easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

radioactivity

randleman

levitate

neysa

ccedudm

bactrites

brieg

miscom

emetin

microtone

bugbear

semigroove

crocidolite

fossilated

interfruitful

capecod

chastisement

mashuensis


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: thanatophobe
cipher variations:
uibobupqipcf vjcpcvqrjqdg wkdqdwrskreh xlerexstlsfi ymfsfytumtgj
zngtgzuvnuhk aohuhavwovil bpivibwxpwjm cqjwjcxyqxkn drkxkdyzrylo
eslylezaszmp ftmzmfabtanq gunangbcubor hvobohcdvcps iwpcpidewdqt
jxqdqjefxeru kyrerkfgyfsv lzsfslghzgtw matgtmhiahux nbuhunijbivy
ocvivojkcjwz pdwjwpkldkxa qexkxqlmelyb rfylyrmnfmzc sgzmzsnognad

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: thanatophobe
Cipher: gszmzglkslyv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: thanatophobe
Cipher: BAABA AABBB AAAAA ABBAA AAAAA BAABA ABBAB ABBBA AABBB ABBAB AAAAB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: thanatophobe
cipher variations:
uibobupqipcfgwbobgruwrenskbobstyktgveybobevcyvidqmbobqxgmxklcabobczkazmtacbobadscdqjmqbobmfwqfsr
yebobyhaehuzksbobkjesjwhwgbobwliglypiubobinmunaxvjcpcvqrjqdghxcpchsvxsfotlcpctuzluhwfzcpcfwdzwje
rncpcryhnylmdbcpcdalbanubdcpcbetderknrcpcngxrgtszfcpczibfivaltcpclkftkxixhcpcxmjhmzqjvcpcjonvoby
wkdqdwrskrehiydqditwytgpumdqduvamvixgadqdgxeaxkfsodqdsziozmnecdqdebmcbovcedqdcfuefslosdqdohyshut
agdqdajcgjwbmudqdmlgulyjyidqdynkinarkwdqdkpowpczxlerexstlsfijzerejuxzuhqvnerevwbnwjyhberehyfbylg
tperetajpanofderefcndcpwdferedgvfgtmpterepiztivubherebkdhkxcnverenmhvmzkzjerezoljobslxerelqpxqda
ymfsfytumtgjkafsfkvyavirwofsfwxcoxkzicfsfizgczmhuqfsfubkqbopgefsfgdoedqxegfsfehwghunqufsfqjaujwv
cifsfcleilydowfsfoniwnalakfsfapmkpctmyfsfmrqyrebzngtgzuvnuhklbgtglwzbwjsxpgtgxydpylajdgtgjahdani
vrgtgvclrcpqhfgtghepferyfhgtgfixhivorvgtgrkbvkxwdjgtgdmfjmzepxgtgpojxobmblgtgbqnlqdunzgtgnsrzsfc
aohuhavwovilmchuhmxacxktyqhuhyzeqzmbkehuhkbiebojwshuhwdmsdqrighuhifqgfszgihuhgjyijwpswhuhslcwlyx
ekhuhengknafqyhuhqpkypcncmhuhcromrevoahuhotsatgdbpivibwxpwjmndivinybdyluzrivizafranclfivilcjfcpk
xtivixentersjhivijgrhgtahjivihkzjkxqtxivitmdxmzyflivifohlobgrzivirqlzqdodnividspnsfwpbiviputbuhe
cqjwjcxyqxknoejwjozcezmvasjwjabgsbodmgjwjmdkgdqlyujwjyfoufstkijwjkhsihubikjwjilaklyruyjwjuneynaz
gmjwjgpimpchsajwjsrmarepeojwjetqotgxqcjwjqvucvifdrkxkdyzrylopfkxkpadfanwbtkxkbchtcpenhkxknelherm
zvkxkzgpvgtuljkxklitjivcjlkxkjmblmzsvzkxkvofzobahnkxkhqjnqditbkxktsnbsfqfpkxkfurpuhyrdkxkrwvdwjg
eslylezaszmpqglylqbegboxculylcdiudqfoilylofmifsnawlylahqwhuvmklylmjukjwdkmlylkncmnatwalylwpgapcb
iolylirkorejuclylutoctgrgqlylgvsqvizselylsxwexkhftmzmfabtanqrhmzmrcfhcpydvmzmdejvergpjmzmpgnjgto
bxmzmbirxivwnlmzmnkvlkxelnmzmlodnobuxbmzmxqhbqdcjpmzmjslpsfkvdmzmvupduhshrmzmhwtrwjatfmzmtyxfyli
gunangbcuborsinansdgidqzewnanefkwfshqknanqhokhupcynancjsyjwxomnanolwmlyfmonanmpeopcvycnanyricred
kqnanktmqtglwenanwvqevitisnanixusxkbugnanuzygzmjhvobohcdvcpstjobotehjerafxobofglxgtirloboriplivq
dzobodktzkxypnobopmxnmzgnpobonqfpqdwzdobozsjdsfelrobolunruhmxfoboxwrfwjujtobojyvtylcvhobovazhank
iwpcpidewdqtukpcpufikfsbgypcpghmyhujsmpcpsjqmjwreapcpelualyzqopcpqnyonahoqpcporgqrexaepcpatketgf
mspcpmvosvinygpcpyxsgxkvkupcpkzwuzmdwipcpwbaiboljxqdqjefxeruvlqdqvgjlgtchzqdqhinzivktnqdqtkrnkxs
fbqdqfmvbmzarpqdqrozpobiprqdqpshrsfybfqdqbulfuhgntqdqnwptwjozhqdqzythylwlvqdqlaxvanexjqdqxcbjcpm
kyrerkfgyfsvwmrerwhkmhudiarerijoajwluorerulsolytgcrergnwcnabsqrerspaqpcjqsrerqtistgzcgrercvmgvih
oureroxquxkpairerazuizmxmwrermbywbofykrerydckdqnlzsfslghzgtwxnsfsxilnivejbsfsjkpbkxmvpsfsvmtpmzu
hdsfshoxdobctrsfstqbrqdkrtsfsrujtuhadhsfsdwnhwjipvsfspyrvylqbjsfsbavjanynxsfsnczxcpgzlsfszedlero
matgtmhiahuxyotgtyjmojwfkctgtklqclynwqtgtwnuqnavietgtipyepcdustgturcsrelsutgtsvkuvibeitgtexoixkj
qwtgtqzswzmrcktgtcbwkbozoytgtodaydqhamtgtafemfspnbuhunijbivyzpuhuzknpkxglduhulmrdmzoxruhuxovrobw
jfuhujqzfqdevtuhuvsdtsfmtvuhutwlvwjcfjuhufypjylkrxuhuratxansdluhudcxlcpapzuhupebzeribnuhubgfngtq
ocvivojkcjwzaqvivaloqlyhmevivmnsenapysvivypwspcxkgvivkragrefwuvivwteutgnuwvivuxmwxkdgkvivgzqkzml
syvivsbuybotemvivedymdqbqavivqfcafsjcovivchgohurpdwjwpkldkxabrwjwbmprmzinfwjwnotfobqztwjwzqxtqdy
lhwjwlsbhsfgxvwjwxufvuhovxwjwvynxylehlwjwharlanmtzwjwtcvzcpufnwjwfeznercrbwjwrgdbgtkdpwjwdihpivs
qexkxqlmelybcsxkxcnqsnajogxkxopugpcrauxkxaryurezmixkxmtcitghywxkxyvgwvipwyxkxwzoyzmfimxkxibsmbon
uaxkxudwadqvgoxkxgfaofsdscxkxshechuleqxkxejiqjwtrfylyrmnfmzcdtylydortobkphylypqvhqdsbvylybszvsfa
njylynudjuhizxylyzwhxwjqxzylyxapzangjnylyjctncpovbylyvexberwhpylyhgbpgtetdylytifdivmfrylyfkjrkxu
sgzmzsnognadeuzmzepsupclqizmzqrwiretcwzmzctawtgbokzmzovekvijayzmzaxiyxkryazmzybqabohkozmzkduodqp
wczmzwfycfsxiqzmzihcqhufuezmzujgejwngszmzglkslyvthanatophobefvanafqtvqdmrjanarsxjsfudxanadubxuhc
planapwflwjkbzanabyjzylszbanazcrbcpilpanalevperqxdanaxgzdgtyjranajidrivgvfanavkhfkxohtanahmltmzw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: thanatophobe
Cipher: gunangbcubor

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: thanatophobe
Cipher: 443211331144435332432151

Extended Methods:
Method #1

Plaintext: thanatophobe
method variations:
ynfsfytuntgkdslxldyzsympixqcqidexdruocvhvoikciwz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
t h a n a t o p h o b e 
4 3 1 3 1 4 4 5 3 4 2 5 
4 2 1 3 1 4 3 3 2 3 1 1 
They are then read out in rows:
431314453425421314332311
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: thanatophobe
Cipher: olqyswilqnma

Read more ...
Method #3

Plaintext: thanatophobe
method variations:
oblcqtxnrhvq blcqtxnrhvqo lcqtxnrhvqob
cqtxnrhvqobl qtxnrhvqoblc txnrhvqoblcq
xnrhvqoblcqt nrhvqoblcqtx rhvqoblcqtxn
hvqoblcqtxnr vqoblcqtxnrh qoblcqtxnrhv

