easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

tortious

praisable

lomenta

antibacterial

transvenom

sackcloth

epochism

avowals

columnist

arranger

saeuitumque

expenderentque

goofier

audiam

percontatorial

natavistis

esthesiogenic

rotary


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: teutonique
cipher variations:
ufvupojrvf vgwvqpkswg whxwrqltxh xiyxsrmuyi yjzytsnvzj
zkazutowak albavupxbl bmcbwvqycm cndcxwrzdn doedyxsaeo
epfezytbfp fqgfazucgq grhgbavdhr hsihcbweis itjidcxfjt
jukjedygku kvlkfezhlv lwmlgfaimw mxnmhgbjnx nyonihckoy
ozpojidlpz paqpkjemqa qbrqlkfnrb rcsrmlgosc sdtsnmhptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: teutonique
Cipher: gvfglmrjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: teutonique
Cipher: BAABA AABAA BAABB BAABA ABBAB ABBAA ABAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: teutonique
cipher variations:
ufvupojrvfgnjgrozxjnsvxstopdxvedlevofjldqlzqxovpzlctnczolvntajpadorhpjmrdmfohndr
yzryhoxtrzkhfkjonzfhwptwlodftpixhinotlhxvgwvqpkswghokhspaykotwytupqeywfemfwpgkme
rmarypwqamduodapmwoubkqbepsiqknsengpioeszaszipyusaliglkpoagixquxmpeguqjyijopumiy
whxwrqltxhiplitqbzlpuxzuvqrfzxgfngxqhlnfsnbszqxrbnevpebqnxpvclrcfqtjrlotfohqjpft
abtajqzvtbmjhmlqpbhjyrvynqfhvrkzjkpqvnjzxiyxsrmuyijqmjurcamqvyavwrsgayhgohyrimog
toctaryscofwqfcroyqwdmsdgruksmpugpirkqgubcubkrawucnkinmrqcikzswzorgiwslaklqrwoka
yjzytsnvzjkrnkvsdbnrwzbwxsthbzihpizsjnphupdubsztdpgxrgdspzrxentehsvltnqvhqjslrhv
cdvclsbxvdoljonsrdjlatxapshjxtmblmrsxplbzkazutowaklsolwtecosxacxytuicajiqjatkoqi
vqevctaueqhyshetqasyfoufitwmuorwirktmsiwdewdmtcywepmkpotsekmbuybqtikyuncmnstyqmc
albavupxblmtpmxufdptybdyzuvjdbkjrkbulprjwrfwdubvfriztifurbtzgpvgjuxnvpsxjsluntjx
efxenudzxfqnlqputflncvzcrujlzvodnotuzrndbmcbwvqycmnuqnyvgequzcezavwkeclkslcvmqsk
xsgxevcwgsjaujgvscuahqwhkvyowqtyktmvoukyfgyfoveaygromrqvugmodwadsvkmawpeopuvasoe
cndcxwrzdnovrozwhfrvadfabwxlfdmltmdwnrtlythyfwdxhtkbvkhwtdvbirxilwzpxruzlunwpvlz
ghzgpwfbzhspnsrwvhnpexbetwlnbxqfpqvwbtpfdoedyxsaeopwspaxigswbegbcxymgenmunexosum
zuizgxeyiulcwlixuewcjsyjmxaqysvamvoxqwmahiahqxgcaitqotsxwioqfycfuxmocyrgqrwxcuqg
epfezytbfpqxtqbyjhtxcfhcdyznhfonvofyptvnavjahyfzjvmdxmjyvfxdktzknybrztwbnwpyrxnb
ijbiryhdbjurputyxjprgzdgvynpdzshrsxydvrhfqgfazucgqryurczkiuydgidezaoigpowpgzquwo
bwkbizgakwneynkzwgyelualozcsauxcoxqzsyocjkcjszieckvsqvuzykqshaehwzoqeatistyzewsi
grhgbavdhrszvsdaljvzehjefabpjhqpxqharvxpcxlcjahblxofzolaxhzfmvbmpadtbvydpyratzpd
kldktajfdlwtrwvazlrtibfixaprfbujtuzafxtjhsihcbweistawtebmkwafikfgbcqkirqyribswyq
dymdkbicmypgapmbyiagnwcnqbeucwzeqzsbuaqelmelubkgemxusxwbamsujcgjybqsgcvkuvabgyuk
itjidcxfjtubxufcnlxbgjlghcdrljsrzsjctxzreznelcjdnzqhbqnczjbhoxdorcfvdxafratcvbrf
mnfmvclhfnyvtyxcbntvkdhkzcrthdwlvwbchzvljukjedygkuvcyvgdomychkmhidesmktsatkduyas
faofmdkeoaricrodakcipyepsdgweybgsbudwcsgnognwdmigozwuzydcouwleiladsuiexmwxcdiawm
kvlkfezhlvwdzwhepnzdilnijeftnlutbulevzbtgbpgnelfpbsjdspebldjqzfqtehxfzchtcvexdth
ophoxenjhpaxvazedpvxmfjmbetvjfynxydejbxnlwmlgfaimwxeaxifqoaejmojkfguomvucvmfwacu
hcqhofmgqctketqfcmekragrufiygadiudwfyeuipqipyfokiqbywbafeqwyngkncfuwkgzoyzefkcyo
mxnmhgbjnxyfbyjgrpbfknpklghvpnwvdwngxbdvidripgnhrdulfurgdnflsbhsvgjzhbejvexgzfvj
qrjqzgpljrczxcbgfrxzohlodgvxlhapzafgldzpnyonihckoyzgczkhsqcgloqlmhiwqoxwexohycew
jesjqhoisevmgvsheogmtcitwhkaicfkwfyhagwkrskrahqmksdaydchgsyapimpehwymibqabghmeaq
ozpojidlpzahdalitrdhmprmnijxrpyxfypizdfxkftkripjtfwnhwtifphnudjuxilbjdglxgzibhxl
stlsbirnltebzedihtzbqjnqfixznjcrbchinfbrpaqpkjemqabiebmjuseinqsnojkysqzygzqjaegy
lgulsjqkugxoixujgqiovekvyjmckehmyhajciymtumtcjsomufcafejiuacrkorgjyaokdscdijogcs
qbrqlkfnrbcjfcnkvtfjortopklztrazharkbfhzmhvmtkrlvhypjyvkhrjpwflwzkndlfinzibkdjzn
uvnudktpnvgdbgfkjvbdslpshkzbpletdejkphdtrcsrmlgoscdkgdolwugkpsupqlmausbaibslcgia
niwnulsmwizqkzwliskqxgmxaloemgjoajclekaovwoveluqowhechglkwcetmqtilacqmfuefklqieu
sdtsnmhptdelhepmxvhlqtvqrmnbvtcbjctmdhjbojxovmtnxjarlaxmjtlryhnybmpfnhkpbkdmflbp
wxpwfmvrpxifdihmlxdfunrujmbdrngvfglmrjfvteutoniquefmifqnywimruwrsnocwudckduneikc
pkypwnuoykbsmbynkumsziozcnqgoilqclengmcqxyqxgnwsqyjgejinmyegvosvkncesohwghmnskgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: teutonique
Cipher: grhgbavdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: teutonique
Cipher: 44515444433342145451

Extended Methods:
Method #1

Plaintext: teutonique
method variations:
ykzytsovzkdpedyxtaepiukidcyfkuozpoihdlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
t e u t o n i q u e 
4 5 5 4 4 3 4 1 5 5 
4 1 4 4 3 3 2 4 4 1 
They are then read out in rows:
45544341554144332441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: teutonique
Cipher: yuodzdtnrd

Read more ...
Method #3

Plaintext: teutonique
method variations:
yvttnsbyyq vttnsbyyqy ttnsbyyqyv
tnsbyyqyvt nsbyyqyvtt sbyyqyvttn
byyqyvttns yyqyvttnsb yqyvttnsby
qyvttnsbyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: teutonique

