssih thievenssish thievenssihs thievensssih thievenssshi thievensshsi thievensshis
thievenishss thievenishss thievenisshs thievenisssh thievenisssh thievenisshs thievenihsss thievenihsss thievenihsss
thievenihsss thievenihsss thievenihsss thievenishss thievenishss thievenisshs thievenisssh thievenisssh thievenisshs
thievenishss thievenishss thievenisshs thievenisssh thievenisssh thievenisshs thievenssihs thievenssish thievensshis
thievensshsi thievenssshi thievensssih thievensishs thievensissh thievensihss thievensihss thievensishs thievensissh
thievenshiss thievenshiss thievenshsis thievenshssi thievenshssi thievenshsis thievenssihs thievenssish thievensshis
thievensshsi thievenssshi thievensssih thievenssish thievenssihs thievensssih thievenssshi thievensshsi thievensshis
thievensissh thievensishs thievensissh thievensishs thievensihss thievensihss thievenssish thievenssihs thievensssih
thievenssshi thievensshsi thievensshis thievenshiss thievenshiss thievenshsis thievenshssi thievenshssi thievenshsis
thieveihnsss thieveihnsss thieveihnsss thieveihnsss thieveihnsss thieveihnsss thieveihsnss thieveihsnss thieveihssns
thieveihsssn thieveihsssn thieveihssns thieveihssns thieveihsssn thieveihsnss thieveihsnss thieveihssns thieveihsssn
thieveihsssn thieveihssns thieveihsssn thieveihssns thieveihsnss thieveihsnss thieveinhsss thieveinhsss thieveinhsss
thieveinhsss thieveinhsss thieveinhsss thieveinshss thieveinshss thieveinsshs thieveinsssh thieveinsssh thieveinsshs
thieveinsshs thieveinsssh thieveinshss thieveinshss thieveinsshs thieveinsssh thieveinsssh thieveinsshs thieveinsssh
thieveinsshs thieveinshss thieveinshss thieveisnhss thieveisnhss thieveisnshs thieveisnssh thieveisnssh thieveisnshs
thieveishnss thieveishnss thieveishsns thieveishssn thieveishssn thieveishsns thieveisshns thieveisshsn thieveissnhs
thieveissnsh thieveisssnh thieveissshn thieveisshsn thieveisshns thieveissshn thieveisssnh thieveissnsh thieveissnhs
thieveisnshs thieveisnssh thieveisnhss thieveisnhss thieveisnshs thieveisnssh thieveissnhs thieveissnsh thieveisshns
thieveisshsn thieveissshn thieveisssnh thieveishsns thieveishssn thieveishnss thieveishnss thieveishsns thieveishssn
thieveissshn thieveisssnh thieveisshsn thieveisshns thieveissnhs thieveissnsh thieveisnssh thieveisnshs thieveisnssh
thieveisnshs thieveisnhss thieveisnhss thieveissnsh thieveissnhs thieveisssnh thieveissshn thieveisshsn thieveisshns
thieveisssnh thieveissshn thieveissnsh thieveissnhs thieveisshns thieveisshsn thieveishssn thieveishsns thieveishssn
thieveishsns thieveishnss thieveishnss thieveshniss thieveshniss thieveshnsis thieveshnssi thieveshnssi thieveshnsis
thieveshinss thieveshinss thieveshisns thieveshissn thieveshissn thieveshisns thieveshsins thieveshsisn thieveshsnis
thieveshsnsi thieveshssni thieveshssin thieveshsisn thieveshsins thieveshssin thieveshssni thieveshsnsi thieveshsnis
thievesnhiss thievesnhiss thievesnhsis thievesnhssi thievesnhssi thievesnhsis thievesnihss thievesnihss thievesnishs
thievesnissh thievesnissh thievesnishs thievesnsihs thievesnsish thievesnshis thievesnshsi thievesnsshi thievesnssih
thievesnsish thievesnsihs thievesnssih thievesnsshi thievesnshsi thievesnshis thievesinhss thievesinhss thievesinshs
thievesinssh thievesinssh thievesinshs thievesihnss thievesihnss thievesihsns thievesihssn thievesihssn thievesihsns
thievesishns thievesishsn thievesisnhs thievesisnsh thievesissnh thievesisshn thievesishsn thievesishns thievesisshn