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: thanatophobe

first 5040 cipher variations(475687488 total)
thanatophobe thanatophoeb thanatophboe thanatophbeo thanatophebo thanatopheob thanatopohbe thanatopoheb thanatopobhe
thanatopobeh thanatopoebh thanatopoehb thanatopbohe thanatopboeh thanatopbhoe thanatopbheo thanatopbeho thanatopbeoh
thanatopeobh thanatopeohb thanatopeboh thanatopebho thanatopehbo thanatopehob thanatohpobe thanatohpoeb thanatohpboe
thanatohpbeo thanatohpebo thanatohpeob thanatohopbe thanatohopeb thanatohobpe thanatohobep thanatohoebp thanatohoepb
thanatohbope thanatohboep thanatohbpoe thanatohbpeo thanatohbepo thanatohbeop thanatoheobp thanatoheopb thanatohebop
thanatohebpo thanatohepbo thanatohepob thanatoohpbe thanatoohpeb thanatoohbpe thanatoohbep thanatoohebp thanatoohepb
thanatoophbe thanatoopheb thanatoopbhe thanatoopbeh thanatoopebh thanatoopehb thanatoobphe thanatoobpeh thanatoobhpe
thanatoobhep thanatoobehp thanatoobeph thanatooepbh thanatooephb thanatooebph thanatooebhp thanatooehbp thanatooehpb
thanatobhope thanatobhoep thanatobhpoe thanatobhpeo thanatobhepo thanatobheop thanatobohpe thanatobohep thanatobophe
thanatobopeh thanatoboeph thanatoboehp thanatobpohe thanatobpoeh thanatobphoe thanatobpheo thanatobpeho thanatobpeoh
thanatobeoph thanatobeohp thanatobepoh thanatobepho thanatobehpo thanatobehop thanatoehobp thanatoehopb thanatoehbop
thanatoehbpo thanatoehpbo thanatoehpob thanatoeohbp thanatoeohpb thanatoeobhp thanatoeobph thanatoeopbh thanatoeophb
thanatoebohp thanatoeboph thanatoebhop thanatoebhpo thanatoebpho thanatoebpoh thanatoepobh thanatoepohb thanatoepboh
thanatoepbho thanatoephbo thanatoephob thanatpohobe thanatpohoeb thanatpohboe thanatpohbeo thanatpohebo thanatpoheob
thanatpoohbe thanatpooheb thanatpoobhe thanatpoobeh thanatpooebh thanatpooehb thanatpobohe thanatpoboeh thanatpobhoe
thanatpobheo thanatpobeho thanatpobeoh thanatpoeobh thanatpoeohb thanatpoeboh thanatpoebho thanatpoehbo thanatpoehob
thanatphoobe thanatphooeb thanatphoboe thanatphobeo thanatphoebo thanatphoeob thanatphoobe thanatphooeb thanatphoboe
thanatphobeo thanatphoebo thanatphoeob thanatphbooe thanatphboeo thanatphbooe thanatphboeo thanatphbeoo thanatphbeoo
thanatpheobo thanatpheoob thanatpheboo thanatpheboo thanatpheobo thanatpheoob thanatpohobe thanatpohoeb thanatpohboe
thanatpohbeo thanatpohebo thanatpoheob thanatpoohbe thanatpooheb thanatpoobhe thanatpoobeh thanatpooebh thanatpooehb
thanatpobohe thanatpoboeh thanatpobhoe thanatpobheo thanatpobeho thanatpobeoh thanatpoeobh thanatpoeohb thanatpoeboh
thanatpoebho thanatpoehbo thanatpoehob thanatpbhooe thanatpbhoeo thanatpbhooe thanatpbhoeo thanatpbheoo thanatpbheoo
thanatpbohoe thanatpboheo thanatpboohe thanatpbooeh thanatpboeoh thanatpboeho thanatpboohe thanatpbooeh thanatpbohoe
thanatpboheo thanatpboeho thanatpboeoh thanatpbeooh thanatpbeoho thanatpbeooh thanatpbeoho thanatpbehoo thanatpbehoo
thanatpehobo thanatpehoob thanatpehboo thanatpehboo thanatpehobo thanatpehoob thanatpeohbo thanatpeohob thanatpeobho
thanatpeoboh thanatpeoobh thanatpeoohb thanatpeboho thanatpebooh thanatpebhoo thanatpebhoo thanatpeboho thanatpebooh
thanatpeoobh thanatpeoohb thanatpeoboh thanatpeobho thanatpeohbo thanatpeohob thanathpoobe thanathpooeb thanathpoboe
thanathpobeo thanathpoebo thanathpoeob thanathpoobe thanathpooeb thanathpoboe thanathpobeo thanathpoebo thanathpoeob
thanathpbooe thanathpboeo thanathpbooe thanathpboeo thanathpbeoo thanathpbeoo thanathpeobo thanathpeoob thanathpeboo
thanathpeboo thanathpeobo thanathpeoob thanathopobe thanathopoeb thanathopboe thanathopbeo thanathopebo thanathopeob
thanathoopbe thanathoopeb thanathoobpe thanathoobep thanathooebp thanathooepb thanathobope thanathoboep thanathobpoe
thanathobpeo thanathobepo thanathobeop thanathoeobp thanathoeopb thanathoebop thanathoebpo thanathoepbo thanathoepob
thanathoopbe thanathoopeb thanathoobpe thanathoobep thanathooebp thanathooepb thanathopobe thanathopoeb thanathopboe
thanathopbeo thanathopebo thanathopeob thanathobpoe thanathobpeo thanathobope thanathoboep thanathobeop thanathobepo
thanathoepbo thanathoepob thanathoebpo thanathoebop thanathoeobp thanathoeopb thanathboope thanathbooep thanathbopoe
thanathbopeo thanathboepo thanathboeop thanathboope thanathbooep thanathbopoe thanathbopeo thanathboepo thanathboeop
thanathbpooe thanathbpoeo thanathbpooe thanathbpoeo thanathbpeoo thanathbpeoo thanathbeopo thanathbeoop thanathbepoo
thanathbepoo thanathbeopo thanathbeoop thanatheoobp thanatheoopb thanatheobop thanatheobpo thanatheopbo thanatheopob
thanatheoobp thanatheoopb thanatheobop thanatheobpo thanatheopbo thanatheopob thanatheboop thanathebopo thanatheboop
thanathebopo thanathebpoo thanathebpoo thanathepobo thanathepoob thanathepboo thanathepboo thanathepobo thanathepoob
thanatophobe thanatophoeb thanatophboe thanatophbeo thanatophebo thanatopheob thanatopohbe thanatopoheb thanatopobhe
thanatopobeh thanatopoebh thanatopoehb thanatopbohe thanatopboeh thanatopbhoe thanatopbheo thanatopbeho thanatopbeoh
thanatopeobh thanatopeohb thanatopeboh thanatopebho thanatopehbo thanatopehob thanatohpobe thanatohpoeb thanatohpboe
thanatohpbeo thanatohpebo thanatohpeob thanatohopbe thanatohopeb thanatohobpe thanatohobep thanatohoebp thanatohoepb
thanatohbope thanatohboep thanatohbpoe thanatohbpeo thanatohbepo thanatohbeop thanatoheobp thanatoheopb thanatohebop
thanatohebpo thanatohepbo thanatohepob thanatoohpbe thanatoohpeb thanatoohbpe thanatoohbep thanatoohebp thanatoohepb
thanatoophbe thanatoopheb thanatoopbhe thanatoopbeh thanatoopebh thanatoopehb thanatoobphe thanatoobpeh thanatoobhpe
thanatoobhep thanatoobehp thanatoobeph thanatooepbh thanatooephb thanatooebph thanatooebhp thanatooehbp thanatooehpb
thanatobhope thanatobhoep thanatobhpoe thanatobhpeo thanatobhepo thanatobheop thanatobohpe thanatobohep thanatobophe
thanatobopeh thanatoboeph thanatoboehp thanatobpohe thanatobpoeh thanatobphoe thanatobpheo thanatobpeho thanatobpeoh
thanatobeoph thanatobeohp thanatobepoh thanatobepho thanatobehpo thanatobehop thanatoehobp thanatoehopb thanatoehbop
thanatoehbpo thanatoehpbo thanatoehpob thanatoeohbp thanatoeohpb thanatoeobhp thanatoeobph thanatoeopbh thanatoeophb
thanatoebohp thanatoeboph thanatoebhop thanatoebhpo thanatoebpho thanatoebpoh thanatoepobh thanatoepohb thanatoepboh
thanatoepbho thanatoephbo thanatoephob thanatbphooe thanatbphoeo thanatbphooe thanatbphoeo thanatbpheoo thanatbpheoo
thanatbpohoe thanatbpoheo thanatbpoohe thanatbpooeh thanatbpoeoh thanatbpoeho thanatbpoohe thanatbpooeh thanatbpohoe
thanatbpoheo thanatbpoeho thanatbpoeoh thanatbpeooh thanatbpeoho thanatbpeooh thanatbpeoho thanatbpehoo thanatbpehoo
thanatbhpooe thanatbhpoeo thanatbhpooe thanatbhpoeo thanatbhpeoo thanatbhpeoo thanatbhopoe thanatbhopeo thanatbhoope
thanatbhooep thanatbhoeop thanatbhoepo thanatbhoope thanatbhooep thanatbhopoe thanatbhopeo thanatbhoepo thanatbhoeop
thanatbheoop thanatbheopo thanatbheoop thanatbheopo thanatbhepoo thanatbhepoo thanatbohpoe thanatbohpeo thanatbohope
thanatbohoep thanatboheop thanatbohepo thanatbophoe thanatbopheo thanatbopohe thanatbopoeh thanatbopeoh thanatbopeho
thanatboophe thanatboopeh thanatboohpe thanatboohep thanatbooehp thanatbooeph thanatboepoh thanatboepho thanatboeoph
thanatboeohp thanatboehop thanatboehpo thanatbohope thanatbohoep thanatbohpoe thanatbohpeo thanatbohepo thanatboheop
thanatboohpe thanatboohep thanatboophe thanatboopeh thanatbooeph thanatbooehp thanatbopohe thanatbopoeh thanatbophoe
thanatbopheo thanatbopeho thanatbopeoh thanatboeoph thanatboeohp thanatboepoh thanatboepho thanatboehpo thanatboehop
thanatbehoop thanatbehopo thanatbehoop thanatbehopo thanatbehpoo thanatbehpoo thanatbeohop thanatbeohpo thanatbeoohp
thanatbeooph thanatbeopoh thanatbeopho thanatbeoohp thanatbeooph thanatbeohop thanatbeohpo thanatbeopho thanatbeopoh
thanatbepooh thanatbepoho thanatbepooh thanatbepoho thanatbephoo thanatbephoo thanatephobo thanatephoob thanatephboo
thanatephboo thanatephobo thanatephoob thanatepohbo thanatepohob thanatepobho thanatepoboh thanatepoobh thanatepoohb
thanatepboho thanatepbooh thanatepbhoo thanatepbhoo thanatepboho thanatepbooh thanatepoobh thanatepoohb thanatepoboh
thanatepobho thanatepohbo thanatepohob thanatehpobo thanatehpoob thanatehpboo thanatehpboo thanatehpobo thanatehpoob
thanatehopbo thanatehopob thanatehobpo thanatehobop thanatehoobp thanatehoopb thanatehbopo thanatehboop thanatehbpoo
thanatehbpoo thanatehbopo thanatehboop thanatehoobp thanatehoopb thanatehobop thanatehobpo thanatehopbo thanatehopob
thanateohpbo thanateohpob thanateohbpo thanateohbop thanateohobp thanateohopb thanateophbo thanateophob thanateopbho
thanateopboh thanateopobh thanateopohb thanateobpho thanateobpoh thanateobhpo thanateobhop thanateobohp thanateoboph
thanateoopbh thanateoophb thanateoobph thanateoobhp thanateoohbp thanateoohpb thanatebhopo thanatebhoop thanatebhpoo
thanatebhpoo thanatebhopo thanatebhoop thanatebohpo thanatebohop thanatebopho thanatebopoh thanatebooph thanateboohp
thanatebpoho thanatebpooh thanatebphoo thanatebphoo thanatebpoho thanatebpooh thanatebooph thanateboohp thanatebopoh
thanatebopho thanatebohpo thanatebohop thanateohobp thanateohopb thanateohbop thanateohbpo thanateohpbo thanateohpob
thanateoohbp thanateoohpb thanateoobhp thanateoobph thanateoopbh thanateoophb thanateobohp thanateoboph thanateobhop