first 5040 cipher variations(3628800 total)
teutonique teutoniqeu teutoniuqe teutoniueq teutonieuq teutoniequ teutonqiue teutonqieu teutonquie teutonquei teutonqeui
teutonqeiu teutonuqie teutonuqei teutonuiqe teutonuieq teutonueiq teutonueqi teutonequi teutoneqiu teutoneuqi teutoneuiq
teutoneiuq teutoneiqu teutoinque teutoinqeu teutoinuqe teutoinueq teutoineuq teutoinequ teutoiqnue teutoiqneu teutoiqune
teutoiquen teutoiqeun teutoiqenu teutoiuqne teutoiuqen teutoiunqe teutoiuneq teutoiuenq teutoiueqn teutoiequn teutoieqnu
teutoieuqn teutoieunq teutoienuq teutoienqu teutoqinue teutoqineu teutoqiune teutoqiuen teutoqieun teutoqienu teutoqniue
teutoqnieu teutoqnuie teutoqnuei teutoqneui teutoqneiu teutoqunie teutoqunei teutoquine teutoquien teutoquein teutoqueni
teutoqenui teutoqeniu teutoqeuni teutoqeuin teutoqeiun teutoqeinu teutouiqne teutouiqen teutouinqe teutouineq teutouienq
teutouieqn teutouqine teutouqien teutouqnie teutouqnei teutouqeni teutouqein teutounqie teutounqei teutouniqe teutounieq
teutouneiq teutouneqi teutoueqni teutoueqin teutouenqi teutoueniq teutoueinq teutoueiqn teutoeiqun teutoeiqnu teutoeiuqn
teutoeiunq teutoeinuq teutoeinqu teutoeqiun teutoeqinu teutoequin teutoequni teutoeqnui teutoeqniu teutoeuqin teutoeuqni
teutoeuiqn teutoeuinq teutoeuniq teutoeunqi teutoenqui teutoenqiu teutoenuqi teutoenuiq teutoeniuq teutoeniqu teutnoique
teutnoiqeu teutnoiuqe teutnoiueq teutnoieuq teutnoiequ teutnoqiue teutnoqieu teutnoquie teutnoquei teutnoqeui teutnoqeiu
teutnouqie teutnouqei teutnouiqe teutnouieq teutnoueiq teutnoueqi teutnoequi teutnoeqiu teutnoeuqi teutnoeuiq teutnoeiuq
teutnoeiqu teutnioque teutnioqeu teutniouqe teutnioueq teutnioeuq teutnioequ teutniqoue teutniqoeu teutniquoe teutniqueo
teutniqeuo teutniqeou teutniuqoe teutniuqeo teutniuoqe teutniuoeq teutniueoq teutniueqo teutniequo teutnieqou teutnieuqo
teutnieuoq teutnieouq teutnieoqu teutnqioue teutnqioeu teutnqiuoe teutnqiueo teutnqieuo teutnqieou teutnqoiue teutnqoieu
teutnqouie teutnqouei teutnqoeui teutnqoeiu teutnquoie teutnquoei teutnquioe teutnquieo teutnqueio teutnqueoi teutnqeoui
teutnqeoiu teutnqeuoi teutnqeuio teutnqeiuo teutnqeiou teutnuiqoe teutnuiqeo teutnuioqe teutnuioeq teutnuieoq teutnuieqo
teutnuqioe teutnuqieo teutnuqoie teutnuqoei teutnuqeoi teutnuqeio teutnuoqie teutnuoqei teutnuoiqe teutnuoieq teutnuoeiq
teutnuoeqi teutnueqoi teutnueqio teutnueoqi teutnueoiq teutnueioq teutnueiqo teutneiquo teutneiqou teutneiuqo teutneiuoq
teutneiouq teutneioqu teutneqiuo teutneqiou teutnequio teutnequoi teutneqoui teutneqoiu teutneuqio teutneuqoi teutneuiqo
teutneuioq teutneuoiq teutneuoqi teutneoqui teutneoqiu teutneouqi teutneouiq teutneoiuq teutneoiqu teutinoque teutinoqeu
teutinouqe teutinoueq teutinoeuq teutinoequ teutinqoue teutinqoeu teutinquoe teutinqueo teutinqeuo teutinqeou teutinuqoe
teutinuqeo teutinuoqe teutinuoeq teutinueoq teutinueqo teutinequo teutineqou teutineuqo teutineuoq teutineouq teutineoqu
teutionque teutionqeu teutionuqe teutionueq teutioneuq teutionequ teutioqnue teutioqneu teutioqune teutioquen teutioqeun
teutioqenu teutiouqne teutiouqen teutiounqe teutiouneq teutiouenq teutioueqn teutioequn teutioeqnu teutioeuqn teutioeunq
teutioenuq teutioenqu teutiqonue teutiqoneu teutiqoune teutiqouen teutiqoeun teutiqoenu teutiqnoue teutiqnoeu teutiqnuoe
teutiqnueo teutiqneuo teutiqneou teutiqunoe teutiquneo teutiquone teutiquoen teutiqueon teutiqueno teutiqenuo teutiqenou
teutiqeuno teutiqeuon teutiqeoun teutiqeonu teutiuoqne teutiuoqen teutiuonqe teutiuoneq teutiuoenq teutiuoeqn teutiuqone
teutiuqoen teutiuqnoe teutiuqneo teutiuqeno teutiuqeon teutiunqoe teutiunqeo teutiunoqe teutiunoeq teutiuneoq teutiuneqo
teutiueqno teutiueqon teutiuenqo teutiuenoq teutiueonq teutiueoqn teutieoqun teutieoqnu teutieouqn teutieounq teutieonuq
teutieonqu teutieqoun teutieqonu teutiequon teutiequno teutieqnuo teutieqnou teutieuqon teutieuqno teutieuoqn teutieuonq
teutieunoq teutieunqo teutienquo teutienqou teutienuqo teutienuoq teutienouq teutienoqu teutqnioue teutqnioeu teutqniuoe
teutqniueo teutqnieuo teutqnieou teutqnoiue teutqnoieu teutqnouie teutqnouei teutqnoeui teutqnoeiu teutqnuoie teutqnuoei
teutqnuioe teutqnuieo teutqnueio teutqnueoi teutqneoui teutqneoiu teutqneuoi teutqneuio teutqneiuo teutqneiou teutqinoue
teutqinoeu teutqinuoe teutqinueo teutqineuo teutqineou teutqionue teutqioneu teutqioune teutqiouen teutqioeun teutqioenu
teutqiuone teutqiuoen teutqiunoe teutqiuneo teutqiueno teutqiueon teutqieoun teutqieonu teutqieuon teutqieuno teutqienuo
teutqienou teutqoinue teutqoineu teutqoiune teutqoiuen teutqoieun teutqoienu teutqoniue teutqonieu teutqonuie teutqonuei
teutqoneui teutqoneiu teutqounie teutqounei teutqouine teutqouien teutqouein teutqoueni teutqoenui teutqoeniu teutqoeuni
teutqoeuin teutqoeiun teutqoeinu teutquione teutquioen teutquinoe teutquineo teutquieno teutquieon teutquoine teutquoien
teutquonie teutquonei teutquoeni teutquoein teutqunoie teutqunoei teutqunioe teutqunieo teutquneio teutquneoi teutqueoni
teutqueoin teutquenoi teutquenio teutqueino teutqueion teutqeioun teutqeionu teutqeiuon teutqeiuno teutqeinuo teutqeinou
teutqeoiun teutqeoinu teutqeouin teutqeouni teutqeonui teutqeoniu teutqeuoin teutqeuoni teutqeuion teutqeuino teutqeunio
teutqeunoi teutqenoui teutqenoiu teutqenuoi teutqenuio teutqeniuo teutqeniou teutuniqoe teutuniqeo teutunioqe teutunioeq
teutunieoq teutunieqo teutunqioe teutunqieo teutunqoie teutunqoei teutunqeoi teutunqeio teutunoqie teutunoqei teutunoiqe
teutunoieq teutunoeiq teutunoeqi teutuneqoi teutuneqio teutuneoqi teutuneoiq teutuneioq teutuneiqo teutuinqoe teutuinqeo
teutuinoqe teutuinoeq teutuineoq teutuineqo teutuiqnoe teutuiqneo teutuiqone teutuiqoen teutuiqeon teutuiqeno teutuioqne
teutuioqen teutuionqe teutuioneq teutuioenq teutuioeqn teutuieqon teutuieqno teutuieoqn teutuieonq teutuienoq teutuienqo
teutuqinoe teutuqineo teutuqione teutuqioen teutuqieon teutuqieno teutuqnioe teutuqnieo teutuqnoie teutuqnoei teutuqneoi
teutuqneio teutuqonie teutuqonei teutuqoine teutuqoien teutuqoein teutuqoeni teutuqenoi teutuqenio teutuqeoni teutuqeoin
teutuqeion teutuqeino teutuoiqne teutuoiqen teutuoinqe teutuoineq teutuoienq teutuoieqn teutuoqine teutuoqien teutuoqnie
teutuoqnei teutuoqeni teutuoqein teutuonqie teutuonqei teutuoniqe teutuonieq teutuoneiq teutuoneqi teutuoeqni teutuoeqin
teutuoenqi teutuoeniq teutuoeinq teutuoeiqn teutueiqon teutueiqno teutueioqn teutueionq teutueinoq teutueinqo teutueqion
teutueqino teutueqoin teutueqoni teutueqnoi teutueqnio teutueoqin teutueoqni teutueoiqn teutueoinq teutueoniq teutueonqi
teutuenqoi teutuenqio teutuenoqi teutuenoiq teutuenioq teutueniqo teuteniquo teuteniqou teuteniuqo teuteniuoq teuteniouq
teutenioqu teutenqiuo teutenqiou teutenquio teutenquoi teutenqoui teutenqoiu teutenuqio teutenuqoi teutenuiqo teutenuioq
teutenuoiq teutenuoqi teutenoqui teutenoqiu teutenouqi teutenouiq teutenoiuq teutenoiqu teuteinquo teuteinqou teuteinuqo
teuteinuoq teuteinouq teuteinoqu teuteiqnuo teuteiqnou teuteiquno teuteiquon teuteiqoun teuteiqonu teuteiuqno teuteiuqon
teuteiunqo teuteiunoq teuteiuonq teuteiuoqn teuteioqun teuteioqnu teuteiouqn teuteiounq teuteionuq teuteionqu teuteqinuo
teuteqinou teuteqiuno teuteqiuon teuteqioun teuteqionu teuteqniuo teuteqniou teuteqnuio teuteqnuoi teuteqnoui teuteqnoiu