thievesissnh thievesisnsh thievesisnhs thievessnihs thievessnish thievessnhis thievessnhsi thievessnshi thievessnsih
thievessinhs thievessinsh thievessihns thievessihsn thievessishn thievessisnh thievesshins thievesshisn thievesshnis
thievesshnsi thievesshsni thievesshsin thievesssihn thievesssinh thievessshin thievessshni thievesssnhi thievesssnih
thievessnish thievessnihs thievessnsih thievessnshi thievessnhsi thievessnhis thievessinsh thievessinhs thievessisnh
thievessishn thievessihsn thievessihns thievesssinh thievesssihn thievesssnih thievesssnhi thievessshni thievessshin
thievesshisn thievesshins thievesshsin thievesshsni thievesshnsi thievesshnis thieveshniss thieveshniss thieveshnsis
thieveshnssi thieveshnssi thieveshnsis thieveshinss thieveshinss thieveshisns thieveshissn thieveshissn thieveshisns
thieveshsins thieveshsisn thieveshsnis thieveshsnsi thieveshssni thieveshssin thieveshsisn thieveshsins thieveshssin
thieveshssni thieveshsnsi thieveshsnis thievesnhiss thievesnhiss thievesnhsis thievesnhssi thievesnhssi thievesnhsis
thievesnihss thievesnihss thievesnishs thievesnissh thievesnissh thievesnishs thievesnsihs thievesnsish thievesnshis
thievesnshsi thievesnsshi thievesnssih thievesnsish thievesnsihs thievesnssih thievesnsshi thievesnshsi thievesnshis
thievesinhss thievesinhss thievesinshs thievesinssh thievesinssh thievesinshs thievesihnss thievesihnss thievesihsns
thievesihssn thievesihssn thievesihsns thievesishns thievesishsn thievesisnhs thievesisnsh thievesissnh thievesisshn
thievesishsn thievesishns thievesisshn thievesissnh thievesisnsh thievesisnhs thievessnihs thievessnish thievessnhis
thievessnhsi thievessnshi thievessnsih thievessinhs thievessinsh thievessihns thievessihsn thievessishn thievessisnh
thievesshins thievesshisn thievesshnis thievesshnsi thievesshsni thievesshsin thievesssihn thievesssinh thievessshin
thievessshni thievesssnhi thievesssnih thievessnish thievessnihs thievessnsih thievessnshi thievessnhsi thievessnhis
thievessinsh thievessinhs thievessisnh thievessishn thievessihsn thievessihns thievesssinh thievesssihn thievesssnih
thievesssnhi thievessshni thievessshin thievesshisn thievesshins thievesshsin thievesshsni thievesshnsi thievesshnis
thievsshneis thievsshnesi thievsshnies thievsshnise thievsshnsie thievsshnsei thievsshenis thievsshensi thievssheins
thievssheisn thievsshesin thievsshesni thievsshiens thievsshiesn thievsshines thievsshinse thievsshisne thievsshisen
thievsshsein thievsshseni thievsshsien thievsshsine thievsshsnie thievsshsnei thievssnheis thievssnhesi thievssnhies
thievssnhise thievssnhsie thievssnhsei thievssnehis thievssnehsi thievssneihs thievssneish thievssnesih thievssneshi
thievssniehs thievssniesh thievssnihes thievssnihse thievssnishe thievssniseh thievssnseih thievssnsehi thievssnsieh
thievssnsihe thievssnshie thievssnshei thievssenhis thievssenhsi thievssenihs thievssenish thievssensih thievssenshi
thievssehnis thievssehnsi thievssehins thievssehisn thievssehsin thievssehsni thievsseihns thievsseihsn thievsseinhs
thievsseinsh thievsseisnh thievsseishn thievsseshin thievsseshni thievssesihn thievssesinh thievssesnih thievssesnhi
thievssinehs thievssinesh thievssinhes thievssinhse thievssinshe thievssinseh thievssienhs thievssiensh thievssiehns
thievssiehsn thievssieshn thievssiesnh thievssihens thievssihesn thievssihnes thievssihnse thievssihsne thievssihsen
thievssisehn thievssisenh thievssishen thievssishne thievssisnhe thievssisneh thievsssneih thievsssnehi thievsssnieh