thanateobhpo thanateobpho thanateobpoh thanateopobh thanateopohb thanateopboh thanateopbho thanateophbo thanateophob
thanaotphobe thanaotphoeb thanaotphboe thanaotphbeo thanaotphebo thanaotpheob thanaotpohbe thanaotpoheb thanaotpobhe
thanaotpobeh thanaotpoebh thanaotpoehb thanaotpbohe thanaotpboeh thanaotpbhoe thanaotpbheo thanaotpbeho thanaotpbeoh
thanaotpeobh thanaotpeohb thanaotpeboh thanaotpebho thanaotpehbo thanaotpehob thanaothpobe thanaothpoeb thanaothpboe
thanaothpbeo thanaothpebo thanaothpeob thanaothopbe thanaothopeb thanaothobpe thanaothobep thanaothoebp thanaothoepb
thanaothbope thanaothboep thanaothbpoe thanaothbpeo thanaothbepo thanaothbeop thanaotheobp thanaotheopb thanaothebop
thanaothebpo thanaothepbo thanaothepob thanaotohpbe thanaotohpeb thanaotohbpe thanaotohbep thanaotohebp thanaotohepb
thanaotophbe thanaotopheb thanaotopbhe thanaotopbeh thanaotopebh thanaotopehb thanaotobphe thanaotobpeh thanaotobhpe
thanaotobhep thanaotobehp thanaotobeph thanaotoepbh thanaotoephb thanaotoebph thanaotoebhp thanaotoehbp thanaotoehpb
thanaotbhope thanaotbhoep thanaotbhpoe thanaotbhpeo thanaotbhepo thanaotbheop thanaotbohpe thanaotbohep thanaotbophe
thanaotbopeh thanaotboeph thanaotboehp thanaotbpohe thanaotbpoeh thanaotbphoe thanaotbpheo thanaotbpeho thanaotbpeoh
thanaotbeoph thanaotbeohp thanaotbepoh thanaotbepho thanaotbehpo thanaotbehop thanaotehobp thanaotehopb thanaotehbop
thanaotehbpo thanaotehpbo thanaotehpob thanaoteohbp thanaoteohpb thanaoteobhp thanaoteobph thanaoteopbh thanaoteophb
thanaotebohp thanaoteboph thanaotebhop thanaotebhpo thanaotebpho thanaotebpoh thanaotepobh thanaotepohb thanaotepboh
thanaotepbho thanaotephbo thanaotephob thanaopthobe thanaopthoeb thanaopthboe thanaopthbeo thanaopthebo thanaoptheob
thanaoptohbe thanaoptoheb thanaoptobhe thanaoptobeh thanaoptoebh thanaoptoehb thanaoptbohe thanaoptboeh thanaoptbhoe
thanaoptbheo thanaoptbeho thanaoptbeoh thanaopteobh thanaopteohb thanaopteboh thanaoptebho thanaoptehbo thanaoptehob
thanaophtobe thanaophtoeb thanaophtboe thanaophtbeo thanaophtebo thanaophteob thanaophotbe thanaophoteb thanaophobte
thanaophobet thanaophoebt thanaophoetb thanaophbote thanaophboet thanaophbtoe thanaophbteo thanaophbeto thanaophbeot
thanaopheobt thanaopheotb thanaophebot thanaophebto thanaophetbo thanaophetob thanaopohtbe thanaopohteb thanaopohbte
thanaopohbet thanaopohebt thanaopohetb thanaopothbe thanaopotheb thanaopotbhe thanaopotbeh thanaopotebh thanaopotehb
thanaopobthe thanaopobteh thanaopobhte thanaopobhet thanaopobeht thanaopobeth thanaopoetbh thanaopoethb thanaopoebth
thanaopoebht thanaopoehbt thanaopoehtb thanaopbhote thanaopbhoet thanaopbhtoe thanaopbhteo thanaopbheto thanaopbheot
thanaopbohte thanaopbohet thanaopbothe thanaopboteh thanaopboeth thanaopboeht thanaopbtohe thanaopbtoeh thanaopbthoe
thanaopbtheo thanaopbteho thanaopbteoh thanaopbeoth thanaopbeoht thanaopbetoh thanaopbetho thanaopbehto thanaopbehot
thanaopehobt thanaopehotb thanaopehbot thanaopehbto thanaopehtbo thanaopehtob thanaopeohbt thanaopeohtb thanaopeobht
thanaopeobth thanaopeotbh thanaopeothb thanaopeboht thanaopeboth thanaopebhot thanaopebhto thanaopebtho thanaopebtoh
thanaopetobh thanaopetohb thanaopetboh thanaopetbho thanaopethbo thanaopethob thanaohptobe thanaohptoeb thanaohptboe
thanaohptbeo thanaohptebo thanaohpteob thanaohpotbe thanaohpoteb thanaohpobte thanaohpobet thanaohpoebt thanaohpoetb
thanaohpbote thanaohpboet thanaohpbtoe thanaohpbteo thanaohpbeto thanaohpbeot thanaohpeobt thanaohpeotb thanaohpebot
thanaohpebto thanaohpetbo thanaohpetob thanaohtpobe thanaohtpoeb thanaohtpboe thanaohtpbeo thanaohtpebo thanaohtpeob
thanaohtopbe thanaohtopeb thanaohtobpe thanaohtobep thanaohtoebp thanaohtoepb thanaohtbope thanaohtboep thanaohtbpoe
thanaohtbpeo thanaohtbepo thanaohtbeop thanaohteobp thanaohteopb thanaohtebop thanaohtebpo thanaohtepbo thanaohtepob
thanaohotpbe thanaohotpeb thanaohotbpe thanaohotbep thanaohotebp thanaohotepb thanaohoptbe thanaohopteb thanaohopbte
thanaohopbet thanaohopebt thanaohopetb thanaohobpte thanaohobpet thanaohobtpe thanaohobtep thanaohobetp thanaohobept
thanaohoepbt thanaohoeptb thanaohoebpt thanaohoebtp thanaohoetbp thanaohoetpb thanaohbtope thanaohbtoep thanaohbtpoe
thanaohbtpeo thanaohbtepo thanaohbteop thanaohbotpe thanaohbotep thanaohbopte thanaohbopet thanaohboept thanaohboetp
thanaohbpote thanaohbpoet thanaohbptoe thanaohbpteo thanaohbpeto thanaohbpeot thanaohbeopt thanaohbeotp thanaohbepot
thanaohbepto thanaohbetpo thanaohbetop thanaohetobp thanaohetopb thanaohetbop thanaohetbpo thanaohetpbo thanaohetpob
thanaoheotbp thanaoheotpb thanaoheobtp thanaoheobpt thanaoheopbt thanaoheoptb thanaohebotp thanaohebopt thanaohebtop
thanaohebtpo thanaohebpto thanaohebpot thanaohepobt thanaohepotb thanaohepbot thanaohepbto thanaoheptbo thanaoheptob
thanaoophtbe thanaoophteb thanaoophbte thanaoophbet thanaoophebt thanaoophetb thanaoopthbe thanaooptheb thanaooptbhe
thanaooptbeh thanaooptebh thanaooptehb thanaoopbthe thanaoopbteh thanaoopbhte thanaoopbhet thanaoopbeht thanaoopbeth
thanaoopetbh thanaoopethb thanaoopebth thanaoopebht thanaoopehbt thanaoopehtb thanaoohptbe thanaoohpteb thanaoohpbte
thanaoohpbet thanaoohpebt thanaoohpetb thanaoohtpbe thanaoohtpeb thanaoohtbpe thanaoohtbep thanaoohtebp thanaoohtepb
thanaoohbtpe thanaoohbtep thanaoohbpte thanaoohbpet thanaoohbept thanaoohbetp thanaoohetbp thanaoohetpb thanaoohebtp
thanaoohebpt thanaoohepbt thanaooheptb thanaoothpbe thanaoothpeb thanaoothbpe thanaoothbep thanaoothebp thanaoothepb
thanaootphbe thanaootpheb thanaootpbhe thanaootpbeh thanaootpebh thanaootpehb thanaootbphe thanaootbpeh thanaootbhpe
thanaootbhep thanaootbehp thanaootbeph thanaootepbh thanaootephb thanaootebph thanaootebhp thanaootehbp thanaootehpb
thanaoobhtpe thanaoobhtep thanaoobhpte thanaoobhpet thanaoobhept thanaoobhetp thanaoobthpe thanaoobthep thanaoobtphe
thanaoobtpeh thanaoobteph thanaoobtehp thanaoobpthe thanaoobpteh thanaoobphte thanaoobphet thanaoobpeht thanaoobpeth
thanaoobetph thanaoobethp thanaoobepth thanaoobepht thanaoobehpt thanaoobehtp thanaooehtbp thanaooehtpb thanaooehbtp
thanaooehbpt thanaooehpbt thanaooehptb thanaooethbp thanaooethpb thanaooetbhp thanaooetbph thanaooetpbh thanaooetphb
thanaooebthp thanaooebtph thanaooebhtp thanaooebhpt thanaooebpht thanaooebpth thanaooeptbh thanaooepthb thanaooepbth
thanaooepbht thanaooephbt thanaooephtb thanaobphote thanaobphoet thanaobphtoe thanaobphteo thanaobpheto thanaobpheot
thanaobpohte thanaobpohet thanaobpothe thanaobpoteh thanaobpoeth thanaobpoeht thanaobptohe thanaobptoeh thanaobpthoe
thanaobptheo thanaobpteho thanaobpteoh thanaobpeoth thanaobpeoht thanaobpetoh thanaobpetho thanaobpehto thanaobpehot
thanaobhpote thanaobhpoet thanaobhptoe thanaobhpteo thanaobhpeto thanaobhpeot thanaobhopte thanaobhopet thanaobhotpe
thanaobhotep thanaobhoetp thanaobhoept thanaobhtope thanaobhtoep thanaobhtpoe thanaobhtpeo thanaobhtepo thanaobhteop
thanaobheotp thanaobheopt thanaobhetop thanaobhetpo thanaobhepto thanaobhepot thanaobohpte thanaobohpet thanaobohtpe
thanaobohtep thanaobohetp thanaobohept thanaobophte thanaobophet thanaobopthe thanaobopteh thanaobopeth thanaobopeht
thanaobotphe thanaobotpeh thanaobothpe thanaobothep thanaobotehp thanaoboteph thanaoboepth thanaoboepht thanaoboetph
thanaoboethp thanaoboehtp thanaoboehpt thanaobthope thanaobthoep thanaobthpoe thanaobthpeo thanaobthepo thanaobtheop
thanaobtohpe thanaobtohep thanaobtophe thanaobtopeh thanaobtoeph thanaobtoehp thanaobtpohe thanaobtpoeh thanaobtphoe
thanaobtpheo thanaobtpeho thanaobtpeoh thanaobteoph thanaobteohp thanaobtepoh thanaobtepho thanaobtehpo thanaobtehop
thanaobehotp thanaobehopt thanaobehtop thanaobehtpo thanaobehpto thanaobehpot thanaobeohtp thanaobeohpt thanaobeothp
thanaobeotph thanaobeopth thanaobeopht thanaobetohp thanaobetoph thanaobethop thanaobethpo thanaobetpho thanaobetpoh
thanaobepoth thanaobepoht thanaobeptoh thanaobeptho thanaobephto thanaobephot thanaoephobt thanaoephotb thanaoephbot
thanaoephbto thanaoephtbo thanaoephtob thanaoepohbt thanaoepohtb thanaoepobht thanaoepobth thanaoepotbh thanaoepothb
thanaoepboht thanaoepboth thanaoepbhot thanaoepbhto thanaoepbtho thanaoepbtoh thanaoeptobh thanaoeptohb thanaoeptboh
thanaoeptbho thanaoepthbo thanaoepthob thanaoehpobt thanaoehpotb thanaoehpbot thanaoehpbto thanaoehptbo thanaoehptob
thanaoehopbt thanaoehoptb thanaoehobpt thanaoehobtp thanaoehotbp thanaoehotpb thanaoehbopt thanaoehbotp thanaoehbpot
thanaoehbpto thanaoehbtpo thanaoehbtop thanaoehtobp thanaoehtopb thanaoehtbop thanaoehtbpo thanaoehtpbo thanaoehtpob
thanaoeohpbt thanaoeohptb thanaoeohbpt thanaoeohbtp thanaoeohtbp thanaoeohtpb thanaoeophbt thanaoeophtb thanaoeopbht
thanaoeopbth thanaoeoptbh thanaoeopthb thanaoeobpht thanaoeobpth thanaoeobhpt thanaoeobhtp thanaoeobthp thanaoeobtph
thanaoeotpbh thanaoeotphb thanaoeotbph thanaoeotbhp thanaoeothbp thanaoeothpb thanaoebhopt thanaoebhotp thanaoebhpot
thanaoebhpto thanaoebhtpo thanaoebhtop thanaoebohpt thanaoebohtp thanaoebopht thanaoebopth thanaoebotph thanaoebothp
thanaoebpoht thanaoebpoth thanaoebphot thanaoebphto thanaoebptho thanaoebptoh thanaoebtoph thanaoebtohp thanaoebtpoh
thanaoebtpho thanaoebthpo thanaoebthop thanaoethobp thanaoethopb thanaoethbop thanaoethbpo thanaoethpbo thanaoethpob
thanaoetohbp thanaoetohpb thanaoetobhp thanaoetobph thanaoetopbh thanaoetophb thanaoetbohp thanaoetboph thanaoetbhop