teutequnio teutequnoi teutequino teutequion teutequoin teutequoni teuteqonui teuteqoniu teuteqouni teuteqouin teuteqoiun
teuteqoinu teuteuiqno teuteuiqon teuteuinqo teuteuinoq teuteuionq teuteuioqn teuteuqino teuteuqion teuteuqnio teuteuqnoi
teuteuqoni teuteuqoin teuteunqio teuteunqoi teuteuniqo teuteunioq teuteunoiq teuteunoqi teuteuoqni teuteuoqin teuteuonqi
teuteuoniq teuteuoinq teuteuoiqn teuteoiqun teuteoiqnu teuteoiuqn teuteoiunq teuteoinuq teuteoinqu teuteoqiun teuteoqinu
teuteoquin teuteoquni teuteoqnui teuteoqniu teuteouqin teuteouqni teuteouiqn teuteouinq teuteouniq teuteounqi teuteonqui
teuteonqiu teuteonuqi teuteonuiq teuteoniuq teuteoniqu teuotnique teuotniqeu teuotniuqe teuotniueq teuotnieuq teuotniequ
teuotnqiue teuotnqieu teuotnquie teuotnquei teuotnqeui teuotnqeiu teuotnuqie teuotnuqei teuotnuiqe teuotnuieq teuotnueiq
teuotnueqi teuotnequi teuotneqiu teuotneuqi teuotneuiq teuotneiuq teuotneiqu teuotinque teuotinqeu teuotinuqe teuotinueq
teuotineuq teuotinequ teuotiqnue teuotiqneu teuotiqune teuotiquen teuotiqeun teuotiqenu teuotiuqne teuotiuqen teuotiunqe
teuotiuneq teuotiuenq teuotiueqn teuotiequn teuotieqnu teuotieuqn teuotieunq teuotienuq teuotienqu teuotqinue teuotqineu
teuotqiune teuotqiuen teuotqieun teuotqienu teuotqniue teuotqnieu teuotqnuie teuotqnuei teuotqneui teuotqneiu teuotqunie
teuotqunei teuotquine teuotquien teuotquein teuotqueni teuotqenui teuotqeniu teuotqeuni teuotqeuin teuotqeiun teuotqeinu
teuotuiqne teuotuiqen teuotuinqe teuotuineq teuotuienq teuotuieqn teuotuqine teuotuqien teuotuqnie teuotuqnei teuotuqeni
teuotuqein teuotunqie teuotunqei teuotuniqe teuotunieq teuotuneiq teuotuneqi teuotueqni teuotueqin teuotuenqi teuotueniq
teuotueinq teuotueiqn teuoteiqun teuoteiqnu teuoteiuqn teuoteiunq teuoteinuq teuoteinqu teuoteqiun teuoteqinu teuotequin
teuotequni teuoteqnui teuoteqniu teuoteuqin teuoteuqni teuoteuiqn teuoteuinq teuoteuniq teuoteunqi teuotenqui teuotenqiu
teuotenuqi teuotenuiq teuoteniuq teuoteniqu teuontique teuontiqeu teuontiuqe teuontiueq teuontieuq teuontiequ teuontqiue
teuontqieu teuontquie teuontquei teuontqeui teuontqeiu teuontuqie teuontuqei teuontuiqe teuontuieq teuontueiq teuontueqi
teuontequi teuonteqiu teuonteuqi teuonteuiq teuonteiuq teuonteiqu teuonitque teuonitqeu teuonituqe teuonitueq teuoniteuq
teuonitequ teuoniqtue teuoniqteu teuoniqute teuoniquet teuoniqeut teuoniqetu teuoniuqte teuoniuqet teuoniutqe teuoniuteq
teuoniuetq teuoniueqt teuoniequt teuonieqtu teuonieuqt teuonieutq teuonietuq teuonietqu teuonqitue teuonqiteu teuonqiute
teuonqiuet teuonqieut teuonqietu teuonqtiue teuonqtieu teuonqtuie teuonqtuei teuonqteui teuonqteiu teuonqutie teuonqutei
teuonquite teuonquiet teuonqueit teuonqueti teuonqetui teuonqetiu teuonqeuti teuonqeuit teuonqeiut teuonqeitu teuonuiqte
teuonuiqet teuonuitqe teuonuiteq teuonuietq teuonuieqt teuonuqite teuonuqiet teuonuqtie teuonuqtei teuonuqeti teuonuqeit
teuonutqie teuonutqei teuonutiqe teuonutieq teuonuteiq teuonuteqi teuonueqti teuonueqit teuonuetqi teuonuetiq teuonueitq
teuonueiqt teuoneiqut teuoneiqtu teuoneiuqt teuoneiutq teuoneituq teuoneitqu teuoneqiut teuoneqitu teuonequit teuonequti
teuoneqtui teuoneqtiu teuoneuqit teuoneuqti teuoneuiqt teuoneuitq teuoneutiq teuoneutqi teuonetqui teuonetqiu teuonetuqi
teuonetuiq teuonetiuq teuonetiqu teuointque teuointqeu teuointuqe teuointueq teuointeuq teuointequ teuoinqtue teuoinqteu
teuoinqute teuoinquet teuoinqeut teuoinqetu teuoinuqte teuoinuqet teuoinutqe teuoinuteq teuoinuetq teuoinueqt teuoinequt
teuoineqtu teuoineuqt teuoineutq teuoinetuq teuoinetqu teuoitnque teuoitnqeu teuoitnuqe teuoitnueq teuoitneuq teuoitnequ
teuoitqnue teuoitqneu teuoitqune teuoitquen teuoitqeun teuoitqenu teuoituqne teuoituqen teuoitunqe teuoituneq teuoituenq
teuoitueqn teuoitequn teuoiteqnu teuoiteuqn teuoiteunq teuoitenuq teuoitenqu teuoiqtnue teuoiqtneu teuoiqtune teuoiqtuen
teuoiqteun teuoiqtenu teuoiqntue teuoiqnteu teuoiqnute teuoiqnuet teuoiqneut teuoiqnetu teuoiqunte teuoiqunet teuoiqutne
teuoiquten teuoiquetn teuoiquent teuoiqenut teuoiqentu teuoiqeunt teuoiqeutn teuoiqetun teuoiqetnu teuoiutqne teuoiutqen
teuoiutnqe teuoiutneq teuoiutenq teuoiuteqn teuoiuqtne teuoiuqten teuoiuqnte teuoiuqnet teuoiuqent teuoiuqetn teuoiunqte
teuoiunqet teuoiuntqe teuoiunteq teuoiunetq teuoiuneqt teuoiueqnt teuoiueqtn teuoiuenqt teuoiuentq teuoiuetnq teuoiuetqn
teuoietqun teuoietqnu teuoietuqn teuoietunq teuoietnuq teuoietnqu teuoieqtun teuoieqtnu teuoiequtn teuoiequnt teuoieqnut
teuoieqntu teuoieuqtn teuoieuqnt teuoieutqn teuoieutnq teuoieuntq teuoieunqt teuoienqut teuoienqtu teuoienuqt teuoienutq
teuoientuq teuoientqu teuoqnitue teuoqniteu teuoqniute teuoqniuet teuoqnieut teuoqnietu teuoqntiue teuoqntieu teuoqntuie
teuoqntuei teuoqnteui teuoqnteiu teuoqnutie teuoqnutei teuoqnuite teuoqnuiet teuoqnueit teuoqnueti teuoqnetui teuoqnetiu
teuoqneuti teuoqneuit teuoqneiut teuoqneitu teuoqintue teuoqinteu teuoqinute teuoqinuet teuoqineut teuoqinetu teuoqitnue
teuoqitneu teuoqitune teuoqituen teuoqiteun teuoqitenu teuoqiutne teuoqiuten teuoqiunte teuoqiunet teuoqiuent teuoqiuetn
teuoqietun teuoqietnu teuoqieutn teuoqieunt teuoqienut teuoqientu teuoqtinue teuoqtineu teuoqtiune teuoqtiuen teuoqtieun
teuoqtienu teuoqtniue teuoqtnieu teuoqtnuie teuoqtnuei teuoqtneui teuoqtneiu teuoqtunie teuoqtunei teuoqtuine teuoqtuien
teuoqtuein teuoqtueni teuoqtenui teuoqteniu teuoqteuni teuoqteuin teuoqteiun teuoqteinu teuoquitne teuoquiten teuoquinte
teuoquinet teuoquient teuoquietn teuoqutine teuoqutien teuoqutnie teuoqutnei teuoquteni teuoqutein teuoquntie teuoquntei
teuoqunite teuoquniet teuoquneit teuoquneti teuoquetni teuoquetin teuoquenti teuoquenit teuoqueint teuoqueitn teuoqeitun
teuoqeitnu teuoqeiutn teuoqeiunt teuoqeinut teuoqeintu teuoqetiun teuoqetinu teuoqetuin teuoqetuni teuoqetnui teuoqetniu
teuoqeutin teuoqeutni teuoqeuitn teuoqeuint teuoqeunit teuoqeunti teuoqentui teuoqentiu teuoqenuti teuoqenuit teuoqeniut
teuoqenitu teuouniqte teuouniqet teuounitqe teuouniteq teuounietq teuounieqt teuounqite teuounqiet teuounqtie teuounqtei
teuounqeti teuounqeit teuountqie teuountqei teuountiqe teuountieq teuounteiq teuounteqi teuouneqti teuouneqit teuounetqi
teuounetiq teuouneitq teuouneiqt teuouinqte teuouinqet teuouintqe teuouinteq teuouinetq teuouineqt teuouiqnte teuouiqnet
teuouiqtne teuouiqten teuouiqetn teuouiqent teuouitqne teuouitqen teuouitnqe teuouitneq teuouitenq teuouiteqn teuouieqtn
teuouieqnt teuouietqn teuouietnq teuouientq teuouienqt teuouqinte teuouqinet teuouqitne teuouqiten teuouqietn teuouqient
teuouqnite teuouqniet teuouqntie teuouqntei teuouqneti teuouqneit teuouqtnie teuouqtnei teuouqtine teuouqtien teuouqtein
teuouqteni teuouqenti teuouqenit teuouqetni teuouqetin teuouqeitn teuouqeint teuoutiqne teuoutiqen teuoutinqe teuoutineq
teuoutienq teuoutieqn teuoutqine teuoutqien teuoutqnie teuoutqnei teuoutqeni teuoutqein teuoutnqie teuoutnqei teuoutniqe
teuoutnieq teuoutneiq teuoutneqi teuouteqni teuouteqin teuoutenqi teuouteniq teuouteinq teuouteiqn teuoueiqtn teuoueiqnt
teuoueitqn teuoueitnq teuoueintq teuoueinqt teuoueqitn teuoueqint teuoueqtin teuoueqtni teuoueqnti teuoueqnit teuouetqin
teuouetqni teuouetiqn teuouetinq teuouetniq teuouetnqi teuouenqti teuouenqit teuouentqi teuouentiq teuouenitq teuoueniqt