thievsssnihe thievsssnhie thievsssnhei thievsssenih thievsssenhi thievssseinh thievssseihn thievsssehin thievsssehni
thievsssienh thievsssiehn thievsssineh thievsssinhe thievsssihne thievsssihen thievssshein thievsssheni thievssshien
thievssshine thievssshnie thievssshnei thievshsneis thievshsnesi thievshsnies thievshsnise thievshsnsie thievshsnsei
thievshsenis thievshsensi thievshseins thievshseisn thievshsesin thievshsesni thievshsiens thievshsiesn thievshsines
thievshsinse thievshsisne thievshsisen thievshssein thievshsseni thievshssien thievshssine thievshssnie thievshssnei
thievshnseis thievshnsesi thievshnsies thievshnsise thievshnssie thievshnssei thievshnesis thievshnessi thievshneiss
thievshneiss thievshnesis thievshnessi thievshniess thievshniess thievshnises thievshnisse thievshnisse thievshnises
thievshnseis thievshnsesi thievshnsies thievshnsise thievshnssie thievshnssei thievshensis thievshenssi thievsheniss
thievsheniss thievshensis thievshenssi thievshesnis thievshesnsi thievshesins thievshesisn thievshessin thievshessni
thievsheisns thievsheissn thievsheinss thievsheinss thievsheisns thievsheissn thievshessin thievshessni thievshesisn
thievshesins thievshesnis thievshesnsi thievshiness thievshiness thievshinses thievshinsse thievshinsse thievshinses
thievshienss thievshienss thievshiesns thievshiessn thievshiessn thievshiesns thievshisens thievshisesn thievshisnes
thievshisnse thievshissne thievshissen thievshisesn thievshisens thievshissen thievshissne thievshisnse thievshisnes
thievshsneis thievshsnesi thievshsnies thievshsnise thievshsnsie thievshsnsei thievshsenis thievshsensi thievshseins
thievshseisn thievshsesin thievshsesni thievshsiens thievshsiesn thievshsines thievshsinse thievshsisne thievshsisen
thievshssein thievshsseni thievshssien thievshssine thievshssnie thievshssnei thievsnhseis thievsnhsesi thievsnhsies
thievsnhsise thievsnhssie thievsnhssei thievsnhesis thievsnhessi thievsnheiss thievsnheiss thievsnhesis thievsnhessi
thievsnhiess thievsnhiess thievsnhises thievsnhisse thievsnhisse thievsnhises thievsnhseis thievsnhsesi thievsnhsies
thievsnhsise thievsnhssie thievsnhssei thievsnsheis thievsnshesi thievsnshies thievsnshise thievsnshsie thievsnshsei
thievsnsehis thievsnsehsi thievsnseihs thievsnseish thievsnsesih thievsnseshi thievsnsiehs thievsnsiesh thievsnsihes
thievsnsihse thievsnsishe thievsnsiseh thievsnsseih thievsnssehi thievsnssieh thievsnssihe thievsnsshie thievsnsshei
thievsneshis thievsneshsi thievsnesihs thievsnesish thievsnessih thievsnesshi thievsnehsis thievsnehssi thievsnehiss
thievsnehiss thievsnehsis thievsnehssi thievsneihss thievsneihss thievsneishs thievsneissh thievsneissh thievsneishs
thievsneshis thievsneshsi thievsnesihs thievsnesish thievsnessih thievsnesshi thievsnisehs thievsnisesh thievsnishes
thievsnishse thievsnisshe thievsnisseh thievsnieshs thievsniessh thievsniehss thievsniehss thievsnieshs thievsniessh
thievsnihess thievsnihess thievsnihses thievsnihsse thievsnihsse thievsnihses thievsnisehs thievsnisesh thievsnishes
thievsnishse thievsnisshe thievsnisseh thievsnsseih thievsnssehi thievsnssieh thievsnssihe thievsnsshie thievsnsshei
thievsnsesih thievsnseshi thievsnseish thievsnseihs thievsnsehis thievsnsehsi thievsnsiesh thievsnsiehs thievsnsiseh
thievsnsishe thievsnsihse thievsnsihes thievsnsheis thievsnshesi thievsnshies thievsnshise thievsnshsie thievsnshsei
thievsehnsis thievsehnssi thievsehniss thievsehniss thievsehnsis thievsehnssi thievsehsnis thievsehsnsi thievsehsins