thanaoetbhpo thanaoetbpho thanaoetbpoh thanaoetpobh thanaoetpohb thanaoetpboh thanaoetpbho thanaoetphbo thanaoetphob
thanapothobe thanapothoeb thanapothboe thanapothbeo thanapothebo thanapotheob thanapotohbe thanapotoheb thanapotobhe
thanapotobeh thanapotoebh thanapotoehb thanapotbohe thanapotboeh thanapotbhoe thanapotbheo thanapotbeho thanapotbeoh
thanapoteobh thanapoteohb thanapoteboh thanapotebho thanapotehbo thanapotehob thanapohtobe thanapohtoeb thanapohtboe
thanapohtbeo thanapohtebo thanapohteob thanapohotbe thanapohoteb thanapohobte thanapohobet thanapohoebt thanapohoetb
thanapohbote thanapohboet thanapohbtoe thanapohbteo thanapohbeto thanapohbeot thanapoheobt thanapoheotb thanapohebot
thanapohebto thanapohetbo thanapohetob thanapoohtbe thanapoohteb thanapoohbte thanapoohbet thanapoohebt thanapoohetb
thanapoothbe thanapootheb thanapootbhe thanapootbeh thanapootebh thanapootehb thanapoobthe thanapoobteh thanapoobhte
thanapoobhet thanapoobeht thanapoobeth thanapooetbh thanapooethb thanapooebth thanapooebht thanapooehbt thanapooehtb
thanapobhote thanapobhoet thanapobhtoe thanapobhteo thanapobheto thanapobheot thanapobohte thanapobohet thanapobothe
thanapoboteh thanapoboeth thanapoboeht thanapobtohe thanapobtoeh thanapobthoe thanapobtheo thanapobteho thanapobteoh
thanapobeoth thanapobeoht thanapobetoh thanapobetho thanapobehto thanapobehot thanapoehobt thanapoehotb thanapoehbot
thanapoehbto thanapoehtbo thanapoehtob thanapoeohbt thanapoeohtb thanapoeobht thanapoeobth thanapoeotbh thanapoeothb
thanapoeboht thanapoeboth thanapoebhot thanapoebhto thanapoebtho thanapoebtoh thanapoetobh thanapoetohb thanapoetboh
thanapoetbho thanapoethbo thanapoethob thanaptohobe thanaptohoeb thanaptohboe thanaptohbeo thanaptohebo thanaptoheob
thanaptoohbe thanaptooheb thanaptoobhe thanaptoobeh thanaptooebh thanaptooehb thanaptobohe thanaptoboeh thanaptobhoe
thanaptobheo thanaptobeho thanaptobeoh thanaptoeobh thanaptoeohb thanaptoeboh thanaptoebho thanaptoehbo thanaptoehob
thanapthoobe thanapthooeb thanapthoboe thanapthobeo thanapthoebo thanapthoeob thanapthoobe thanapthooeb thanapthoboe
thanapthobeo thanapthoebo thanapthoeob thanapthbooe thanapthboeo thanapthbooe thanapthboeo thanapthbeoo thanapthbeoo
thanaptheobo thanaptheoob thanaptheboo thanaptheboo thanaptheobo thanaptheoob thanaptohobe thanaptohoeb thanaptohboe
thanaptohbeo thanaptohebo thanaptoheob thanaptoohbe thanaptooheb thanaptoobhe thanaptoobeh thanaptooebh thanaptooehb
thanaptobohe thanaptoboeh thanaptobhoe thanaptobheo thanaptobeho thanaptobeoh thanaptoeobh thanaptoeohb thanaptoeboh
thanaptoebho thanaptoehbo thanaptoehob thanaptbhooe thanaptbhoeo thanaptbhooe thanaptbhoeo thanaptbheoo thanaptbheoo
thanaptbohoe thanaptboheo thanaptboohe thanaptbooeh thanaptboeoh thanaptboeho thanaptboohe thanaptbooeh thanaptbohoe
thanaptboheo thanaptboeho thanaptboeoh thanaptbeooh thanaptbeoho thanaptbeooh thanaptbeoho thanaptbehoo thanaptbehoo
thanaptehobo thanaptehoob thanaptehboo thanaptehboo thanaptehobo thanaptehoob thanapteohbo thanapteohob thanapteobho
thanapteoboh thanapteoobh thanapteoohb thanapteboho thanaptebooh thanaptebhoo thanaptebhoo thanapteboho thanaptebooh
thanapteoobh thanapteoohb thanapteoboh thanapteobho thanapteohbo thanapteohob thanaphtoobe thanaphtooeb thanaphtoboe
thanaphtobeo thanaphtoebo thanaphtoeob thanaphtoobe thanaphtooeb thanaphtoboe thanaphtobeo thanaphtoebo thanaphtoeob
thanaphtbooe thanaphtboeo thanaphtbooe thanaphtboeo thanaphtbeoo thanaphtbeoo thanaphteobo thanaphteoob thanaphteboo
thanaphteboo thanaphteobo thanaphteoob thanaphotobe thanaphotoeb thanaphotboe thanaphotbeo thanaphotebo thanaphoteob
thanaphootbe thanaphooteb thanaphoobte thanaphoobet thanaphooebt thanaphooetb thanaphobote thanaphoboet thanaphobtoe
thanaphobteo thanaphobeto thanaphobeot thanaphoeobt thanaphoeotb thanaphoebot thanaphoebto thanaphoetbo thanaphoetob
thanaphootbe thanaphooteb thanaphoobte thanaphoobet thanaphooebt thanaphooetb thanaphotobe thanaphotoeb thanaphotboe
thanaphotbeo thanaphotebo thanaphoteob thanaphobtoe thanaphobteo thanaphobote thanaphoboet thanaphobeot thanaphobeto
thanaphoetbo thanaphoetob thanaphoebto thanaphoebot thanaphoeobt thanaphoeotb thanaphboote thanaphbooet thanaphbotoe
thanaphboteo thanaphboeto thanaphboeot thanaphboote thanaphbooet thanaphbotoe thanaphboteo thanaphboeto thanaphboeot
thanaphbtooe thanaphbtoeo thanaphbtooe thanaphbtoeo thanaphbteoo thanaphbteoo thanaphbeoto thanaphbeoot thanaphbetoo
thanaphbetoo thanaphbeoto thanaphbeoot thanapheoobt thanapheootb thanapheobot thanapheobto thanapheotbo thanapheotob
thanapheoobt thanapheootb thanapheobot thanapheobto thanapheotbo thanapheotob thanapheboot thanapheboto thanapheboot
thanapheboto thanaphebtoo thanaphebtoo thanaphetobo thanaphetoob thanaphetboo thanaphetboo thanaphetobo thanaphetoob
thanapothobe thanapothoeb thanapothboe thanapothbeo thanapothebo thanapotheob thanapotohbe thanapotoheb thanapotobhe
thanapotobeh thanapotoebh thanapotoehb thanapotbohe thanapotboeh thanapotbhoe thanapotbheo thanapotbeho thanapotbeoh
thanapoteobh thanapoteohb thanapoteboh thanapotebho thanapotehbo thanapotehob thanapohtobe thanapohtoeb thanapohtboe
thanapohtbeo thanapohtebo thanapohteob thanapohotbe thanapohoteb thanapohobte thanapohobet thanapohoebt thanapohoetb
thanapohbote thanapohboet thanapohbtoe thanapohbteo thanapohbeto thanapohbeot thanapoheobt thanapoheotb thanapohebot
thanapohebto thanapohetbo thanapohetob thanapoohtbe thanapoohteb thanapoohbte thanapoohbet thanapoohebt thanapoohetb
thanapoothbe thanapootheb thanapootbhe thanapootbeh thanapootebh thanapootehb thanapoobthe thanapoobteh thanapoobhte
thanapoobhet thanapoobeht thanapoobeth thanapooetbh thanapooethb thanapooebth thanapooebht thanapooehbt thanapooehtb
thanapobhote thanapobhoet thanapobhtoe thanapobhteo thanapobheto thanapobheot thanapobohte thanapobohet thanapobothe
thanapoboteh thanapoboeth thanapoboeht thanapobtohe thanapobtoeh thanapobthoe thanapobtheo thanapobteho thanapobteoh
thanapobeoth thanapobeoht thanapobetoh thanapobetho thanapobehto thanapobehot thanapoehobt thanapoehotb thanapoehbot
thanapoehbto thanapoehtbo thanapoehtob thanapoeohbt thanapoeohtb thanapoeobht thanapoeobth thanapoeotbh thanapoeothb
thanapoeboht thanapoeboth thanapoebhot thanapoebhto thanapoebtho thanapoebtoh thanapoetobh thanapoetohb thanapoetboh
thanapoetbho thanapoethbo thanapoethob thanapbthooe thanapbthoeo thanapbthooe thanapbthoeo thanapbtheoo thanapbtheoo
thanapbtohoe thanapbtoheo thanapbtoohe thanapbtooeh thanapbtoeoh thanapbtoeho thanapbtoohe thanapbtooeh thanapbtohoe
thanapbtoheo thanapbtoeho thanapbtoeoh thanapbteooh thanapbteoho thanapbteooh thanapbteoho thanapbtehoo thanapbtehoo
thanapbhtooe thanapbhtoeo thanapbhtooe thanapbhtoeo thanapbhteoo thanapbhteoo thanapbhotoe thanapbhoteo thanapbhoote
thanapbhooet thanapbhoeot thanapbhoeto thanapbhoote thanapbhooet thanapbhotoe thanapbhoteo thanapbhoeto thanapbhoeot
thanapbheoot thanapbheoto thanapbheoot thanapbheoto thanapbhetoo thanapbhetoo thanapbohtoe thanapbohteo thanapbohote
thanapbohoet thanapboheot thanapboheto thanapbothoe thanapbotheo thanapbotohe thanapbotoeh thanapboteoh thanapboteho
thanapboothe thanapbooteh thanapboohte thanapboohet thanapbooeht thanapbooeth thanapboetoh thanapboetho thanapboeoth
thanapboeoht thanapboehot thanapboehto thanapbohote thanapbohoet thanapbohtoe thanapbohteo thanapboheto thanapboheot
thanapboohte thanapboohet thanapboothe thanapbooteh thanapbooeth thanapbooeht thanapbotohe thanapbotoeh thanapbothoe
thanapbotheo thanapboteho thanapboteoh thanapboeoth thanapboeoht thanapboetoh thanapboetho thanapboehto thanapboehot
thanapbehoot thanapbehoto thanapbehoot thanapbehoto thanapbehtoo thanapbehtoo thanapbeohot thanapbeohto thanapbeooht
thanapbeooth thanapbeotoh thanapbeotho thanapbeooht thanapbeooth thanapbeohot thanapbeohto thanapbeotho thanapbeotoh
thanapbetooh thanapbetoho thanapbetooh thanapbetoho thanapbethoo thanapbethoo thanapethobo thanapethoob thanapethboo
thanapethboo thanapethobo thanapethoob thanapetohbo thanapetohob thanapetobho thanapetoboh thanapetoobh thanapetoohb
thanapetboho thanapetbooh thanapetbhoo thanapetbhoo thanapetboho thanapetbooh thanapetoobh thanapetoohb thanapetoboh
thanapetobho thanapetohbo thanapetohob thanapehtobo thanapehtoob thanapehtboo thanapehtboo thanapehtobo thanapehtoob
thanapehotbo thanapehotob thanapehobto thanapehobot thanapehoobt thanapehootb thanapehboto thanapehboot thanapehbtoo
thanapehbtoo thanapehboto thanapehboot thanapehoobt thanapehootb thanapehobot thanapehobto thanapehotbo thanapehotob
thanapeohtbo thanapeohtob thanapeohbto thanapeohbot thanapeohobt thanapeohotb thanapeothbo thanapeothob thanapeotbho
thanapeotboh thanapeotobh thanapeotohb thanapeobtho thanapeobtoh thanapeobhto thanapeobhot thanapeoboht thanapeoboth
thanapeootbh thanapeoothb thanapeoobth thanapeoobht thanapeoohbt thanapeoohtb thanapebhoto thanapebhoot thanapebhtoo
thanapebhtoo thanapebhoto thanapebhoot thanapebohto thanapebohot thanapebotho thanapebotoh thanapebooth thanapebooht
thanapebtoho thanapebtooh thanapebthoo thanapebthoo thanapebtoho thanapebtooh thanapebooth thanapebooht thanapebotoh
thanapebotho thanapebohto thanapebohot thanapeohobt thanapeohotb thanapeohbot thanapeohbto thanapeohtbo thanapeohtob
thanapeoohbt thanapeoohtb thanapeoobht thanapeoobth thanapeootbh thanapeoothb thanapeoboht thanapeoboth thanapeobhot
thanapeobhto thanapeobtho thanapeobtoh thanapeotobh thanapeotohb thanapeotboh thanapeotbho thanapeothbo thanapeothob