teuoeniqut teuoeniqtu teuoeniuqt teuoeniutq teuoenituq teuoenitqu teuoenqiut teuoenqitu teuoenquit teuoenquti teuoenqtui
teuoenqtiu teuoenuqit teuoenuqti teuoenuiqt teuoenuitq teuoenutiq teuoenutqi teuoentqui teuoentqiu teuoentuqi teuoentuiq
teuoentiuq teuoentiqu teuoeinqut teuoeinqtu teuoeinuqt teuoeinutq teuoeintuq teuoeintqu teuoeiqnut teuoeiqntu teuoeiqunt
teuoeiqutn teuoeiqtun teuoeiqtnu teuoeiuqnt teuoeiuqtn teuoeiunqt teuoeiuntq teuoeiutnq teuoeiutqn teuoeitqun teuoeitqnu
teuoeituqn teuoeitunq teuoeitnuq teuoeitnqu teuoeqinut teuoeqintu teuoeqiunt teuoeqiutn teuoeqitun teuoeqitnu teuoeqniut
teuoeqnitu teuoeqnuit teuoeqnuti teuoeqntui teuoeqntiu teuoequnit teuoequnti teuoequint teuoequitn teuoequtin teuoequtni
teuoeqtnui teuoeqtniu teuoeqtuni teuoeqtuin teuoeqtiun teuoeqtinu teuoeuiqnt teuoeuiqtn teuoeuinqt teuoeuintq teuoeuitnq
teuoeuitqn teuoeuqint teuoeuqitn teuoeuqnit teuoeuqnti teuoeuqtni teuoeuqtin teuoeunqit teuoeunqti teuoeuniqt teuoeunitq
teuoeuntiq teuoeuntqi teuoeutqni teuoeutqin teuoeutnqi teuoeutniq teuoeutinq teuoeutiqn teuoetiqun teuoetiqnu teuoetiuqn
teuoetiunq teuoetinuq teuoetinqu teuoetqiun teuoetqinu teuoetquin teuoetquni teuoetqnui teuoetqniu teuoetuqin teuoetuqni
teuoetuiqn teuoetuinq teuoetuniq teuoetunqi teuoetnqui teuoetnqiu teuoetnuqi teuoetnuiq teuoetniuq teuoetniqu teunotique
teunotiqeu teunotiuqe teunotiueq teunotieuq teunotiequ teunotqiue teunotqieu teunotquie teunotquei teunotqeui teunotqeiu
teunotuqie teunotuqei teunotuiqe teunotuieq teunotueiq teunotueqi teunotequi teunoteqiu teunoteuqi teunoteuiq teunoteiuq
teunoteiqu teunoitque teunoitqeu teunoituqe teunoitueq teunoiteuq teunoitequ teunoiqtue teunoiqteu teunoiqute teunoiquet
teunoiqeut teunoiqetu teunoiuqte teunoiuqet teunoiutqe teunoiuteq teunoiuetq teunoiueqt teunoiequt teunoieqtu teunoieuqt
teunoieutq teunoietuq teunoietqu teunoqitue teunoqiteu teunoqiute teunoqiuet teunoqieut teunoqietu teunoqtiue teunoqtieu
teunoqtuie teunoqtuei teunoqteui teunoqteiu teunoqutie teunoqutei teunoquite teunoquiet teunoqueit teunoqueti teunoqetui
teunoqetiu teunoqeuti teunoqeuit teunoqeiut teunoqeitu teunouiqte teunouiqet teunouitqe teunouiteq teunouietq teunouieqt
teunouqite teunouqiet teunouqtie teunouqtei teunouqeti teunouqeit teunoutqie teunoutqei teunoutiqe teunoutieq teunouteiq
teunouteqi teunoueqti teunoueqit teunouetqi teunouetiq teunoueitq teunoueiqt teunoeiqut teunoeiqtu teunoeiuqt teunoeiutq
teunoeituq teunoeitqu teunoeqiut teunoeqitu teunoequit teunoequti teunoeqtui teunoeqtiu teunoeuqit teunoeuqti teunoeuiqt
teunoeuitq teunoeutiq teunoeutqi teunoetqui teunoetqiu teunoetuqi teunoetuiq teunoetiuq teunoetiqu teuntoique teuntoiqeu
teuntoiuqe teuntoiueq teuntoieuq teuntoiequ teuntoqiue teuntoqieu teuntoquie teuntoquei teuntoqeui teuntoqeiu teuntouqie
teuntouqei teuntouiqe teuntouieq teuntoueiq teuntoueqi teuntoequi teuntoeqiu teuntoeuqi teuntoeuiq teuntoeiuq teuntoeiqu
teuntioque teuntioqeu teuntiouqe teuntioueq teuntioeuq teuntioequ teuntiqoue teuntiqoeu teuntiquoe teuntiqueo teuntiqeuo
teuntiqeou teuntiuqoe teuntiuqeo teuntiuoqe teuntiuoeq teuntiueoq teuntiueqo teuntiequo teuntieqou teuntieuqo teuntieuoq
teuntieouq teuntieoqu teuntqioue teuntqioeu teuntqiuoe teuntqiueo teuntqieuo teuntqieou teuntqoiue teuntqoieu teuntqouie
teuntqouei teuntqoeui teuntqoeiu teuntquoie teuntquoei teuntquioe teuntquieo teuntqueio teuntqueoi teuntqeoui teuntqeoiu
teuntqeuoi teuntqeuio teuntqeiuo teuntqeiou teuntuiqoe teuntuiqeo teuntuioqe teuntuioeq teuntuieoq teuntuieqo teuntuqioe
teuntuqieo teuntuqoie teuntuqoei teuntuqeoi teuntuqeio teuntuoqie teuntuoqei teuntuoiqe teuntuoieq teuntuoeiq teuntuoeqi
teuntueqoi teuntueqio teuntueoqi teuntueoiq teuntueioq teuntueiqo teunteiquo teunteiqou teunteiuqo teunteiuoq teunteiouq
teunteioqu teunteqiuo teunteqiou teuntequio teuntequoi teunteqoui teunteqoiu teunteuqio teunteuqoi teunteuiqo teunteuioq
teunteuoiq teunteuoqi teunteoqui teunteoqiu teunteouqi teunteouiq teunteoiuq teunteoiqu teunitoque teunitoqeu teunitouqe
teunitoueq teunitoeuq teunitoequ teunitqoue teunitqoeu teunitquoe teunitqueo teunitqeuo teunitqeou teunituqoe teunituqeo
teunituoqe teunituoeq teunitueoq teunitueqo teunitequo teuniteqou teuniteuqo teuniteuoq teuniteouq teuniteoqu teuniotque
teuniotqeu teuniotuqe teuniotueq teunioteuq teuniotequ teunioqtue teunioqteu teunioqute teunioquet teunioqeut teunioqetu
teuniouqte teuniouqet teunioutqe teuniouteq teuniouetq teunioueqt teunioequt teunioeqtu teunioeuqt teunioeutq teunioetuq
teunioetqu teuniqotue teuniqoteu teuniqoute teuniqouet teuniqoeut teuniqoetu teuniqtoue teuniqtoeu teuniqtuoe teuniqtueo
teuniqteuo teuniqteou teuniqutoe teuniquteo teuniquote teuniquoet teuniqueot teuniqueto teuniqetuo teuniqetou teuniqeuto
teuniqeuot teuniqeout teuniqeotu teuniuoqte teuniuoqet teuniuotqe teuniuoteq teuniuoetq teuniuoeqt teuniuqote teuniuqoet
teuniuqtoe teuniuqteo teuniuqeto teuniuqeot teuniutqoe teuniutqeo teuniutoqe teuniutoeq teuniuteoq teuniuteqo teuniueqto
teuniueqot teuniuetqo teuniuetoq teuniueotq teuniueoqt teunieoqut teunieoqtu teunieouqt teunieoutq teunieotuq teunieotqu
teunieqout teunieqotu teuniequot teuniequto teunieqtuo teunieqtou teunieuqot teunieuqto teunieuoqt teunieuotq teunieutoq
teunieutqo teunietquo teunietqou teunietuqo teunietuoq teunietouq teunietoqu teunqtioue teunqtioeu teunqtiuoe teunqtiueo
teunqtieuo teunqtieou teunqtoiue teunqtoieu teunqtouie teunqtouei teunqtoeui teunqtoeiu teunqtuoie teunqtuoei teunqtuioe
teunqtuieo teunqtueio teunqtueoi teunqteoui teunqteoiu teunqteuoi teunqteuio teunqteiuo teunqteiou teunqitoue teunqitoeu
teunqituoe teunqitueo teunqiteuo teunqiteou teunqiotue teunqioteu teunqioute teunqiouet teunqioeut teunqioetu teunqiuote
teunqiuoet teunqiutoe teunqiuteo teunqiueto teunqiueot teunqieout teunqieotu teunqieuot teunqieuto teunqietuo teunqietou
teunqoitue teunqoiteu teunqoiute teunqoiuet teunqoieut teunqoietu teunqotiue teunqotieu teunqotuie teunqotuei teunqoteui
teunqoteiu teunqoutie teunqoutei teunqouite teunqouiet teunqoueit teunqoueti teunqoetui teunqoetiu teunqoeuti teunqoeuit
teunqoeiut teunqoeitu teunquiote teunquioet teunquitoe teunquiteo teunquieto teunquieot teunquoite teunquoiet teunquotie
teunquotei teunquoeti teunquoeit teunqutoie teunqutoei teunqutioe teunqutieo teunquteio teunquteoi teunqueoti teunqueoit
teunquetoi teunquetio teunqueito teunqueiot teunqeiout teunqeiotu teunqeiuot teunqeiuto teunqeituo teunqeitou teunqeoiut
teunqeoitu teunqeouit teunqeouti teunqeotui teunqeotiu teunqeuoit teunqeuoti teunqeuiot teunqeuito teunqeutio teunqeutoi
teunqetoui teunqetoiu teunqetuoi teunqetuio teunqetiuo teunqetiou teunutiqoe teunutiqeo teunutioqe teunutioeq teunutieoq
teunutieqo teunutqioe teunutqieo teunutqoie teunutqoei teunutqeoi teunutqeio teunutoqie teunutoqei teunutoiqe teunutoieq
teunutoeiq teunutoeqi teunuteqoi teunuteqio teunuteoqi teunuteoiq teunuteioq teunuteiqo teunuitqoe teunuitqeo teunuitoqe
teunuitoeq teunuiteoq teunuiteqo teunuiqtoe teunuiqteo teunuiqote teunuiqoet teunuiqeot teunuiqeto teunuioqte teunuioqet
teunuiotqe teunuioteq teunuioetq teunuioeqt teunuieqot teunuieqto teunuieoqt teunuieotq teunuietoq teunuietqo teunuqitoe
teunuqiteo teunuqiote teunuqioet teunuqieot teunuqieto teunuqtioe teunuqtieo teunuqtoie teunuqtoei teunuqteoi teunuqteio