thievsehsisn thievsehssin thievsehssni thievsehisns thievsehissn thievsehinss thievsehinss thievsehisns thievsehissn
thievsehssin thievsehssni thievsehsisn thievsehsins thievsehsnis thievsehsnsi thievsenhsis thievsenhssi thievsenhiss
thievsenhiss thievsenhsis thievsenhssi thievsenshis thievsenshsi thievsensihs thievsensish thievsenssih thievsensshi
thievsenishs thievsenissh thievsenihss thievsenihss thievsenishs thievsenissh thievsenssih thievsensshi thievsensish
thievsensihs thievsenshis thievsenshsi thievsesnhis thievsesnhsi thievsesnihs thievsesnish thievsesnsih thievsesnshi
thievseshnis thievseshnsi thievseshins thievseshisn thievseshsin thievseshsni thievsesihns thievsesihsn thievsesinhs
thievsesinsh thievsesisnh thievsesishn thievsesshin thievsesshni thievsessihn thievsessinh thievsessnih thievsessnhi
thievseinshs thievseinssh thievseinhss thievseinhss thievseinshs thievseinssh thievseisnhs thievseisnsh thievseishns
thievseishsn thievseisshn thievseissnh thievseihsns thievseihssn thievseihnss thievseihnss thievseihsns thievseihssn
thievseisshn thievseissnh thievseishsn thievseishns thievseisnhs thievseisnsh thievsesnsih thievsesnshi thievsesnish
thievsesnihs thievsesnhis thievsesnhsi thievsessnih thievsessnhi thievsessinh thievsessihn thievsesshin thievsesshni
thievsesisnh thievsesishn thievsesinsh thievsesinhs thievsesihns thievsesihsn thievseshsin thievseshsni thievseshisn
thievseshins thievseshnis thievseshnsi thievsihness thievsihness thievsihnses thievsihnsse thievsihnsse thievsihnses
thievsihenss thievsihenss thievsihesns thievsihessn thievsihessn thievsihesns thievsihsens thievsihsesn thievsihsnes
thievsihsnse thievsihssne thievsihssen thievsihsesn thievsihsens thievsihssen thievsihssne thievsihsnse thievsihsnes
thievsinhess thievsinhess thievsinhses thievsinhsse thievsinhsse thievsinhses thievsinehss thievsinehss thievsineshs
thievsinessh thievsinessh thievsineshs thievsinsehs thievsinsesh thievsinshes thievsinshse thievsinsshe thievsinsseh
thievsinsesh thievsinsehs thievsinsseh thievsinsshe thievsinshse thievsinshes thievsienhss thievsienhss thievsienshs
thievsienssh thievsienssh thievsienshs thievsiehnss thievsiehnss thievsiehsns thievsiehssn thievsiehssn thievsiehsns
thievsieshns thievsieshsn thievsiesnhs thievsiesnsh thievsiessnh thievsiesshn thievsieshsn thievsieshns thievsiesshn
thievsiessnh thievsiesnsh thievsiesnhs thievsisnehs thievsisnesh thievsisnhes thievsisnhse thievsisnshe thievsisnseh
thievsisenhs thievsisensh thievsisehns thievsisehsn thievsiseshn thievsisesnh thievsishens thievsishesn thievsishnes
thievsishnse thievsishsne thievsishsen thievsissehn thievsissenh thievsisshen thievsisshne thievsissnhe thievsissneh
thievsisnesh thievsisnehs thievsisnseh thievsisnshe thievsisnhse thievsisnhes thievsisensh thievsisenhs thievsisesnh
thievsiseshn thievsisehsn thievsisehns thievsissenh thievsissehn thievsissneh thievsissnhe thievsisshne thievsisshen
thievsishesn thievsishens thievsishsen thievsishsne thievsishnse thievsishnes thievsshneis thievsshnesi thievsshnies
thievsshnise thievsshnsie thievsshnsei thievsshenis thievsshensi thievssheins thievssheisn thievsshesin thievsshesni
thievsshiens thievsshiesn thievsshines thievsshinse thievsshisne thievsshisen thievsshsein thievsshseni thievsshsien
thievsshsine thievsshsnie thievsshsnei thievssnheis thievssnhesi thievssnhies thievssnhise thievssnhsie thievssnhsei
thievssnehis thievssnehsi thievssneihs thievssneish thievssnesih thievssneshi thievssniehs thievssniesh thievssnihes