thanahoptobe thanahoptoeb thanahoptboe thanahoptbeo thanahoptebo thanahopteob thanahopotbe thanahopoteb thanahopobte
thanahopobet thanahopoebt thanahopoetb thanahopbote thanahopboet thanahopbtoe thanahopbteo thanahopbeto thanahopbeot
thanahopeobt thanahopeotb thanahopebot thanahopebto thanahopetbo thanahopetob thanahotpobe thanahotpoeb thanahotpboe
thanahotpbeo thanahotpebo thanahotpeob thanahotopbe thanahotopeb thanahotobpe thanahotobep thanahotoebp thanahotoepb
thanahotbope thanahotboep thanahotbpoe thanahotbpeo thanahotbepo thanahotbeop thanahoteobp thanahoteopb thanahotebop
thanahotebpo thanahotepbo thanahotepob thanahootpbe thanahootpeb thanahootbpe thanahootbep thanahootebp thanahootepb
thanahooptbe thanahoopteb thanahoopbte thanahoopbet thanahoopebt thanahoopetb thanahoobpte thanahoobpet thanahoobtpe
thanahoobtep thanahoobetp thanahoobept thanahooepbt thanahooeptb thanahooebpt thanahooebtp thanahooetbp thanahooetpb
thanahobtope thanahobtoep thanahobtpoe thanahobtpeo thanahobtepo thanahobteop thanahobotpe thanahobotep thanahobopte
thanahobopet thanahoboept thanahoboetp thanahobpote thanahobpoet thanahobptoe thanahobpteo thanahobpeto thanahobpeot
thanahobeopt thanahobeotp thanahobepot thanahobepto thanahobetpo thanahobetop thanahoetobp thanahoetopb thanahoetbop
thanahoetbpo thanahoetpbo thanahoetpob thanahoeotbp thanahoeotpb thanahoeobtp thanahoeobpt thanahoeopbt thanahoeoptb
thanahoebotp thanahoebopt thanahoebtop thanahoebtpo thanahoebpto thanahoebpot thanahoepobt thanahoepotb thanahoepbot
thanahoepbto thanahoeptbo thanahoeptob thanahpotobe thanahpotoeb thanahpotboe thanahpotbeo thanahpotebo thanahpoteob
thanahpootbe thanahpooteb thanahpoobte thanahpoobet thanahpooebt thanahpooetb thanahpobote thanahpoboet thanahpobtoe
thanahpobteo thanahpobeto thanahpobeot thanahpoeobt thanahpoeotb thanahpoebot thanahpoebto thanahpoetbo thanahpoetob
thanahptoobe thanahptooeb thanahptoboe thanahptobeo thanahptoebo thanahptoeob thanahptoobe thanahptooeb thanahptoboe
thanahptobeo thanahptoebo thanahptoeob thanahptbooe thanahptboeo thanahptbooe thanahptboeo thanahptbeoo thanahptbeoo
thanahpteobo thanahpteoob thanahpteboo thanahpteboo thanahpteobo thanahpteoob thanahpotobe thanahpotoeb thanahpotboe
thanahpotbeo thanahpotebo thanahpoteob thanahpootbe thanahpooteb thanahpoobte thanahpoobet thanahpooebt thanahpooetb
thanahpobote thanahpoboet thanahpobtoe thanahpobteo thanahpobeto thanahpobeot thanahpoeobt thanahpoeotb thanahpoebot
thanahpoebto thanahpoetbo thanahpoetob thanahpbtooe thanahpbtoeo thanahpbtooe thanahpbtoeo thanahpbteoo thanahpbteoo
thanahpbotoe thanahpboteo thanahpboote thanahpbooet thanahpboeot thanahpboeto thanahpboote thanahpbooet thanahpbotoe
thanahpboteo thanahpboeto thanahpboeot thanahpbeoot thanahpbeoto thanahpbeoot thanahpbeoto thanahpbetoo thanahpbetoo
thanahpetobo thanahpetoob thanahpetboo thanahpetboo thanahpetobo thanahpetoob thanahpeotbo thanahpeotob thanahpeobto
thanahpeobot thanahpeoobt thanahpeootb thanahpeboto thanahpeboot thanahpebtoo thanahpebtoo thanahpeboto thanahpeboot
thanahpeoobt thanahpeootb thanahpeobot thanahpeobto thanahpeotbo thanahpeotob thanahtpoobe thanahtpooeb thanahtpoboe
thanahtpobeo thanahtpoebo thanahtpoeob thanahtpoobe thanahtpooeb thanahtpoboe thanahtpobeo thanahtpoebo thanahtpoeob
thanahtpbooe thanahtpboeo thanahtpbooe thanahtpboeo thanahtpbeoo thanahtpbeoo thanahtpeobo thanahtpeoob thanahtpeboo
thanahtpeboo thanahtpeobo thanahtpeoob thanahtopobe thanahtopoeb thanahtopboe thanahtopbeo thanahtopebo thanahtopeob
thanahtoopbe thanahtoopeb thanahtoobpe thanahtoobep thanahtooebp thanahtooepb thanahtobope thanahtoboep thanahtobpoe
thanahtobpeo thanahtobepo thanahtobeop thanahtoeobp thanahtoeopb thanahtoebop thanahtoebpo thanahtoepbo thanahtoepob
thanahtoopbe thanahtoopeb thanahtoobpe thanahtoobep thanahtooebp thanahtooepb thanahtopobe thanahtopoeb thanahtopboe
thanahtopbeo thanahtopebo thanahtopeob thanahtobpoe thanahtobpeo thanahtobope thanahtoboep thanahtobeop thanahtobepo
thanahtoepbo thanahtoepob thanahtoebpo thanahtoebop thanahtoeobp thanahtoeopb thanahtboope thanahtbooep thanahtbopoe
thanahtbopeo thanahtboepo thanahtboeop thanahtboope thanahtbooep thanahtbopoe thanahtbopeo thanahtboepo thanahtboeop
thanahtbpooe thanahtbpoeo thanahtbpooe thanahtbpoeo thanahtbpeoo thanahtbpeoo thanahtbeopo thanahtbeoop thanahtbepoo
thanahtbepoo thanahtbeopo thanahtbeoop thanahteoobp thanahteoopb thanahteobop thanahteobpo thanahteopbo thanahteopob
thanahteoobp thanahteoopb thanahteobop thanahteobpo thanahteopbo thanahteopob thanahteboop thanahtebopo thanahteboop
thanahtebopo thanahtebpoo thanahtebpoo thanahtepobo thanahtepoob thanahtepboo thanahtepboo thanahtepobo thanahtepoob
thanahoptobe thanahoptoeb thanahoptboe thanahoptbeo thanahoptebo thanahopteob thanahopotbe thanahopoteb thanahopobte
thanahopobet thanahopoebt thanahopoetb thanahopbote thanahopboet thanahopbtoe thanahopbteo thanahopbeto thanahopbeot
thanahopeobt thanahopeotb thanahopebot thanahopebto thanahopetbo thanahopetob thanahotpobe thanahotpoeb thanahotpboe
thanahotpbeo thanahotpebo thanahotpeob thanahotopbe thanahotopeb thanahotobpe thanahotobep thanahotoebp thanahotoepb
thanahotbope thanahotboep thanahotbpoe thanahotbpeo thanahotbepo thanahotbeop thanahoteobp thanahoteopb thanahotebop
thanahotebpo thanahotepbo thanahotepob thanahootpbe thanahootpeb thanahootbpe thanahootbep thanahootebp thanahootepb
thanahooptbe thanahoopteb thanahoopbte thanahoopbet thanahoopebt thanahoopetb thanahoobpte thanahoobpet thanahoobtpe
thanahoobtep thanahoobetp thanahoobept thanahooepbt thanahooeptb thanahooebpt thanahooebtp thanahooetbp thanahooetpb
thanahobtope thanahobtoep thanahobtpoe thanahobtpeo thanahobtepo thanahobteop thanahobotpe thanahobotep thanahobopte
thanahobopet thanahoboept thanahoboetp thanahobpote thanahobpoet thanahobptoe thanahobpteo thanahobpeto thanahobpeot
thanahobeopt thanahobeotp thanahobepot thanahobepto thanahobetpo thanahobetop thanahoetobp thanahoetopb thanahoetbop
thanahoetbpo thanahoetpbo thanahoetpob thanahoeotbp thanahoeotpb thanahoeobtp thanahoeobpt thanahoeopbt thanahoeoptb
thanahoebotp thanahoebopt thanahoebtop thanahoebtpo thanahoebpto thanahoebpot thanahoepobt thanahoepotb thanahoepbot
thanahoepbto thanahoeptbo thanahoeptob thanahbptooe thanahbptoeo thanahbptooe thanahbptoeo thanahbpteoo thanahbpteoo
thanahbpotoe thanahbpoteo thanahbpoote thanahbpooet thanahbpoeot thanahbpoeto thanahbpoote thanahbpooet thanahbpotoe
thanahbpoteo thanahbpoeto thanahbpoeot thanahbpeoot thanahbpeoto thanahbpeoot thanahbpeoto thanahbpetoo thanahbpetoo
thanahbtpooe thanahbtpoeo thanahbtpooe thanahbtpoeo thanahbtpeoo thanahbtpeoo thanahbtopoe thanahbtopeo thanahbtoope
thanahbtooep thanahbtoeop thanahbtoepo thanahbtoope thanahbtooep thanahbtopoe thanahbtopeo thanahbtoepo thanahbtoeop
thanahbteoop thanahbteopo thanahbteoop thanahbteopo thanahbtepoo thanahbtepoo thanahbotpoe thanahbotpeo thanahbotope
thanahbotoep thanahboteop thanahbotepo thanahboptoe thanahbopteo thanahbopote thanahbopoet thanahbopeot thanahbopeto
thanahboopte thanahboopet thanahbootpe thanahbootep thanahbooetp thanahbooept thanahboepot thanahboepto thanahboeopt
thanahboeotp thanahboetop thanahboetpo thanahbotope thanahbotoep thanahbotpoe thanahbotpeo thanahbotepo thanahboteop
thanahbootpe thanahbootep thanahboopte thanahboopet thanahbooept thanahbooetp thanahbopote thanahbopoet thanahboptoe
thanahbopteo thanahbopeto thanahbopeot thanahboeopt thanahboeotp thanahboepot thanahboepto thanahboetpo thanahboetop
thanahbetoop thanahbetopo thanahbetoop thanahbetopo thanahbetpoo thanahbetpoo thanahbeotop thanahbeotpo thanahbeootp
thanahbeoopt thanahbeopot thanahbeopto thanahbeootp thanahbeoopt thanahbeotop thanahbeotpo thanahbeopto thanahbeopot
thanahbepoot thanahbepoto thanahbepoot thanahbepoto thanahbeptoo thanahbeptoo thanaheptobo thanaheptoob thanaheptboo
thanaheptboo thanaheptobo thanaheptoob thanahepotbo thanahepotob thanahepobto thanahepobot thanahepoobt thanahepootb
thanahepboto thanahepboot thanahepbtoo thanahepbtoo thanahepboto thanahepboot thanahepoobt thanahepootb thanahepobot
thanahepobto thanahepotbo thanahepotob thanahetpobo thanahetpoob thanahetpboo thanahetpboo thanahetpobo thanahetpoob
thanahetopbo thanahetopob thanahetobpo thanahetobop thanahetoobp thanahetoopb thanahetbopo thanahetboop thanahetbpoo
thanahetbpoo thanahetbopo thanahetboop thanahetoobp thanahetoopb thanahetobop thanahetobpo thanahetopbo thanahetopob
thanaheotpbo thanaheotpob thanaheotbpo thanaheotbop thanaheotobp thanaheotopb thanaheoptbo thanaheoptob thanaheopbto
thanaheopbot thanaheopobt thanaheopotb thanaheobpto thanaheobpot thanaheobtpo thanaheobtop thanaheobotp thanaheobopt
thanaheoopbt thanaheooptb thanaheoobpt thanaheoobtp thanaheootbp thanaheootpb thanahebtopo thanahebtoop thanahebtpoo
thanahebtpoo thanahebtopo thanahebtoop thanahebotpo thanahebotop thanahebopto thanahebopot thanaheboopt thanahebootp
thanahebpoto thanahebpoot thanahebptoo thanahebptoo thanahebpoto thanahebpoot thanaheboopt thanahebootp thanahebopot
thanahebopto thanahebotpo thanahebotop thanaheotobp thanaheotopb thanaheotbop thanaheotbpo thanaheotpbo thanaheotpob
thanaheootbp thanaheootpb thanaheoobtp thanaheoobpt thanaheoopbt thanaheooptb thanaheobotp thanaheobopt thanaheobtop
thanaheobtpo thanaheobpto thanaheobpot thanaheopobt thanaheopotb thanaheopbot thanaheopbto thanaheoptbo thanaheoptob