teunuqotie teunuqotei teunuqoite teunuqoiet teunuqoeit teunuqoeti teunuqetoi teunuqetio teunuqeoti teunuqeoit teunuqeiot
teunuqeito teunuoiqte teunuoiqet teunuoitqe teunuoiteq teunuoietq teunuoieqt teunuoqite teunuoqiet teunuoqtie teunuoqtei
teunuoqeti teunuoqeit teunuotqie teunuotqei teunuotiqe teunuotieq teunuoteiq teunuoteqi teunuoeqti teunuoeqit teunuoetqi
teunuoetiq teunuoeitq teunuoeiqt teunueiqot teunueiqto teunueioqt teunueiotq teunueitoq teunueitqo teunueqiot teunueqito
teunueqoit teunueqoti teunueqtoi teunueqtio teunueoqit teunueoqti teunueoiqt teunueoitq teunueotiq teunueotqi teunuetqoi
teunuetqio teunuetoqi teunuetoiq teunuetioq teunuetiqo teunetiquo teunetiqou teunetiuqo teunetiuoq teunetiouq teunetioqu
teunetqiuo teunetqiou teunetquio teunetquoi teunetqoui teunetqoiu teunetuqio teunetuqoi teunetuiqo teunetuioq teunetuoiq
teunetuoqi teunetoqui teunetoqiu teunetouqi teunetouiq teunetoiuq teunetoiqu teuneitquo teuneitqou teuneituqo teuneituoq
teuneitouq teuneitoqu teuneiqtuo teuneiqtou teuneiquto teuneiquot teuneiqout teuneiqotu teuneiuqto teuneiuqot teuneiutqo
teuneiutoq teuneiuotq teuneiuoqt teuneioqut teuneioqtu teuneiouqt teuneioutq teuneiotuq teuneiotqu teuneqituo teuneqitou
teuneqiuto teuneqiuot teuneqiout teuneqiotu teuneqtiuo teuneqtiou teuneqtuio teuneqtuoi teuneqtoui teuneqtoiu teunequtio
teunequtoi teunequito teunequiot teunequoit teunequoti teuneqotui teuneqotiu teuneqouti teuneqouit teuneqoiut teuneqoitu
teuneuiqto teuneuiqot teuneuitqo teuneuitoq teuneuiotq teuneuioqt teuneuqito teuneuqiot teuneuqtio teuneuqtoi teuneuqoti
teuneuqoit teuneutqio teuneutqoi teuneutiqo teuneutioq teuneutoiq teuneutoqi teuneuoqti teuneuoqit teuneuotqi teuneuotiq
teuneuoitq teuneuoiqt teuneoiqut teuneoiqtu teuneoiuqt teuneoiutq teuneoituq teuneoitqu teuneoqiut teuneoqitu teuneoquit
teuneoquti teuneoqtui teuneoqtiu teuneouqit teuneouqti teuneouiqt teuneouitq teuneoutiq teuneoutqi teuneotqui teuneotqiu
teuneotuqi teuneotuiq teuneotiuq teuneotiqu teuiontque teuiontqeu teuiontuqe teuiontueq teuionteuq teuiontequ teuionqtue
teuionqteu teuionqute teuionquet teuionqeut teuionqetu teuionuqte teuionuqet teuionutqe teuionuteq teuionuetq teuionueqt
teuionequt teuioneqtu teuioneuqt teuioneutq teuionetuq teuionetqu teuiotnque teuiotnqeu teuiotnuqe teuiotnueq teuiotneuq
teuiotnequ teuiotqnue teuiotqneu teuiotqune teuiotquen teuiotqeun teuiotqenu teuiotuqne teuiotuqen teuiotunqe teuiotuneq
teuiotuenq teuiotueqn teuiotequn teuioteqnu teuioteuqn teuioteunq teuiotenuq teuiotenqu teuioqtnue teuioqtneu teuioqtune
teuioqtuen teuioqteun teuioqtenu teuioqntue teuioqnteu teuioqnute teuioqnuet teuioqneut teuioqnetu teuioqunte teuioqunet
teuioqutne teuioquten teuioquetn teuioquent teuioqenut teuioqentu teuioqeunt teuioqeutn teuioqetun teuioqetnu teuioutqne
teuioutqen teuioutnqe teuioutneq teuioutenq teuiouteqn teuiouqtne teuiouqten teuiouqnte teuiouqnet teuiouqent teuiouqetn
teuiounqte teuiounqet teuiountqe teuiounteq teuiounetq teuiouneqt teuioueqnt teuioueqtn teuiouenqt teuiouentq teuiouetnq
teuiouetqn teuioetqun teuioetqnu teuioetuqn teuioetunq teuioetnuq teuioetnqu teuioeqtun teuioeqtnu teuioequtn teuioequnt
teuioeqnut teuioeqntu teuioeuqtn teuioeuqnt teuioeutqn teuioeutnq teuioeuntq teuioeunqt teuioenqut teuioenqtu teuioenuqt
teuioenutq teuioentuq teuioentqu teuinotque teuinotqeu teuinotuqe teuinotueq teuinoteuq teuinotequ teuinoqtue teuinoqteu
teuinoqute teuinoquet teuinoqeut teuinoqetu teuinouqte teuinouqet teuinoutqe teuinouteq teuinouetq teuinoueqt teuinoequt
teuinoeqtu teuinoeuqt teuinoeutq teuinoetuq teuinoetqu teuintoque teuintoqeu teuintouqe teuintoueq teuintoeuq teuintoequ
teuintqoue teuintqoeu teuintquoe teuintqueo teuintqeuo teuintqeou teuintuqoe teuintuqeo teuintuoqe teuintuoeq teuintueoq
teuintueqo teuintequo teuinteqou teuinteuqo teuinteuoq teuinteouq teuinteoqu teuinqtoue teuinqtoeu teuinqtuoe teuinqtueo
teuinqteuo teuinqteou teuinqotue teuinqoteu teuinqoute teuinqouet teuinqoeut teuinqoetu teuinquote teuinquoet teuinqutoe
teuinquteo teuinqueto teuinqueot teuinqeout teuinqeotu teuinqeuot teuinqeuto teuinqetuo teuinqetou teuinutqoe teuinutqeo
teuinutoqe teuinutoeq teuinuteoq teuinuteqo teuinuqtoe teuinuqteo teuinuqote teuinuqoet teuinuqeot teuinuqeto teuinuoqte
teuinuoqet teuinuotqe teuinuoteq teuinuoetq teuinuoeqt teuinueqot teuinueqto teuinueoqt teuinueotq teuinuetoq teuinuetqo
teuinetquo teuinetqou teuinetuqo teuinetuoq teuinetouq teuinetoqu teuineqtuo teuineqtou teuinequto teuinequot teuineqout
teuineqotu teuineuqto teuineuqot teuineutqo teuineutoq teuineuotq teuineuoqt teuineoqut teuineoqtu teuineouqt teuineoutq
teuineotuq teuineotqu teuitnoque teuitnoqeu teuitnouqe teuitnoueq teuitnoeuq teuitnoequ teuitnqoue teuitnqoeu teuitnquoe
teuitnqueo teuitnqeuo teuitnqeou teuitnuqoe teuitnuqeo teuitnuoqe teuitnuoeq teuitnueoq teuitnueqo teuitnequo teuitneqou
teuitneuqo teuitneuoq teuitneouq teuitneoqu teuitonque teuitonqeu teuitonuqe teuitonueq teuitoneuq teuitonequ teuitoqnue
teuitoqneu teuitoqune teuitoquen teuitoqeun teuitoqenu teuitouqne teuitouqen teuitounqe teuitouneq teuitouenq teuitoueqn
teuitoequn teuitoeqnu teuitoeuqn teuitoeunq teuitoenuq teuitoenqu teuitqonue teuitqoneu teuitqoune teuitqouen teuitqoeun
teuitqoenu teuitqnoue teuitqnoeu teuitqnuoe teuitqnueo teuitqneuo teuitqneou teuitqunoe teuitquneo teuitquone teuitquoen
teuitqueon teuitqueno teuitqenuo teuitqenou teuitqeuno teuitqeuon teuitqeoun teuitqeonu teuituoqne teuituoqen teuituonqe
teuituoneq teuituoenq teuituoeqn teuituqone teuituqoen teuituqnoe teuituqneo teuituqeno teuituqeon teuitunqoe teuitunqeo
teuitunoqe teuitunoeq teuituneoq teuituneqo teuitueqno teuitueqon teuituenqo teuituenoq teuitueonq teuitueoqn teuiteoqun
teuiteoqnu teuiteouqn teuiteounq teuiteonuq teuiteonqu teuiteqoun teuiteqonu teuitequon teuitequno teuiteqnuo teuiteqnou
teuiteuqon teuiteuqno teuiteuoqn teuiteuonq teuiteunoq teuiteunqo teuitenquo teuitenqou teuitenuqo teuitenuoq teuitenouq
teuitenoqu teuiqntoue teuiqntoeu teuiqntuoe teuiqntueo teuiqnteuo teuiqnteou teuiqnotue teuiqnoteu teuiqnoute teuiqnouet
teuiqnoeut teuiqnoetu teuiqnuote teuiqnuoet teuiqnutoe teuiqnuteo teuiqnueto teuiqnueot teuiqneout teuiqneotu teuiqneuot
teuiqneuto teuiqnetuo teuiqnetou teuiqtnoue teuiqtnoeu teuiqtnuoe teuiqtnueo teuiqtneuo teuiqtneou teuiqtonue teuiqtoneu
teuiqtoune teuiqtouen teuiqtoeun teuiqtoenu teuiqtuone teuiqtuoen teuiqtunoe teuiqtuneo teuiqtueno teuiqtueon teuiqteoun
teuiqteonu teuiqteuon teuiqteuno teuiqtenuo teuiqtenou teuiqotnue teuiqotneu teuiqotune teuiqotuen teuiqoteun teuiqotenu
teuiqontue teuiqonteu teuiqonute teuiqonuet teuiqoneut teuiqonetu teuiqounte teuiqounet teuiqoutne teuiqouten teuiqouetn
teuiqouent teuiqoenut teuiqoentu teuiqoeunt teuiqoeutn teuiqoetun teuiqoetnu teuiqutone teuiqutoen teuiqutnoe teuiqutneo
teuiquteno teuiquteon teuiquotne teuiquoten teuiquonte teuiquonet teuiquoent teuiquoetn teuiqunote teuiqunoet teuiquntoe
teuiqunteo teuiquneto teuiquneot teuiqueont teuiqueotn teuiquenot teuiquento teuiquetno teuiqueton teuiqetoun teuiqetonu
teuiqetuon teuiqetuno teuiqetnuo teuiqetnou teuiqeotun teuiqeotnu teuiqeoutn teuiqeount teuiqeonut teuiqeontu teuiqeuotn
teuiqeuont teuiqeuton teuiqeutno teuiqeunto teuiqeunot teuiqenout teuiqenotu teuiqenuot teuiqenuto teuiqentuo teuiqentou