thievssnihse thievssnishe thievssniseh thievssnseih thievssnsehi thievssnsieh thievssnsihe thievssnshie thievssnshei
thievssenhis thievssenhsi thievssenihs thievssenish thievssensih thievssenshi thievssehnis thievssehnsi thievssehins
thievssehisn thievssehsin thievssehsni thievsseihns thievsseihsn thievsseinhs thievsseinsh thievsseisnh thievsseishn
thievsseshin thievsseshni thievssesihn thievssesinh thievssesnih thievssesnhi thievssinehs thievssinesh thievssinhes
thievssinhse thievssinshe thievssinseh thievssienhs thievssiensh thievssiehns thievssiehsn thievssieshn thievssiesnh
thievssihens thievssihesn thievssihnes thievssihnse thievssihsne thievssihsen thievssisehn thievssisenh thievssishen
thievssishne thievssisnhe thievssisneh thievsssneih thievsssnehi thievsssnieh thievsssnihe thievsssnhie thievsssnhei
thievsssenih thievsssenhi thievssseinh thievssseihn thievsssehin thievsssehni thievsssienh thievsssiehn thievsssineh
thievsssinhe thievsssihne thievsssihen thievssshein thievsssheni thievssshien thievssshine thievssshnie thievssshnei
thievsshnesi thievsshneis thievsshnsei thievsshnsie thievsshnise thievsshnies thievsshensi thievsshenis thievsshesni
thievsshesin thievssheisn thievssheins thievsshseni thievsshsein thievsshsnei thievsshsnie thievsshsine thievsshsien
thievsshiesn thievsshiens thievsshisen thievsshisne thievsshinse thievsshines thievssnhesi thievssnheis thievssnhsei
thievssnhsie thievssnhise thievssnhies thievssnehsi thievssnehis thievssneshi thievssnesih thievssneish thievssneihs
thievssnsehi thievssnseih thievssnshei thievssnshie thievssnsihe thievssnsieh thievssniesh thievssniehs thievssniseh
thievssnishe thievssnihse thievssnihes thievssenhsi thievssenhis thievssenshi thievssensih thievssenish thievssenihs
thievssehnsi thievssehnis thievssehsni thievssehsin thievssehisn thievssehins thievsseshni thievsseshin thievssesnhi
thievssesnih thievssesinh thievssesihn thievsseihsn thievsseihns thievsseishn thievsseisnh thievsseinsh thievsseinhs
thievsssnehi thievsssneih thievsssnhei thievsssnhie thievsssnihe thievsssnieh thievsssenhi thievsssenih thievsssehni
thievsssehin thievssseihn thievssseinh thievsssheni thievssshein thievssshnei thievssshnie thievssshine thievssshien
thievsssiehn thievsssienh thievsssihen thievsssihne thievsssinhe thievsssineh thievssinesh thievssinehs thievssinseh
thievssinshe thievssinhse thievssinhes thievssiensh thievssienhs thievssiesnh thievssieshn thievssiehsn thievssiehns
thievssisenh thievssisehn thievssisneh thievssisnhe thievssishne thievssishen thievssihesn thievssihens thievssihsen
thievssihsne thievssihnse thievssihnes thievshsnesi thievshsneis thievshsnsei thievshsnsie thievshsnise thievshsnies
thievshsensi thievshsenis thievshsesni thievshsesin thievshseisn thievshseins thievshsseni thievshssein thievshssnei
thievshssnie thievshssine thievshssien thievshsiesn thievshsiens thievshsisen thievshsisne thievshsinse thievshsines
thievshnsesi thievshnseis thievshnssei thievshnssie thievshnsise thievshnsies thievshnessi thievshnesis thievshnessi
thievshnesis thievshneiss thievshneiss thievshnsesi thievshnseis thievshnssei thievshnssie thievshnsise thievshnsies
thievshniess thievshniess thievshnises thievshnisse thievshnisse thievshnises thievshenssi thievshensis thievshenssi
thievshensis thievsheniss thievsheniss thievshesnsi thievshesnis thievshessni thievshessin thievshesisn thievshesins
thievshessni thievshessin thievshesnsi thievshesnis thievshesins thievshesisn thievsheissn thievsheisns thievsheissn