thanaoophtbe thanaoophteb thanaoophbte thanaoophbet thanaoophebt thanaoophetb thanaoopthbe thanaooptheb thanaooptbhe
thanaooptbeh thanaooptebh thanaooptehb thanaoopbthe thanaoopbteh thanaoopbhte thanaoopbhet thanaoopbeht thanaoopbeth
thanaoopetbh thanaoopethb thanaoopebth thanaoopebht thanaoopehbt thanaoopehtb thanaoohptbe thanaoohpteb thanaoohpbte
thanaoohpbet thanaoohpebt thanaoohpetb thanaoohtpbe thanaoohtpeb thanaoohtbpe thanaoohtbep thanaoohtebp thanaoohtepb
thanaoohbtpe thanaoohbtep thanaoohbpte thanaoohbpet thanaoohbept thanaoohbetp thanaoohetbp thanaoohetpb thanaoohebtp
thanaoohebpt thanaoohepbt thanaooheptb thanaoothpbe thanaoothpeb thanaoothbpe thanaoothbep thanaoothebp thanaoothepb
thanaootphbe thanaootpheb thanaootpbhe thanaootpbeh thanaootpebh thanaootpehb thanaootbphe thanaootbpeh thanaootbhpe
thanaootbhep thanaootbehp thanaootbeph thanaootepbh thanaootephb thanaootebph thanaootebhp thanaootehbp thanaootehpb
thanaoobhtpe thanaoobhtep thanaoobhpte thanaoobhpet thanaoobhept thanaoobhetp thanaoobthpe thanaoobthep thanaoobtphe
thanaoobtpeh thanaoobteph thanaoobtehp thanaoobpthe thanaoobpteh thanaoobphte thanaoobphet thanaoobpeht thanaoobpeth
thanaoobetph thanaoobethp thanaoobepth thanaoobepht thanaoobehpt thanaoobehtp thanaooehtbp thanaooehtpb thanaooehbtp
thanaooehbpt thanaooehpbt thanaooehptb thanaooethbp thanaooethpb thanaooetbhp thanaooetbph thanaooetpbh thanaooetphb
thanaooebthp thanaooebtph thanaooebhtp thanaooebhpt thanaooebpht thanaooebpth thanaooeptbh thanaooepthb thanaooepbth
thanaooepbht thanaooephbt thanaooephtb thanaopohtbe thanaopohteb thanaopohbte thanaopohbet thanaopohebt thanaopohetb
thanaopothbe thanaopotheb thanaopotbhe thanaopotbeh thanaopotebh thanaopotehb thanaopobthe thanaopobteh thanaopobhte
thanaopobhet thanaopobeht thanaopobeth thanaopoetbh thanaopoethb thanaopoebth thanaopoebht thanaopoehbt thanaopoehtb
thanaophotbe thanaophoteb thanaophobte thanaophobet thanaophoebt thanaophoetb thanaophtobe thanaophtoeb thanaophtboe
thanaophtbeo thanaophtebo thanaophteob thanaophbtoe thanaophbteo thanaophbote thanaophboet thanaophbeot thanaophbeto
thanaophetbo thanaophetob thanaophebto thanaophebot thanaopheobt thanaopheotb thanaopthobe thanaopthoeb thanaopthboe
thanaopthbeo thanaopthebo thanaoptheob thanaoptohbe thanaoptoheb thanaoptobhe thanaoptobeh thanaoptoebh thanaoptoehb
thanaoptbohe thanaoptboeh thanaoptbhoe thanaoptbheo thanaoptbeho thanaoptbeoh thanaopteobh thanaopteohb thanaopteboh
thanaoptebho thanaoptehbo thanaoptehob thanaopbhtoe thanaopbhteo thanaopbhote thanaopbhoet thanaopbheot thanaopbheto
thanaopbthoe thanaopbtheo thanaopbtohe thanaopbtoeh thanaopbteoh thanaopbteho thanaopbothe thanaopboteh thanaopbohte
thanaopbohet thanaopboeht thanaopboeth thanaopbetoh thanaopbetho thanaopbeoth thanaopbeoht thanaopbehot thanaopbehto
thanaopehtbo thanaopehtob thanaopehbto thanaopehbot thanaopehobt thanaopehotb thanaopethbo thanaopethob thanaopetbho
thanaopetboh thanaopetobh thanaopetohb thanaopebtho thanaopebtoh thanaopebhto thanaopebhot thanaopeboht thanaopeboth
thanaopeotbh thanaopeothb thanaopeobth thanaopeobht thanaopeohbt thanaopeohtb thanaohpotbe thanaohpoteb thanaohpobte
thanaohpobet thanaohpoebt thanaohpoetb thanaohptobe thanaohptoeb thanaohptboe thanaohptbeo thanaohptebo thanaohpteob
thanaohpbtoe thanaohpbteo thanaohpbote thanaohpboet thanaohpbeot thanaohpbeto thanaohpetbo thanaohpetob thanaohpebto
thanaohpebot thanaohpeobt thanaohpeotb thanaohoptbe thanaohopteb thanaohopbte thanaohopbet thanaohopebt thanaohopetb
thanaohotpbe thanaohotpeb thanaohotbpe thanaohotbep thanaohotebp thanaohotepb thanaohobtpe thanaohobtep thanaohobpte
thanaohobpet thanaohobept thanaohobetp thanaohoetbp thanaohoetpb thanaohoebtp thanaohoebpt thanaohoepbt thanaohoeptb
thanaohtopbe thanaohtopeb thanaohtobpe thanaohtobep thanaohtoebp thanaohtoepb thanaohtpobe thanaohtpoeb thanaohtpboe
thanaohtpbeo thanaohtpebo thanaohtpeob thanaohtbpoe thanaohtbpeo thanaohtbope thanaohtboep thanaohtbeop thanaohtbepo
thanaohtepbo thanaohtepob thanaohtebpo thanaohtebop thanaohteobp thanaohteopb thanaohbotpe thanaohbotep thanaohbopte
thanaohbopet thanaohboept thanaohboetp thanaohbtope thanaohbtoep thanaohbtpoe thanaohbtpeo thanaohbtepo thanaohbteop
thanaohbptoe thanaohbpteo thanaohbpote thanaohbpoet thanaohbpeot thanaohbpeto thanaohbetpo thanaohbetop thanaohbepto
thanaohbepot thanaohbeopt thanaohbeotp thanaoheotbp thanaoheotpb thanaoheobtp thanaoheobpt thanaoheopbt thanaoheoptb
thanaohetobp thanaohetopb thanaohetbop thanaohetbpo thanaohetpbo thanaohetpob thanaohebtop thanaohebtpo thanaohebotp
thanaohebopt thanaohebpot thanaohebpto thanaoheptbo thanaoheptob thanaohepbto thanaohepbot thanaohepobt thanaohepotb
thanaotphobe thanaotphoeb thanaotphboe thanaotphbeo thanaotphebo thanaotpheob thanaotpohbe thanaotpoheb thanaotpobhe
thanaotpobeh thanaotpoebh thanaotpoehb thanaotpbohe thanaotpboeh thanaotpbhoe thanaotpbheo thanaotpbeho thanaotpbeoh
thanaotpeobh thanaotpeohb thanaotpeboh thanaotpebho thanaotpehbo thanaotpehob thanaothpobe thanaothpoeb thanaothpboe
thanaothpbeo thanaothpebo thanaothpeob thanaothopbe thanaothopeb thanaothobpe thanaothobep thanaothoebp thanaothoepb
thanaothbope thanaothboep thanaothbpoe thanaothbpeo thanaothbepo thanaothbeop thanaotheobp thanaotheopb thanaothebop
thanaothebpo thanaothepbo thanaothepob thanaotohpbe thanaotohpeb thanaotohbpe thanaotohbep thanaotohebp thanaotohepb
thanaotophbe thanaotopheb thanaotopbhe thanaotopbeh thanaotopebh thanaotopehb thanaotobphe thanaotobpeh thanaotobhpe
thanaotobhep thanaotobehp thanaotobeph thanaotoepbh thanaotoephb thanaotoebph thanaotoebhp thanaotoehbp thanaotoehpb
thanaotbhope thanaotbhoep thanaotbhpoe thanaotbhpeo thanaotbhepo thanaotbheop thanaotbohpe thanaotbohep thanaotbophe
thanaotbopeh thanaotboeph thanaotboehp thanaotbpohe thanaotbpoeh thanaotbphoe thanaotbpheo thanaotbpeho thanaotbpeoh
thanaotbeoph thanaotbeohp thanaotbepoh thanaotbepho thanaotbehpo thanaotbehop thanaotehobp thanaotehopb thanaotehbop
thanaotehbpo thanaotehpbo thanaotehpob thanaoteohbp thanaoteohpb thanaoteobhp thanaoteobph thanaoteopbh thanaoteophb
thanaotebohp thanaoteboph thanaotebhop thanaotebhpo thanaotebpho thanaotebpoh thanaotepobh thanaotepohb thanaotepboh
thanaotepbho thanaotephbo thanaotephob thanaobphtoe thanaobphteo thanaobphote thanaobphoet thanaobpheot thanaobpheto
thanaobpthoe thanaobptheo thanaobptohe thanaobptoeh thanaobpteoh thanaobpteho thanaobpothe thanaobpoteh thanaobpohte
thanaobpohet thanaobpoeht thanaobpoeth thanaobpetoh thanaobpetho thanaobpeoth thanaobpeoht thanaobpehot thanaobpehto
thanaobhptoe thanaobhpteo thanaobhpote thanaobhpoet thanaobhpeot thanaobhpeto thanaobhtpoe thanaobhtpeo thanaobhtope
thanaobhtoep thanaobhteop thanaobhtepo thanaobhotpe thanaobhotep thanaobhopte thanaobhopet thanaobhoept thanaobhoetp
thanaobhetop thanaobhetpo thanaobheotp thanaobheopt thanaobhepot thanaobhepto thanaobthpoe thanaobthpeo thanaobthope
thanaobthoep thanaobtheop thanaobthepo thanaobtphoe thanaobtpheo thanaobtpohe thanaobtpoeh thanaobtpeoh thanaobtpeho
thanaobtophe thanaobtopeh thanaobtohpe thanaobtohep thanaobtoehp thanaobtoeph thanaobtepoh thanaobtepho thanaobteoph
thanaobteohp thanaobtehop thanaobtehpo thanaobohtpe thanaobohtep thanaobohpte thanaobohpet thanaobohept thanaobohetp
thanaobothpe thanaobothep thanaobotphe thanaobotpeh thanaoboteph thanaobotehp thanaobopthe thanaobopteh thanaobophte
thanaobophet thanaobopeht thanaobopeth thanaoboetph thanaoboethp thanaoboepth thanaoboepht thanaoboehpt thanaoboehtp
thanaobehtop thanaobehtpo thanaobehotp thanaobehopt thanaobehpot thanaobehpto thanaobethop thanaobethpo thanaobetohp
thanaobetoph thanaobetpoh thanaobetpho thanaobeothp thanaobeotph thanaobeohtp thanaobeohpt thanaobeopht thanaobeopth
thanaobeptoh thanaobeptho thanaobepoth thanaobepoht thanaobephot thanaobephto thanaoephtbo thanaoephtob thanaoephbto
thanaoephbot thanaoephobt thanaoephotb thanaoepthbo thanaoepthob thanaoeptbho thanaoeptboh thanaoeptobh thanaoeptohb
thanaoepbtho thanaoepbtoh thanaoepbhto thanaoepbhot thanaoepboht thanaoepboth thanaoepotbh thanaoepothb thanaoepobth
thanaoepobht thanaoepohbt thanaoepohtb thanaoehptbo thanaoehptob thanaoehpbto thanaoehpbot thanaoehpobt thanaoehpotb
thanaoehtpbo thanaoehtpob thanaoehtbpo thanaoehtbop thanaoehtobp thanaoehtopb thanaoehbtpo thanaoehbtop thanaoehbpto
thanaoehbpot thanaoehbopt thanaoehbotp thanaoehotbp thanaoehotpb thanaoehobtp thanaoehobpt thanaoehopbt thanaoehoptb
thanaoethpbo thanaoethpob thanaoethbpo thanaoethbop thanaoethobp thanaoethopb thanaoetphbo thanaoetphob thanaoetpbho
thanaoetpboh thanaoetpobh thanaoetpohb thanaoetbpho thanaoetbpoh thanaoetbhpo thanaoetbhop thanaoetbohp thanaoetboph
thanaoetopbh thanaoetophb thanaoetobph thanaoetobhp thanaoetohbp thanaoetohpb thanaoebhtpo thanaoebhtop thanaoebhpto
thanaoebhpot thanaoebhopt thanaoebhotp thanaoebthpo thanaoebthop thanaoebtpho thanaoebtpoh thanaoebtoph thanaoebtohp
thanaoebptho thanaoebptoh thanaoebphto thanaoebphot thanaoebpoht thanaoebpoth thanaoebotph thanaoebothp thanaoebopth
thanaoebopht thanaoebohpt thanaoebohtp thanaoeohtbp thanaoeohtpb thanaoeohbtp thanaoeohbpt thanaoeohpbt thanaoeohptb
thanaoeothbp thanaoeothpb thanaoeotbhp thanaoeotbph thanaoeotpbh thanaoeotphb thanaoeobthp thanaoeobtph thanaoeobhtp
thanaoeobhpt thanaoeobpht thanaoeobpth thanaoeoptbh thanaoeopthb thanaoeopbth thanaoeopbht thanaoeophbt thanaoeophtb