teuiuntqoe teuiuntqeo teuiuntoqe teuiuntoeq teuiunteoq teuiunteqo teuiunqtoe teuiunqteo teuiunqote teuiunqoet teuiunqeot
teuiunqeto teuiunoqte teuiunoqet teuiunotqe teuiunoteq teuiunoetq teuiunoeqt teuiuneqot teuiuneqto teuiuneoqt teuiuneotq
teuiunetoq teuiunetqo teuiutnqoe teuiutnqeo teuiutnoqe teuiutnoeq teuiutneoq teuiutneqo teuiutqnoe teuiutqneo teuiutqone
teuiutqoen teuiutqeon teuiutqeno teuiutoqne teuiutoqen teuiutonqe teuiutoneq teuiutoenq teuiutoeqn teuiuteqon teuiuteqno
teuiuteoqn teuiuteonq teuiutenoq teuiutenqo teuiuqtnoe teuiuqtneo teuiuqtone teuiuqtoen teuiuqteon teuiuqteno teuiuqntoe
teuiuqnteo teuiuqnote teuiuqnoet teuiuqneot teuiuqneto teuiuqonte teuiuqonet teuiuqotne teuiuqoten teuiuqoetn teuiuqoent
teuiuqenot teuiuqento teuiuqeont teuiuqeotn teuiuqeton teuiuqetno teuiuotqne teuiuotqen teuiuotnqe teuiuotneq teuiuotenq
teuiuoteqn teuiuoqtne teuiuoqten teuiuoqnte teuiuoqnet teuiuoqent teuiuoqetn teuiuonqte teuiuonqet teuiuontqe teuiuonteq
teuiuonetq teuiuoneqt teuiuoeqnt teuiuoeqtn teuiuoenqt teuiuoentq teuiuoetnq teuiuoetqn teuiuetqon teuiuetqno teuiuetoqn
teuiuetonq teuiuetnoq teuiuetnqo teuiueqton teuiueqtno teuiueqotn teuiueqont teuiueqnot teuiueqnto teuiueoqtn teuiueoqnt
teuiueotqn teuiueotnq teuiueontq teuiueonqt teuiuenqot teuiuenqto teuiuenoqt teuiuenotq teuiuentoq teuiuentqo teuientquo
teuientqou teuientuqo teuientuoq teuientouq teuientoqu teuienqtuo teuienqtou teuienquto teuienquot teuienqout teuienqotu
teuienuqto teuienuqot teuienutqo teuienutoq teuienuotq teuienuoqt teuienoqut teuienoqtu teuienouqt teuienoutq teuienotuq
teuienotqu teuietnquo teuietnqou teuietnuqo teuietnuoq teuietnouq teuietnoqu teuietqnuo teuietqnou teuietquno teuietquon
teuietqoun teuietqonu teuietuqno teuietuqon teuietunqo teuietunoq teuietuonq teuietuoqn teuietoqun teuietoqnu teuietouqn
teuietounq teuietonuq teuietonqu teuieqtnuo teuieqtnou teuieqtuno teuieqtuon teuieqtoun teuieqtonu teuieqntuo teuieqntou
teuieqnuto teuieqnuot teuieqnout teuieqnotu teuiequnto teuiequnot teuiequtno teuiequton teuiequotn teuiequont teuieqonut
teuieqontu teuieqount teuieqoutn teuieqotun teuieqotnu teuieutqno teuieutqon teuieutnqo teuieutnoq teuieutonq teuieutoqn
teuieuqtno teuieuqton teuieuqnto teuieuqnot teuieuqont teuieuqotn teuieunqto teuieunqot teuieuntqo teuieuntoq teuieunotq
teuieunoqt teuieuoqnt teuieuoqtn teuieuonqt teuieuontq teuieuotnq teuieuotqn teuieotqun teuieotqnu teuieotuqn teuieotunq
teuieotnuq teuieotnqu teuieoqtun teuieoqtnu teuieoqutn teuieoqunt teuieoqnut teuieoqntu teuieouqtn teuieouqnt teuieoutqn
teuieoutnq teuieountq teuieounqt teuieonqut teuieonqtu teuieonuqt teuieonutq teuieontuq teuieontqu teuqonitue teuqoniteu
teuqoniute teuqoniuet teuqonieut teuqonietu teuqontiue teuqontieu teuqontuie teuqontuei teuqonteui teuqonteiu teuqonutie
teuqonutei teuqonuite teuqonuiet teuqonueit teuqonueti teuqonetui teuqonetiu teuqoneuti teuqoneuit teuqoneiut teuqoneitu
teuqointue teuqointeu teuqoinute teuqoinuet teuqoineut teuqoinetu teuqoitnue teuqoitneu teuqoitune teuqoituen teuqoiteun
teuqoitenu teuqoiutne teuqoiuten teuqoiunte teuqoiunet teuqoiuent teuqoiuetn teuqoietun teuqoietnu teuqoieutn teuqoieunt
teuqoienut teuqoientu teuqotinue teuqotineu teuqotiune teuqotiuen teuqotieun teuqotienu teuqotniue teuqotnieu teuqotnuie
teuqotnuei teuqotneui teuqotneiu teuqotunie teuqotunei teuqotuine teuqotuien teuqotuein teuqotueni teuqotenui teuqoteniu
teuqoteuni teuqoteuin teuqoteiun teuqoteinu teuqouitne teuqouiten teuqouinte teuqouinet teuqouient teuqouietn teuqoutine
teuqoutien teuqoutnie teuqoutnei teuqouteni teuqoutein teuqountie teuqountei teuqounite teuqouniet teuqouneit teuqouneti
teuqouetni teuqouetin teuqouenti teuqouenit teuqoueint teuqoueitn teuqoeitun teuqoeitnu teuqoeiutn teuqoeiunt teuqoeinut
teuqoeintu teuqoetiun teuqoetinu teuqoetuin teuqoetuni teuqoetnui teuqoetniu teuqoeutin teuqoeutni teuqoeuitn teuqoeuint
teuqoeunit teuqoeunti teuqoentui teuqoentiu teuqoenuti teuqoenuit teuqoeniut teuqoenitu teuqnoitue teuqnoiteu teuqnoiute
teuqnoiuet teuqnoieut teuqnoietu teuqnotiue teuqnotieu teuqnotuie teuqnotuei teuqnoteui teuqnoteiu teuqnoutie teuqnoutei
teuqnouite teuqnouiet teuqnoueit teuqnoueti teuqnoetui teuqnoetiu teuqnoeuti teuqnoeuit teuqnoeiut teuqnoeitu teuqniotue
teuqnioteu teuqnioute teuqniouet teuqnioeut teuqnioetu teuqnitoue teuqnitoeu teuqnituoe teuqnitueo teuqniteuo teuqniteou
teuqniutoe teuqniuteo teuqniuote teuqniuoet teuqniueot teuqniueto teuqnietuo teuqnietou teuqnieuto teuqnieuot teuqnieout
teuqnieotu teuqntioue teuqntioeu teuqntiuoe teuqntiueo teuqntieuo teuqntieou teuqntoiue teuqntoieu teuqntouie teuqntouei
teuqntoeui teuqntoeiu teuqntuoie teuqntuoei teuqntuioe teuqntuieo teuqntueio teuqntueoi teuqnteoui teuqnteoiu teuqnteuoi
teuqnteuio teuqnteiuo teuqnteiou teuqnuitoe teuqnuiteo teuqnuiote teuqnuioet teuqnuieot teuqnuieto teuqnutioe teuqnutieo
teuqnutoie teuqnutoei teuqnuteoi teuqnuteio teuqnuotie teuqnuotei teuqnuoite teuqnuoiet teuqnuoeit teuqnuoeti teuqnuetoi
teuqnuetio teuqnueoti teuqnueoit teuqnueiot teuqnueito teuqneituo teuqneitou teuqneiuto teuqneiuot teuqneiout teuqneiotu
teuqnetiuo teuqnetiou teuqnetuio teuqnetuoi teuqnetoui teuqnetoiu teuqneutio teuqneutoi teuqneuito teuqneuiot teuqneuoit
teuqneuoti teuqneotui teuqneotiu teuqneouti teuqneouit teuqneoiut teuqneoitu teuqinotue teuqinoteu teuqinoute teuqinouet
teuqinoeut teuqinoetu teuqintoue teuqintoeu teuqintuoe teuqintueo teuqinteuo teuqinteou teuqinutoe teuqinuteo teuqinuote
teuqinuoet teuqinueot teuqinueto teuqinetuo teuqinetou teuqineuto teuqineuot teuqineout teuqineotu teuqiontue teuqionteu
teuqionute teuqionuet teuqioneut teuqionetu teuqiotnue teuqiotneu teuqiotune teuqiotuen teuqioteun teuqiotenu teuqioutne
teuqiouten teuqiounte teuqiounet teuqiouent teuqiouetn teuqioetun teuqioetnu teuqioeutn teuqioeunt teuqioenut teuqioentu
teuqitonue teuqitoneu teuqitoune teuqitouen teuqitoeun teuqitoenu teuqitnoue teuqitnoeu teuqitnuoe teuqitnueo teuqitneuo
teuqitneou teuqitunoe teuqituneo teuqituone teuqituoen teuqitueon teuqitueno teuqitenuo teuqitenou teuqiteuno teuqiteuon
teuqiteoun teuqiteonu teuqiuotne teuqiuoten teuqiuonte teuqiuonet teuqiuoent teuqiuoetn teuqiutone teuqiutoen teuqiutnoe
teuqiutneo teuqiuteno teuqiuteon teuqiuntoe teuqiunteo teuqiunote teuqiunoet teuqiuneot teuqiuneto teuqiuetno teuqiueton
teuqiuento teuqiuenot teuqiueont teuqiueotn teuqieotun teuqieotnu teuqieoutn teuqieount teuqieonut teuqieontu teuqietoun
teuqietonu teuqietuon teuqietuno teuqietnuo teuqietnou teuqieuton teuqieutno teuqieuotn teuqieuont teuqieunot teuqieunto
teuqientuo teuqientou teuqienuto teuqienuot teuqienout teuqienotu teuqtnioue teuqtnioeu teuqtniuoe teuqtniueo teuqtnieuo
teuqtnieou teuqtnoiue teuqtnoieu teuqtnouie teuqtnouei teuqtnoeui teuqtnoeiu teuqtnuoie teuqtnuoei teuqtnuioe teuqtnuieo
teuqtnueio teuqtnueoi teuqtneoui teuqtneoiu teuqtneuoi teuqtneuio teuqtneiuo teuqtneiou teuqtinoue teuqtinoeu teuqtinuoe
teuqtinueo teuqtineuo teuqtineou teuqtionue teuqtioneu teuqtioune teuqtiouen teuqtioeun teuqtioenu teuqtiuone teuqtiuoen
teuqtiunoe teuqtiuneo teuqtiueno teuqtiueon teuqtieoun teuqtieonu teuqtieuon teuqtieuno teuqtienuo teuqtienou teuqtoinue
teuqtoineu teuqtoiune teuqtoiuen teuqtoieun teuqtoienu teuqtoniue teuqtonieu teuqtonuie teuqtonuei teuqtoneui teuqtoneiu