thievsheisns thievsheinss thievsheinss thievshsnesi thievshsneis thievshsnsei thievshsnsie thievshsnise thievshsnies
thievshsensi thievshsenis thievshsesni thievshsesin thievshseisn thievshseins thievshsseni thievshssein thievshssnei
thievshssnie thievshssine thievshssien thievshsiesn thievshsiens thievshsisen thievshsisne thievshsinse thievshsines
thievshiness thievshiness thievshinses thievshinsse thievshinsse thievshinses thievshienss thievshienss thievshiesns
thievshiessn thievshiessn thievshiesns thievshisens thievshisesn thievshisnes thievshisnse thievshissne thievshissen
thievshisesn thievshisens thievshissen thievshissne thievshisnse thievshisnes thievsnhsesi thievsnhseis thievsnhssei
thievsnhssie thievsnhsise thievsnhsies thievsnhessi thievsnhesis thievsnhessi thievsnhesis thievsnheiss thievsnheiss
thievsnhsesi thievsnhseis thievsnhssei thievsnhssie thievsnhsise thievsnhsies thievsnhiess thievsnhiess thievsnhises
thievsnhisse thievsnhisse thievsnhises thievsnshesi thievsnsheis thievsnshsei thievsnshsie thievsnshise thievsnshies
thievsnsehsi thievsnsehis thievsnseshi thievsnsesih thievsnseish thievsnseihs thievsnssehi thievsnsseih thievsnsshei
thievsnsshie thievsnssihe thievsnssieh thievsnsiesh thievsnsiehs thievsnsiseh thievsnsishe thievsnsihse thievsnsihes
thievsneshsi thievsneshis thievsnesshi thievsnessih thievsnesish thievsnesihs thievsnehssi thievsnehsis thievsnehssi
thievsnehsis thievsnehiss thievsnehiss thievsneshsi thievsneshis thievsnesshi thievsnessih thievsnesish thievsnesihs
thievsneihss thievsneihss thievsneishs thievsneissh thievsneissh thievsneishs thievsnssehi thievsnsseih thievsnsshei
thievsnsshie thievsnssihe thievsnssieh thievsnseshi thievsnsesih thievsnsehsi thievsnsehis thievsnseihs thievsnseish
thievsnshesi thievsnsheis thievsnshsei thievsnshsie thievsnshise thievsnshies thievsnsiehs thievsnsiesh thievsnsihes
thievsnsihse thievsnsishe thievsnsiseh thievsnisesh thievsnisehs thievsnisseh thievsnisshe thievsnishse thievsnishes
thievsniessh thievsnieshs thievsniessh thievsnieshs thievsniehss thievsniehss thievsnisesh thievsnisehs thievsnisseh
thievsnisshe thievsnishse thievsnishes thievsnihess thievsnihess thievsnihses thievsnihsse thievsnihsse thievsnihses
thievsehnssi thievsehnsis thievsehnssi thievsehnsis thievsehniss thievsehniss thievsehsnsi thievsehsnis thievsehssni
thievsehssin thievsehsisn thievsehsins thievsehssni thievsehssin thievsehsnsi thievsehsnis thievsehsins thievsehsisn
thievsehissn thievsehisns thievsehissn thievsehisns thievsehinss thievsehinss thievsenhssi thievsenhsis thievsenhssi
thievsenhsis thievsenhiss thievsenhiss thievsenshsi thievsenshis thievsensshi thievsenssih thievsensish thievsensihs
thievsensshi thievsenssih thievsenshsi thievsenshis thievsensihs thievsensish thievsenissh thievsenishs thievsenissh
thievsenishs thievsenihss thievsenihss thievsesnhsi thievsesnhis thievsesnshi thievsesnsih thievsesnish thievsesnihs
thievseshnsi thievseshnis thievseshsni thievseshsin thievseshisn thievseshins thievsesshni thievsesshin thievsessnhi
thievsessnih thievsessinh thievsessihn thievsesihsn thievsesihns thievsesishn thievsesisnh thievsesinsh thievsesinhs
thievsesnshi thievsesnsih thievsesnhsi thievsesnhis thievsesnihs thievsesnish thievsessnhi thievsessnih thievsesshni
thievsesshin thievsessihn thievsessinh thievseshsni thievseshsin thievseshnsi thievseshnis thievseshins thievseshisn
thievsesishn thievsesisnh thievsesihsn thievsesihns thievsesinhs thievsesinsh thievseinssh thievseinshs thievseinssh