thanabophote thanabophoet thanabophtoe thanabophteo thanabopheto thanabopheot thanabopohte thanabopohet thanabopothe
thanabopoteh thanabopoeth thanabopoeht thanaboptohe thanaboptoeh thanabopthoe thanaboptheo thanabopteho thanabopteoh
thanabopeoth thanabopeoht thanabopetoh thanabopetho thanabopehto thanabopehot thanabohpote thanabohpoet thanabohptoe
thanabohpteo thanabohpeto thanabohpeot thanabohopte thanabohopet thanabohotpe thanabohotep thanabohoetp thanabohoept
thanabohtope thanabohtoep thanabohtpoe thanabohtpeo thanabohtepo thanabohteop thanaboheotp thanaboheopt thanabohetop
thanabohetpo thanabohepto thanabohepot thanaboohpte thanaboohpet thanaboohtpe thanaboohtep thanaboohetp thanaboohept
thanaboophte thanaboophet thanaboopthe thanaboopteh thanaboopeth thanaboopeht thanabootphe thanabootpeh thanaboothpe
thanaboothep thanabootehp thanabooteph thanabooepth thanabooepht thanabooetph thanabooethp thanabooehtp thanabooehpt
thanabothope thanabothoep thanabothpoe thanabothpeo thanabothepo thanabotheop thanabotohpe thanabotohep thanabotophe
thanabotopeh thanabotoeph thanabotoehp thanabotpohe thanabotpoeh thanabotphoe thanabotpheo thanabotpeho thanabotpeoh
thanaboteoph thanaboteohp thanabotepoh thanabotepho thanabotehpo thanabotehop thanaboehotp thanaboehopt thanaboehtop
thanaboehtpo thanaboehpto thanaboehpot thanaboeohtp thanaboeohpt thanaboeothp thanaboeotph thanaboeopth thanaboeopht
thanaboetohp thanaboetoph thanaboethop thanaboethpo thanaboetpho thanaboetpoh thanaboepoth thanaboepoht thanaboeptoh
thanaboeptho thanaboephto thanaboephot thanabpohote thanabpohoet thanabpohtoe thanabpohteo thanabpoheto thanabpoheot
thanabpoohte thanabpoohet thanabpoothe thanabpooteh thanabpooeth thanabpooeht thanabpotohe thanabpotoeh thanabpothoe
thanabpotheo thanabpoteho thanabpoteoh thanabpoeoth thanabpoeoht thanabpoetoh thanabpoetho thanabpoehto thanabpoehot
thanabphoote thanabphooet thanabphotoe thanabphoteo thanabphoeto thanabphoeot thanabphoote thanabphooet thanabphotoe
thanabphoteo thanabphoeto thanabphoeot thanabphtooe thanabphtoeo thanabphtooe thanabphtoeo thanabphteoo thanabphteoo
thanabpheoto thanabpheoot thanabphetoo thanabphetoo thanabpheoto thanabpheoot thanabpohote thanabpohoet thanabpohtoe
thanabpohteo thanabpoheto thanabpoheot thanabpoohte thanabpoohet thanabpoothe thanabpooteh thanabpooeth thanabpooeht
thanabpotohe thanabpotoeh thanabpothoe thanabpotheo thanabpoteho thanabpoteoh thanabpoeoth thanabpoeoht thanabpoetoh
thanabpoetho thanabpoehto thanabpoehot thanabpthooe thanabpthoeo thanabpthooe thanabpthoeo thanabptheoo thanabptheoo
thanabptohoe thanabptoheo thanabptoohe thanabptooeh thanabptoeoh thanabptoeho thanabptoohe thanabptooeh thanabptohoe
thanabptoheo thanabptoeho thanabptoeoh thanabpteooh thanabpteoho thanabpteooh thanabpteoho thanabptehoo thanabptehoo
thanabpehoto thanabpehoot thanabpehtoo thanabpehtoo thanabpehoto thanabpehoot thanabpeohto thanabpeohot thanabpeotho
thanabpeotoh thanabpeooth thanabpeooht thanabpetoho thanabpetooh thanabpethoo thanabpethoo thanabpetoho thanabpetooh
thanabpeooth thanabpeooht thanabpeotoh thanabpeotho thanabpeohto thanabpeohot thanabhpoote thanabhpooet thanabhpotoe
thanabhpoteo thanabhpoeto thanabhpoeot thanabhpoote thanabhpooet thanabhpotoe thanabhpoteo thanabhpoeto thanabhpoeot
thanabhptooe thanabhptoeo thanabhptooe thanabhptoeo thanabhpteoo thanabhpteoo thanabhpeoto thanabhpeoot thanabhpetoo
thanabhpetoo thanabhpeoto thanabhpeoot thanabhopote thanabhopoet thanabhoptoe thanabhopteo thanabhopeto thanabhopeot
thanabhoopte thanabhoopet thanabhootpe thanabhootep thanabhooetp thanabhooept thanabhotope thanabhotoep thanabhotpoe
thanabhotpeo thanabhotepo thanabhoteop thanabhoeotp thanabhoeopt thanabhoetop thanabhoetpo thanabhoepto thanabhoepot
thanabhoopte thanabhoopet thanabhootpe thanabhootep thanabhooetp thanabhooept thanabhopote thanabhopoet thanabhoptoe
thanabhopteo thanabhopeto thanabhopeot thanabhotpoe thanabhotpeo thanabhotope thanabhotoep thanabhoteop thanabhotepo
thanabhoepto thanabhoepot thanabhoetpo thanabhoetop thanabhoeotp thanabhoeopt thanabhtoope thanabhtooep thanabhtopoe
thanabhtopeo thanabhtoepo thanabhtoeop thanabhtoope thanabhtooep thanabhtopoe thanabhtopeo thanabhtoepo thanabhtoeop
thanabhtpooe thanabhtpoeo thanabhtpooe thanabhtpoeo thanabhtpeoo thanabhtpeoo thanabhteopo thanabhteoop thanabhtepoo
thanabhtepoo thanabhteopo thanabhteoop thanabheootp thanabheoopt thanabheotop thanabheotpo thanabheopto thanabheopot
thanabheootp thanabheoopt thanabheotop thanabheotpo thanabheopto thanabheopot thanabhetoop thanabhetopo thanabhetoop
thanabhetopo thanabhetpoo thanabhetpoo thanabhepoto thanabhepoot thanabheptoo thanabheptoo thanabhepoto thanabhepoot
thanabophote thanabophoet thanabophtoe thanabophteo thanabopheto thanabopheot thanabopohte thanabopohet thanabopothe
thanabopoteh thanabopoeth thanabopoeht thanaboptohe thanaboptoeh thanabopthoe thanaboptheo thanabopteho thanabopteoh
thanabopeoth thanabopeoht thanabopetoh thanabopetho thanabopehto thanabopehot thanabohpote thanabohpoet thanabohptoe
thanabohpteo thanabohpeto thanabohpeot thanabohopte thanabohopet thanabohotpe thanabohotep thanabohoetp thanabohoept
thanabohtope thanabohtoep thanabohtpoe thanabohtpeo thanabohtepo thanabohteop thanaboheotp thanaboheopt thanabohetop
thanabohetpo thanabohepto thanabohepot thanaboohpte thanaboohpet thanaboohtpe thanaboohtep thanaboohetp thanaboohept
thanaboophte thanaboophet thanaboopthe thanaboopteh thanaboopeth thanaboopeht thanabootphe thanabootpeh thanaboothpe
thanaboothep thanabootehp thanabooteph thanabooepth thanabooepht thanabooetph thanabooethp thanabooehtp thanabooehpt
thanabothope thanabothoep thanabothpoe thanabothpeo thanabothepo thanabotheop thanabotohpe thanabotohep thanabotophe
thanabotopeh thanabotoeph thanabotoehp thanabotpohe thanabotpoeh thanabotphoe thanabotpheo thanabotpeho thanabotpeoh
thanaboteoph thanaboteohp thanabotepoh thanabotepho thanabotehpo thanabotehop thanaboehotp thanaboehopt thanaboehtop
thanaboehtpo thanaboehpto thanaboehpot thanaboeohtp thanaboeohpt thanaboeothp thanaboeotph thanaboeopth thanaboeopht
thanaboetohp thanaboetoph thanaboethop thanaboethpo thanaboetpho thanaboetpoh thanaboepoth thanaboepoht thanaboeptoh
thanaboeptho thanaboephto thanaboephot thanabtphooe thanabtphoeo thanabtphooe thanabtphoeo thanabtpheoo thanabtpheoo
thanabtpohoe thanabtpoheo thanabtpoohe thanabtpooeh thanabtpoeoh thanabtpoeho thanabtpoohe thanabtpooeh thanabtpohoe
thanabtpoheo thanabtpoeho thanabtpoeoh thanabtpeooh thanabtpeoho thanabtpeooh thanabtpeoho thanabtpehoo thanabtpehoo
thanabthpooe thanabthpoeo thanabthpooe thanabthpoeo thanabthpeoo thanabthpeoo thanabthopoe thanabthopeo thanabthoope
thanabthooep thanabthoeop thanabthoepo thanabthoope thanabthooep thanabthopoe thanabthopeo thanabthoepo thanabthoeop
thanabtheoop thanabtheopo thanabtheoop thanabtheopo thanabthepoo thanabthepoo thanabtohpoe thanabtohpeo thanabtohope
thanabtohoep thanabtoheop thanabtohepo thanabtophoe thanabtopheo thanabtopohe thanabtopoeh thanabtopeoh thanabtopeho
thanabtoophe thanabtoopeh thanabtoohpe thanabtoohep thanabtooehp thanabtooeph thanabtoepoh thanabtoepho thanabtoeoph
thanabtoeohp thanabtoehop thanabtoehpo thanabtohope thanabtohoep thanabtohpoe thanabtohpeo thanabtohepo thanabtoheop
thanabtoohpe thanabtoohep thanabtoophe thanabtoopeh thanabtooeph thanabtooehp thanabtopohe thanabtopoeh thanabtophoe
thanabtopheo thanabtopeho thanabtopeoh thanabtoeoph thanabtoeohp thanabtoepoh thanabtoepho thanabtoehpo thanabtoehop
thanabtehoop thanabtehopo thanabtehoop thanabtehopo thanabtehpoo thanabtehpoo thanabteohop thanabteohpo thanabteoohp
thanabteooph thanabteopoh thanabteopho thanabteoohp thanabteooph thanabteohop thanabteohpo thanabteopho thanabteopoh
thanabtepooh thanabtepoho thanabtepooh thanabtepoho thanabtephoo thanabtephoo thanabephoto thanabephoot thanabephtoo
thanabephtoo thanabephoto thanabephoot thanabepohto thanabepohot thanabepotho thanabepotoh thanabepooth thanabepooht
thanabeptoho thanabeptooh thanabepthoo thanabepthoo thanabeptoho thanabeptooh thanabepooth thanabepooht thanabepotoh
thanabepotho thanabepohto thanabepohot thanabehpoto thanabehpoot thanabehptoo thanabehptoo thanabehpoto thanabehpoot
thanabehopto thanabehopot thanabehotpo thanabehotop thanabehootp thanabehoopt thanabehtopo thanabehtoop thanabehtpoo
thanabehtpoo thanabehtopo thanabehtoop thanabehootp thanabehoopt thanabehotop thanabehotpo thanabehopto thanabehopot
thanabeohpto thanabeohpot thanabeohtpo thanabeohtop thanabeohotp thanabeohopt thanabeophto thanabeophot thanabeoptho
thanabeoptoh thanabeopoth thanabeopoht thanabeotpho thanabeotpoh thanabeothpo thanabeothop thanabeotohp thanabeotoph
thanabeoopth thanabeoopht thanabeootph thanabeoothp thanabeoohtp thanabeoohpt thanabethopo thanabethoop thanabethpoo
thanabethpoo thanabethopo thanabethoop thanabetohpo thanabetohop thanabetopho thanabetopoh thanabetooph thanabetoohp
thanabetpoho thanabetpooh thanabetphoo thanabetphoo thanabetpoho thanabetpooh thanabetooph thanabetoohp thanabetopoh
thanabetopho thanabetohpo thanabetohop thanabeohotp thanabeohopt thanabeohtop thanabeohtpo thanabeohpto thanabeohpot
thanabeoohtp thanabeoohpt thanabeoothp thanabeootph thanabeoopth thanabeoopht thanabeotohp thanabeotoph thanabeothop
thanabeothpo thanabeotpho thanabeotpoh thanabeopoth thanabeopoht thanabeoptoh thanabeoptho thanabeophto thanabeophot