teuqtounie teuqtounei teuqtouine teuqtouien teuqtouein teuqtoueni teuqtoenui teuqtoeniu teuqtoeuni teuqtoeuin teuqtoeiun
teuqtoeinu teuqtuione teuqtuioen teuqtuinoe teuqtuineo teuqtuieno teuqtuieon teuqtuoine teuqtuoien teuqtuonie teuqtuonei
teuqtuoeni teuqtuoein teuqtunoie teuqtunoei teuqtunioe teuqtunieo teuqtuneio teuqtuneoi teuqtueoni teuqtueoin teuqtuenoi
teuqtuenio teuqtueino teuqtueion teuqteioun teuqteionu teuqteiuon teuqteiuno teuqteinuo teuqteinou teuqteoiun teuqteoinu
teuqteouin teuqteouni teuqteonui teuqteoniu teuqteuoin teuqteuoni teuqteuion teuqteuino teuqteunio teuqteunoi teuqtenoui
teuqtenoiu teuqtenuoi teuqtenuio teuqteniuo teuqteniou teuqunitoe teuquniteo teuquniote teuqunioet teuqunieot teuqunieto
teuquntioe teuquntieo teuquntoie teuquntoei teuqunteoi teuqunteio teuqunotie teuqunotei teuqunoite teuqunoiet teuqunoeit
teuqunoeti teuqunetoi teuqunetio teuquneoti teuquneoit teuquneiot teuquneito teuquintoe teuquinteo teuquinote teuquinoet
teuquineot teuquineto teuquitnoe teuquitneo teuquitone teuquitoen teuquiteon teuquiteno teuquiotne teuquioten teuquionte
teuquionet teuquioent teuquioetn teuquieton teuquietno teuquieotn teuquieont teuquienot teuquiento teuqutinoe teuqutineo
teuqutione teuqutioen teuqutieon teuqutieno teuqutnioe teuqutnieo teuqutnoie teuqutnoei teuqutneoi teuqutneio teuqutonie
teuqutonei teuqutoine teuqutoien teuqutoein teuqutoeni teuqutenoi teuqutenio teuquteoni teuquteoin teuquteion teuquteino
teuquoitne teuquoiten teuquointe teuquoinet teuquoient teuquoietn teuquotine teuquotien teuquotnie teuquotnei teuquoteni
teuquotein teuquontie teuquontei teuquonite teuquoniet teuquoneit teuquoneti teuquoetni teuquoetin teuquoenti teuquoenit
teuquoeint teuquoeitn teuqueiton teuqueitno teuqueiotn teuqueiont teuqueinot teuqueinto teuquetion teuquetino teuquetoin
teuquetoni teuquetnoi teuquetnio teuqueotin teuqueotni teuqueoitn teuqueoint teuqueonit teuqueonti teuquentoi teuquentio
teuquenoti teuquenoit teuqueniot teuquenito teuqenituo teuqenitou teuqeniuto teuqeniuot teuqeniout teuqeniotu teuqentiuo
teuqentiou teuqentuio teuqentuoi teuqentoui teuqentoiu teuqenutio teuqenutoi teuqenuito teuqenuiot teuqenuoit teuqenuoti
teuqenotui teuqenotiu teuqenouti teuqenouit teuqenoiut teuqenoitu teuqeintuo teuqeintou teuqeinuto teuqeinuot teuqeinout
teuqeinotu teuqeitnuo teuqeitnou teuqeituno teuqeituon teuqeitoun teuqeitonu teuqeiutno teuqeiuton teuqeiunto teuqeiunot
teuqeiuont teuqeiuotn teuqeiotun teuqeiotnu teuqeioutn teuqeiount teuqeionut teuqeiontu teuqetinuo teuqetinou teuqetiuno
teuqetiuon teuqetioun teuqetionu teuqetniuo teuqetniou teuqetnuio teuqetnuoi teuqetnoui teuqetnoiu teuqetunio teuqetunoi
teuqetuino teuqetuion teuqetuoin teuqetuoni teuqetonui teuqetoniu teuqetouni teuqetouin teuqetoiun teuqetoinu teuqeuitno
teuqeuiton teuqeuinto teuqeuinot teuqeuiont teuqeuiotn teuqeutino teuqeution teuqeutnio teuqeutnoi teuqeutoni teuqeutoin
teuqeuntio teuqeuntoi teuqeunito teuqeuniot teuqeunoit teuqeunoti teuqeuotni teuqeuotin teuqeuonti teuqeuonit teuqeuoint
teuqeuoitn teuqeoitun teuqeoitnu teuqeoiutn teuqeoiunt teuqeoinut teuqeointu teuqeotiun teuqeotinu teuqeotuin teuqeotuni
teuqeotnui teuqeotniu teuqeoutin teuqeoutni teuqeouitn teuqeouint teuqeounit teuqeounti teuqeontui teuqeontiu teuqeonuti
teuqeonuit teuqeoniut teuqeonitu teuuoniqte teuuoniqet teuuonitqe teuuoniteq teuuonietq teuuonieqt teuuonqite teuuonqiet
teuuonqtie teuuonqtei teuuonqeti teuuonqeit teuuontqie teuuontqei teuuontiqe teuuontieq teuuonteiq teuuonteqi teuuoneqti
teuuoneqit teuuonetqi teuuonetiq teuuoneitq teuuoneiqt teuuoinqte teuuoinqet teuuointqe teuuointeq teuuoinetq teuuoineqt
teuuoiqnte teuuoiqnet teuuoiqtne teuuoiqten teuuoiqetn teuuoiqent teuuoitqne teuuoitqen teuuoitnqe teuuoitneq teuuoitenq
teuuoiteqn teuuoieqtn teuuoieqnt teuuoietqn teuuoietnq teuuoientq teuuoienqt teuuoqinte teuuoqinet teuuoqitne teuuoqiten
teuuoqietn teuuoqient teuuoqnite teuuoqniet teuuoqntie teuuoqntei teuuoqneti teuuoqneit teuuoqtnie teuuoqtnei teuuoqtine
teuuoqtien teuuoqtein teuuoqteni teuuoqenti teuuoqenit teuuoqetni teuuoqetin teuuoqeitn teuuoqeint teuuotiqne teuuotiqen
teuuotinqe teuuotineq teuuotienq teuuotieqn teuuotqine teuuotqien teuuotqnie teuuotqnei teuuotqeni teuuotqein teuuotnqie
teuuotnqei teuuotniqe teuuotnieq teuuotneiq teuuotneqi teuuoteqni teuuoteqin teuuotenqi teuuoteniq teuuoteinq teuuoteiqn
teuuoeiqtn teuuoeiqnt teuuoeitqn teuuoeitnq teuuoeintq teuuoeinqt teuuoeqitn teuuoeqint teuuoeqtin teuuoeqtni teuuoeqnti
teuuoeqnit teuuoetqin teuuoetqni teuuoetiqn teuuoetinq teuuoetniq teuuoetnqi teuuoenqti teuuoenqit teuuoentqi teuuoentiq
teuuoenitq teuuoeniqt teuunoiqte teuunoiqet teuunoitqe teuunoiteq teuunoietq teuunoieqt teuunoqite teuunoqiet teuunoqtie
teuunoqtei teuunoqeti teuunoqeit teuunotqie teuunotqei teuunotiqe teuunotieq teuunoteiq teuunoteqi teuunoeqti teuunoeqit
teuunoetqi teuunoetiq teuunoeitq teuunoeiqt teuunioqte teuunioqet teuuniotqe teuunioteq teuunioetq teuunioeqt teuuniqote
teuuniqoet teuuniqtoe teuuniqteo teuuniqeto teuuniqeot teuunitqoe teuunitqeo teuunitoqe teuunitoeq teuuniteoq teuuniteqo
teuunieqto teuunieqot teuunietqo teuunietoq teuunieotq teuunieoqt teuunqiote teuunqioet teuunqitoe teuunqiteo teuunqieto
teuunqieot teuunqoite teuunqoiet teuunqotie teuunqotei teuunqoeti teuunqoeit teuunqtoie teuunqtoei teuunqtioe teuunqtieo
teuunqteio teuunqteoi teuunqeoti teuunqeoit teuunqetoi teuunqetio teuunqeito teuunqeiot teuuntiqoe teuuntiqeo teuuntioqe
teuuntioeq teuuntieoq teuuntieqo teuuntqioe teuuntqieo teuuntqoie teuuntqoei teuuntqeoi teuuntqeio teuuntoqie teuuntoqei
teuuntoiqe teuuntoieq teuuntoeiq teuuntoeqi teuunteqoi teuunteqio teuunteoqi teuunteoiq teuunteioq teuunteiqo teuuneiqto
teuuneiqot teuuneitqo teuuneitoq teuuneiotq teuuneioqt teuuneqito teuuneqiot teuuneqtio teuuneqtoi teuuneqoti teuuneqoit
teuunetqio teuunetqoi teuunetiqo teuunetioq teuunetoiq teuunetoqi teuuneoqti teuuneoqit teuuneotqi teuuneotiq teuuneoitq
teuuneoiqt teuuinoqte teuuinoqet teuuinotqe teuuinoteq teuuinoetq teuuinoeqt teuuinqote teuuinqoet teuuinqtoe teuuinqteo
teuuinqeto teuuinqeot teuuintqoe teuuintqeo teuuintoqe teuuintoeq teuuinteoq teuuinteqo teuuineqto teuuineqot teuuinetqo
teuuinetoq teuuineotq teuuineoqt teuuionqte teuuionqet teuuiontqe teuuionteq teuuionetq teuuioneqt teuuioqnte teuuioqnet
teuuioqtne teuuioqten teuuioqetn teuuioqent teuuiotqne teuuiotqen teuuiotnqe teuuiotneq teuuiotenq teuuioteqn teuuioeqtn
teuuioeqnt teuuioetqn teuuioetnq teuuioentq teuuioenqt teuuiqonte teuuiqonet teuuiqotne teuuiqoten teuuiqoetn teuuiqoent
teuuiqnote teuuiqnoet teuuiqntoe teuuiqnteo teuuiqneto teuuiqneot teuuiqtnoe teuuiqtneo teuuiqtone teuuiqtoen teuuiqteon
teuuiqteno teuuiqento teuuiqenot teuuiqetno teuuiqeton teuuiqeotn teuuiqeont teuuitoqne teuuitoqen teuuitonqe teuuitoneq
teuuitoenq teuuitoeqn teuuitqone teuuitqoen teuuitqnoe teuuitqneo teuuitqeno teuuitqeon teuuitnqoe teuuitnqeo teuuitnoqe
teuuitnoeq teuuitneoq teuuitneqo teuuiteqno teuuiteqon teuuitenqo teuuitenoq teuuiteonq teuuiteoqn teuuieoqtn teuuieoqnt
teuuieotqn teuuieotnq teuuieontq teuuieonqt teuuieqotn teuuieqont teuuieqton teuuieqtno teuuieqnto teuuieqnot teuuietqon
teuuietqno teuuietoqn teuuietonq teuuietnoq teuuietnqo teuuienqto teuuienqot teuuientqo teuuientoq teuuienotq teuuienoqt