thievseinshs thievseinhss thievseinhss thievseisnsh thievseisnhs thievseissnh thievseisshn thievseishsn thievseishns
thievseissnh thievseisshn thievseisnsh thievseisnhs thievseishns thievseishsn thievseihssn thievseihsns thievseihssn
thievseihsns thievseihnss thievseihnss thievsshnesi thievsshneis thievsshnsei thievsshnsie thievsshnise thievsshnies
thievsshensi thievsshenis thievsshesni thievsshesin thievssheisn thievssheins thievsshseni thievsshsein thievsshsnei
thievsshsnie thievsshsine thievsshsien thievsshiesn thievsshiens thievsshisen thievsshisne thievsshinse thievsshines
thievssnhesi thievssnheis thievssnhsei thievssnhsie thievssnhise thievssnhies thievssnehsi thievssnehis thievssneshi
thievssnesih thievssneish thievssneihs thievssnsehi thievssnseih thievssnshei thievssnshie thievssnsihe thievssnsieh
thievssniesh thievssniehs thievssniseh thievssnishe thievssnihse thievssnihes thievssenhsi thievssenhis thievssenshi
thievssensih thievssenish thievssenihs thievssehnsi thievssehnis thievssehsni thievssehsin thievssehisn thievssehins
thievsseshni thievsseshin thievssesnhi thievssesnih thievssesinh thievssesihn thievsseihsn thievsseihns thievsseishn
thievsseisnh thievsseinsh thievsseinhs thievsssnehi thievsssneih thievsssnhei thievsssnhie thievsssnihe thievsssnieh
thievsssenhi thievsssenih thievsssehni thievsssehin thievssseihn thievssseinh thievsssheni thievssshein thievssshnei
thievssshnie thievssshine thievssshien thievsssiehn thievsssienh thievsssihen thievsssihne thievsssinhe thievsssineh
thievssinesh thievssinehs thievssinseh thievssinshe thievssinhse thievssinhes thievssiensh thievssienhs thievssiesnh
thievssieshn thievssiehsn thievssiehns thievssisenh thievssisehn thievssisneh thievssisnhe thievssishne thievssishen
thievssihesn thievssihens thievssihsen thievssihsne thievssihnse thievssihnes thievsihness thievsihness thievsihnses
thievsihnsse thievsihnsse thievsihnses thievsihenss thievsihenss thievsihesns thievsihessn thievsihessn thievsihesns
thievsihsens thievsihsesn thievsihsnes thievsihsnse thievsihssne thievsihssen thievsihsesn thievsihsens thievsihssen
thievsihssne thievsihsnse thievsihsnes thievsinhess thievsinhess thievsinhses thievsinhsse thievsinhsse thievsinhses
thievsinehss thievsinehss thievsineshs thievsinessh thievsinessh thievsineshs thievsinsehs thievsinsesh thievsinshes
thievsinshse thievsinsshe thievsinsseh thievsinsesh thievsinsehs thievsinsseh thievsinsshe thievsinshse thievsinshes
thievsienhss thievsienhss thievsienshs thievsienssh thievsienssh thievsienshs thievsiehnss thievsiehnss thievsiehsns
thievsiehssn thievsiehssn thievsiehsns thievsieshns thievsieshsn thievsiesnhs thievsiesnsh thievsiessnh thievsiesshn
thievsieshsn thievsieshns thievsiesshn thievsiessnh thievsiesnsh thievsiesnhs thievsisnehs thievsisnesh thievsisnhes
thievsisnhse thievsisnshe thievsisnseh thievsisenhs thievsisensh thievsisehns thievsisehsn thievsiseshn thievsisesnh
thievsishens thievsishesn thievsishnes thievsishnse thievsishsne thievsishsen thievsissehn thievsissenh thievsisshen
thievsisshne thievsissnhe thievsissneh thievsisnesh thievsisnehs thievsisnseh thievsisnshe thievsisnhse thievsisnhes
thievsisensh thievsisenhs thievsisesnh thievsiseshn thievsisehsn thievsisehns thievsissenh thievsissehn thievsissneh
thievsissnhe thievsisshne thievsisshen thievsishesn thievsishens thievsishsen thievsishsne thievsishnse thievsishnes

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us