thanaeophobt thanaeophotb thanaeophbot thanaeophbto thanaeophtbo thanaeophtob thanaeopohbt thanaeopohtb thanaeopobht
thanaeopobth thanaeopotbh thanaeopothb thanaeopboht thanaeopboth thanaeopbhot thanaeopbhto thanaeopbtho thanaeopbtoh
thanaeoptobh thanaeoptohb thanaeoptboh thanaeoptbho thanaeopthbo thanaeopthob thanaeohpobt thanaeohpotb thanaeohpbot
thanaeohpbto thanaeohptbo thanaeohptob thanaeohopbt thanaeohoptb thanaeohobpt thanaeohobtp thanaeohotbp thanaeohotpb
thanaeohbopt thanaeohbotp thanaeohbpot thanaeohbpto thanaeohbtpo thanaeohbtop thanaeohtobp thanaeohtopb thanaeohtbop
thanaeohtbpo thanaeohtpbo thanaeohtpob thanaeoohpbt thanaeoohptb thanaeoohbpt thanaeoohbtp thanaeoohtbp thanaeoohtpb
thanaeoophbt thanaeoophtb thanaeoopbht thanaeoopbth thanaeooptbh thanaeoopthb thanaeoobpht thanaeoobpth thanaeoobhpt
thanaeoobhtp thanaeoobthp thanaeoobtph thanaeootpbh thanaeootphb thanaeootbph thanaeootbhp thanaeoothbp thanaeoothpb
thanaeobhopt thanaeobhotp thanaeobhpot thanaeobhpto thanaeobhtpo thanaeobhtop thanaeobohpt thanaeobohtp thanaeobopht
thanaeobopth thanaeobotph thanaeobothp thanaeobpoht thanaeobpoth thanaeobphot thanaeobphto thanaeobptho thanaeobptoh
thanaeobtoph thanaeobtohp thanaeobtpoh thanaeobtpho thanaeobthpo thanaeobthop thanaeothobp thanaeothopb thanaeothbop
thanaeothbpo thanaeothpbo thanaeothpob thanaeotohbp thanaeotohpb thanaeotobhp thanaeotobph thanaeotopbh thanaeotophb
thanaeotbohp thanaeotboph thanaeotbhop thanaeotbhpo thanaeotbpho thanaeotbpoh thanaeotpobh thanaeotpohb thanaeotpboh
thanaeotpbho thanaeotphbo thanaeotphob thanaepohobt thanaepohotb thanaepohbot thanaepohbto thanaepohtbo thanaepohtob
thanaepoohbt thanaepoohtb thanaepoobht thanaepoobth thanaepootbh thanaepoothb thanaepoboht thanaepoboth thanaepobhot
thanaepobhto thanaepobtho thanaepobtoh thanaepotobh thanaepotohb thanaepotboh thanaepotbho thanaepothbo thanaepothob
thanaephoobt thanaephootb thanaephobot thanaephobto thanaephotbo thanaephotob thanaephoobt thanaephootb thanaephobot
thanaephobto thanaephotbo thanaephotob thanaephboot thanaephboto thanaephboot thanaephboto thanaephbtoo thanaephbtoo
thanaephtobo thanaephtoob thanaephtboo thanaephtboo thanaephtobo thanaephtoob thanaepohobt thanaepohotb thanaepohbot
thanaepohbto thanaepohtbo thanaepohtob thanaepoohbt thanaepoohtb thanaepoobht thanaepoobth thanaepootbh thanaepoothb
thanaepoboht thanaepoboth thanaepobhot thanaepobhto thanaepobtho thanaepobtoh thanaepotobh thanaepotohb thanaepotboh
thanaepotbho thanaepothbo thanaepothob thanaepbhoot thanaepbhoto thanaepbhoot thanaepbhoto thanaepbhtoo thanaepbhtoo
thanaepbohot thanaepbohto thanaepbooht thanaepbooth thanaepbotoh thanaepbotho thanaepbooht thanaepbooth thanaepbohot
thanaepbohto thanaepbotho thanaepbotoh thanaepbtooh thanaepbtoho thanaepbtooh thanaepbtoho thanaepbthoo thanaepbthoo
thanaepthobo thanaepthoob thanaepthboo thanaepthboo thanaepthobo thanaepthoob thanaeptohbo thanaeptohob thanaeptobho
thanaeptoboh thanaeptoobh thanaeptoohb thanaeptboho thanaeptbooh thanaeptbhoo thanaeptbhoo thanaeptboho thanaeptbooh
thanaeptoobh thanaeptoohb thanaeptoboh thanaeptobho thanaeptohbo thanaeptohob thanaehpoobt thanaehpootb thanaehpobot
thanaehpobto thanaehpotbo thanaehpotob thanaehpoobt thanaehpootb thanaehpobot thanaehpobto thanaehpotbo thanaehpotob
thanaehpboot thanaehpboto thanaehpboot thanaehpboto thanaehpbtoo thanaehpbtoo thanaehptobo thanaehptoob thanaehptboo
thanaehptboo thanaehptobo thanaehptoob thanaehopobt thanaehopotb thanaehopbot thanaehopbto thanaehoptbo thanaehoptob
thanaehoopbt thanaehooptb thanaehoobpt thanaehoobtp thanaehootbp thanaehootpb thanaehobopt thanaehobotp thanaehobpot
thanaehobpto thanaehobtpo thanaehobtop thanaehotobp thanaehotopb thanaehotbop thanaehotbpo thanaehotpbo thanaehotpob
thanaehoopbt thanaehooptb thanaehoobpt thanaehoobtp thanaehootbp thanaehootpb thanaehopobt thanaehopotb thanaehopbot
thanaehopbto thanaehoptbo thanaehoptob thanaehobpot thanaehobpto thanaehobopt thanaehobotp thanaehobtop thanaehobtpo
thanaehotpbo thanaehotpob thanaehotbpo thanaehotbop thanaehotobp thanaehotopb thanaehboopt thanaehbootp thanaehbopot
thanaehbopto thanaehbotpo thanaehbotop thanaehboopt thanaehbootp thanaehbopot thanaehbopto thanaehbotpo thanaehbotop
thanaehbpoot thanaehbpoto thanaehbpoot thanaehbpoto thanaehbptoo thanaehbptoo thanaehbtopo thanaehbtoop thanaehbtpoo
thanaehbtpoo thanaehbtopo thanaehbtoop thanaehtoobp thanaehtoopb thanaehtobop thanaehtobpo thanaehtopbo thanaehtopob
thanaehtoobp thanaehtoopb thanaehtobop thanaehtobpo thanaehtopbo thanaehtopob thanaehtboop thanaehtbopo thanaehtboop
thanaehtbopo thanaehtbpoo thanaehtbpoo thanaehtpobo thanaehtpoob thanaehtpboo thanaehtpboo thanaehtpobo thanaehtpoob
thanaeophobt thanaeophotb thanaeophbot thanaeophbto thanaeophtbo thanaeophtob thanaeopohbt thanaeopohtb thanaeopobht
thanaeopobth thanaeopotbh thanaeopothb thanaeopboht thanaeopboth thanaeopbhot thanaeopbhto thanaeopbtho thanaeopbtoh
thanaeoptobh thanaeoptohb thanaeoptboh thanaeoptbho thanaeopthbo thanaeopthob thanaeohpobt thanaeohpotb thanaeohpbot
thanaeohpbto thanaeohptbo thanaeohptob thanaeohopbt thanaeohoptb thanaeohobpt thanaeohobtp thanaeohotbp thanaeohotpb
thanaeohbopt thanaeohbotp thanaeohbpot thanaeohbpto thanaeohbtpo thanaeohbtop thanaeohtobp thanaeohtopb thanaeohtbop
thanaeohtbpo thanaeohtpbo thanaeohtpob thanaeoohpbt thanaeoohptb thanaeoohbpt thanaeoohbtp thanaeoohtbp thanaeoohtpb
thanaeoophbt thanaeoophtb thanaeoopbht thanaeoopbth thanaeooptbh thanaeoopthb thanaeoobpht thanaeoobpth thanaeoobhpt
thanaeoobhtp thanaeoobthp thanaeoobtph thanaeootpbh thanaeootphb thanaeootbph thanaeootbhp thanaeoothbp thanaeoothpb
thanaeobhopt thanaeobhotp thanaeobhpot thanaeobhpto thanaeobhtpo thanaeobhtop thanaeobohpt thanaeobohtp thanaeobopht
thanaeobopth thanaeobotph thanaeobothp thanaeobpoht thanaeobpoth thanaeobphot thanaeobphto thanaeobptho thanaeobptoh
thanaeobtoph thanaeobtohp thanaeobtpoh thanaeobtpho thanaeobthpo thanaeobthop thanaeothobp thanaeothopb thanaeothbop
thanaeothbpo thanaeothpbo thanaeothpob thanaeotohbp thanaeotohpb thanaeotobhp thanaeotobph thanaeotopbh thanaeotophb
thanaeotbohp thanaeotboph thanaeotbhop thanaeotbhpo thanaeotbpho thanaeotbpoh thanaeotpobh thanaeotpohb thanaeotpboh
thanaeotpbho thanaeotphbo thanaeotphob thanaebphoot thanaebphoto thanaebphoot thanaebphoto thanaebphtoo thanaebphtoo
thanaebpohot thanaebpohto thanaebpooht thanaebpooth thanaebpotoh thanaebpotho thanaebpooht thanaebpooth thanaebpohot
thanaebpohto thanaebpotho thanaebpotoh thanaebptooh thanaebptoho thanaebptooh thanaebptoho thanaebpthoo thanaebpthoo
thanaebhpoot thanaebhpoto thanaebhpoot thanaebhpoto thanaebhptoo thanaebhptoo thanaebhopot thanaebhopto thanaebhoopt
thanaebhootp thanaebhotop thanaebhotpo thanaebhoopt thanaebhootp thanaebhopot thanaebhopto thanaebhotpo thanaebhotop
thanaebhtoop thanaebhtopo thanaebhtoop thanaebhtopo thanaebhtpoo thanaebhtpoo thanaebohpot thanaebohpto thanaebohopt
thanaebohotp thanaebohtop thanaebohtpo thanaebophot thanaebophto thanaebopoht thanaebopoth thanaeboptoh thanaeboptho
thanaeboopht thanaeboopth thanaeboohpt thanaeboohtp thanaeboothp thanaebootph thanaebotpoh thanaebotpho thanaebotoph
thanaebotohp thanaebothop thanaebothpo thanaebohopt thanaebohotp thanaebohpot thanaebohpto thanaebohtpo thanaebohtop
thanaeboohpt thanaeboohtp thanaeboopht thanaeboopth thanaebootph thanaeboothp thanaebopoht thanaebopoth thanaebophot
thanaebophto thanaeboptho thanaeboptoh thanaebotoph thanaebotohp thanaebotpoh thanaebotpho thanaebothpo thanaebothop
thanaebthoop thanaebthopo thanaebthoop thanaebthopo thanaebthpoo thanaebthpoo thanaebtohop thanaebtohpo thanaebtoohp
thanaebtooph thanaebtopoh thanaebtopho thanaebtoohp thanaebtooph thanaebtohop thanaebtohpo thanaebtopho thanaebtopoh
thanaebtpooh thanaebtpoho thanaebtpooh thanaebtpoho thanaebtphoo thanaebtphoo thanaetphobo thanaetphoob thanaetphboo
thanaetphboo thanaetphobo thanaetphoob thanaetpohbo thanaetpohob thanaetpobho thanaetpoboh thanaetpoobh thanaetpoohb
thanaetpboho thanaetpbooh thanaetpbhoo thanaetpbhoo thanaetpboho thanaetpbooh thanaetpoobh thanaetpoohb thanaetpoboh
thanaetpobho thanaetpohbo thanaetpohob thanaethpobo thanaethpoob thanaethpboo thanaethpboo thanaethpobo thanaethpoob
thanaethopbo thanaethopob thanaethobpo thanaethobop thanaethoobp thanaethoopb thanaethbopo thanaethboop thanaethbpoo
thanaethbpoo thanaethbopo thanaethboop thanaethoobp thanaethoopb thanaethobop thanaethobpo thanaethopbo thanaethopob
thanaetohpbo thanaetohpob thanaetohbpo thanaetohbop thanaetohobp thanaetohopb thanaetophbo thanaetophob thanaetopbho
thanaetopboh thanaetopobh thanaetopohb thanaetobpho thanaetobpoh thanaetobhpo thanaetobhop thanaetobohp thanaetoboph
thanaetoopbh thanaetoophb thanaetoobph thanaetoobhp thanaetoohbp thanaetoohpb thanaetbhopo thanaetbhoop thanaetbhpoo
thanaetbhpoo thanaetbhopo thanaetbhoop thanaetbohpo thanaetbohop thanaetbopho thanaetbopoh thanaetbooph thanaetboohp
thanaetbpoho thanaetbpooh thanaetbphoo thanaetbphoo thanaetbpoho thanaetbpooh thanaetbooph thanaetboohp thanaetbopoh
thanaetbopho thanaetbohpo thanaetbohop thanaetohobp thanaetohopb thanaetohbop thanaetohbpo thanaetohpbo thanaetohpob
thanaetoohbp thanaetoohpb thanaetoobhp thanaetoobph thanaetoopbh thanaetoophb thanaetobohp thanaetoboph thanaetobhop
thanaetobhpo thanaetobpho thanaetobpoh thanaetopobh thanaetopohb thanaetopboh thanaetopbho thanaetophbo thanaetophob

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us