teuuqniote teuuqnioet teuuqnitoe teuuqniteo teuuqnieto teuuqnieot teuuqnoite teuuqnoiet teuuqnotie teuuqnotei teuuqnoeti
teuuqnoeit teuuqntoie teuuqntoei teuuqntioe teuuqntieo teuuqnteio teuuqnteoi teuuqneoti teuuqneoit teuuqnetoi teuuqnetio
teuuqneito teuuqneiot teuuqinote teuuqinoet teuuqintoe teuuqinteo teuuqineto teuuqineot teuuqionte teuuqionet teuuqiotne
teuuqioten teuuqioetn teuuqioent teuuqitone teuuqitoen teuuqitnoe teuuqitneo teuuqiteno teuuqiteon teuuqieotn teuuqieont
teuuqieton teuuqietno teuuqiento teuuqienot teuuqointe teuuqoinet teuuqoitne teuuqoiten teuuqoietn teuuqoient teuuqonite
teuuqoniet teuuqontie teuuqontei teuuqoneti teuuqoneit teuuqotnie teuuqotnei teuuqotine teuuqotien teuuqotein teuuqoteni
teuuqoenti teuuqoenit teuuqoetni teuuqoetin teuuqoeitn teuuqoeint teuuqtione teuuqtioen teuuqtinoe teuuqtineo teuuqtieno
teuuqtieon teuuqtoine teuuqtoien teuuqtonie teuuqtonei teuuqtoeni teuuqtoein teuuqtnoie teuuqtnoei teuuqtnioe teuuqtnieo
teuuqtneio teuuqtneoi teuuqteoni teuuqteoin teuuqtenoi teuuqtenio teuuqteino teuuqteion teuuqeiotn teuuqeiont teuuqeiton
teuuqeitno teuuqeinto teuuqeinot teuuqeoitn teuuqeoint teuuqeotin teuuqeotni teuuqeonti teuuqeonit teuuqetoin teuuqetoni
teuuqetion teuuqetino teuuqetnio teuuqetnoi teuuqenoti teuuqenoit teuuqentoi teuuqentio teuuqenito teuuqeniot teuutniqoe
teuutniqeo teuutnioqe teuutnioeq teuutnieoq teuutnieqo teuutnqioe teuutnqieo teuutnqoie teuutnqoei teuutnqeoi teuutnqeio
teuutnoqie teuutnoqei teuutnoiqe teuutnoieq teuutnoeiq teuutnoeqi teuutneqoi teuutneqio teuutneoqi teuutneoiq teuutneioq
teuutneiqo teuutinqoe teuutinqeo teuutinoqe teuutinoeq teuutineoq teuutineqo teuutiqnoe teuutiqneo teuutiqone teuutiqoen
teuutiqeon teuutiqeno teuutioqne teuutioqen teuutionqe teuutioneq teuutioenq teuutioeqn teuutieqon teuutieqno teuutieoqn
teuutieonq teuutienoq teuutienqo teuutqinoe teuutqineo teuutqione teuutqioen teuutqieon teuutqieno teuutqnioe teuutqnieo
teuutqnoie teuutqnoei teuutqneoi teuutqneio teuutqonie teuutqonei teuutqoine teuutqoien teuutqoein teuutqoeni teuutqenoi
teuutqenio teuutqeoni teuutqeoin teuutqeion teuutqeino teuutoiqne teuutoiqen teuutoinqe teuutoineq teuutoienq teuutoieqn
teuutoqine teuutoqien teuutoqnie teuutoqnei teuutoqeni teuutoqein teuutonqie teuutonqei teuutoniqe teuutonieq teuutoneiq
teuutoneqi teuutoeqni teuutoeqin teuutoenqi teuutoeniq teuutoeinq teuutoeiqn teuuteiqon teuuteiqno teuuteioqn teuuteionq
teuuteinoq teuuteinqo teuuteqion teuuteqino teuuteqoin teuuteqoni teuuteqnoi teuuteqnio teuuteoqin teuuteoqni teuuteoiqn
teuuteoinq teuuteoniq teuuteonqi teuutenqoi teuutenqio teuutenoqi teuutenoiq teuutenioq teuuteniqo teuueniqto teuueniqot
teuuenitqo teuuenitoq teuueniotq teuuenioqt teuuenqito teuuenqiot teuuenqtio teuuenqtoi teuuenqoti teuuenqoit teuuentqio
teuuentqoi teuuentiqo teuuentioq teuuentoiq teuuentoqi teuuenoqti teuuenoqit teuuenotqi teuuenotiq teuuenoitq teuuenoiqt
teuueinqto teuueinqot teuueintqo teuueintoq teuueinotq teuueinoqt teuueiqnto teuueiqnot teuueiqtno teuueiqton teuueiqotn
teuueiqont teuueitqno teuueitqon teuueitnqo teuueitnoq teuueitonq teuueitoqn teuueioqtn teuueioqnt teuueiotqn teuueiotnq
teuueiontq teuueionqt teuueqinto teuueqinot teuueqitno teuueqiton teuueqiotn teuueqiont teuueqnito teuueqniot teuueqntio
teuueqntoi teuueqnoti teuueqnoit teuueqtnio teuueqtnoi teuueqtino teuueqtion teuueqtoin teuueqtoni teuueqonti teuueqonit
teuueqotni teuueqotin teuueqoitn teuueqoint teuuetiqno teuuetiqon teuuetinqo teuuetinoq teuuetionq teuuetioqn teuuetqino
teuuetqion teuuetqnio teuuetqnoi teuuetqoni teuuetqoin teuuetnqio teuuetnqoi teuuetniqo teuuetnioq teuuetnoiq teuuetnoqi
teuuetoqni teuuetoqin teuuetonqi teuuetoniq teuuetoinq teuuetoiqn teuueoiqtn teuueoiqnt teuueoitqn teuueoitnq teuueointq
teuueoinqt teuueoqitn teuueoqint teuueoqtin teuueoqtni teuueoqnti teuueoqnit teuueotqin teuueotqni teuueotiqn teuueotinq
teuueotniq teuueotnqi teuueonqti teuueonqit teuueontqi teuueontiq teuueonitq teuueoniqt teueoniqut teueoniqtu teueoniuqt
teueoniutq teueonituq teueonitqu teueonqiut teueonqitu teueonquit teueonquti teueonqtui teueonqtiu teueonuqit teueonuqti
teueonuiqt teueonuitq teueonutiq teueonutqi teueontqui teueontqiu teueontuqi teueontuiq teueontiuq teueontiqu teueoinqut
teueoinqtu teueoinuqt teueoinutq teueointuq teueointqu teueoiqnut teueoiqntu teueoiqunt teueoiqutn teueoiqtun teueoiqtnu
teueoiuqnt teueoiuqtn teueoiunqt teueoiuntq teueoiutnq teueoiutqn teueoitqun teueoitqnu teueoituqn teueoitunq teueoitnuq
teueoitnqu teueoqinut teueoqintu teueoqiunt teueoqiutn teueoqitun teueoqitnu teueoqniut teueoqnitu teueoqnuit teueoqnuti
teueoqntui teueoqntiu teueoqunit teueoqunti teueoquint teueoquitn teueoqutin teueoqutni teueoqtnui teueoqtniu teueoqtuni
teueoqtuin teueoqtiun teueoqtinu teueouiqnt teueouiqtn teueouinqt teueouintq teueouitnq teueouitqn teueouqint teueouqitn
teueouqnit teueouqnti teueouqtni teueouqtin teueounqit teueounqti teueouniqt teueounitq teueountiq teueountqi teueoutqni
teueoutqin teueoutnqi teueoutniq teueoutinq teueoutiqn teueotiqun teueotiqnu teueotiuqn teueotiunq teueotinuq teueotinqu
teueotqiun teueotqinu teueotquin teueotquni teueotqnui teueotqniu teueotuqin teueotuqni teueotuiqn teueotuinq teueotuniq
teueotunqi teueotnqui teueotnqiu teueotnuqi teueotnuiq teueotniuq teueotniqu teuenoiqut teuenoiqtu teuenoiuqt teuenoiutq
teuenoituq teuenoitqu teuenoqiut teuenoqitu teuenoquit teuenoquti teuenoqtui teuenoqtiu teuenouqit teuenouqti teuenouiqt
teuenouitq teuenoutiq teuenoutqi teuenotqui teuenotqiu teuenotuqi teuenotuiq teuenotiuq teuenotiqu teuenioqut teuenioqtu
teueniouqt teuenioutq teueniotuq teueniotqu teueniqout teueniqotu teueniquot teueniquto teueniqtuo teueniqtou teueniuqot
teueniuqto teueniuoqt teueniuotq teueniutoq teueniutqo teuenitquo teuenitqou teuenituqo teuenituoq teuenitouq teuenitoqu
teuenqiout teuenqiotu teuenqiuot teuenqiuto teuenqituo teuenqitou teuenqoiut teuenqoitu teuenqouit teuenqouti teuenqotui
teuenqotiu teuenquoit teuenquoti teuenquiot teuenquito teuenqutio teuenqutoi teuenqtoui teuenqtoiu teuenqtuoi teuenqtuio
teuenqtiuo teuenqtiou teuenuiqot teuenuiqto teuenuioqt teuenuiotq teuenuitoq teuenuitqo teuenuqiot teuenuqito teuenuqoit
teuenuqoti teuenuqtoi teuenuqtio teuenuoqit teuenuoqti teuenuoiqt teuenuoitq teuenuotiq teuenuotqi teuenutqoi teuenutqio
teuenutoqi teuenutoiq teuenutioq teuenutiqo teuentiquo teuentiqou teuentiuqo teuentiuoq teuentiouq teuentioqu teuentqiuo
teuentqiou teuentquio teuentquoi teuentqoui teuentqoiu teuentuqio teuentuqoi teuentuiqo teuentuioq teuentuoiq teuentuoqi
teuentoqui teuentoqiu teuentouqi teuentouiq teuentoiuq teuentoiqu teueinoqut teueinoqtu teueinouqt teueinoutq teueinotuq
teueinotqu teueinqout teueinqotu teueinquot teueinquto teueinqtuo teueinqtou teueinuqot teueinuqto teueinuoqt teueinuotq
teueinutoq teueinutqo teueintquo teueintqou teueintuqo teueintuoq teueintouq teueintoqu teueionqut teueionqtu teueionuqt
teueionutq teueiontuq teueiontqu teueioqnut teueioqntu teueioqunt teueioqutn teueioqtun teueioqtnu teueiouqnt teueiouqtn
teueiounqt teueiountq teueioutnq teueioutqn teueiotqun teueiotqnu teueiotuqn teueiotunq teueiotnuq teueiotnqu teueiqonut
teueiqontu teueiqount teueiqoutn teueiqotun teueiqotnu teueiqnout teueiqnotu teueiqnuot teueiqnuto teueiqntuo teueiqntou
teueiqunot teueiqunto teueiquont teueiquotn teueiquton teueiqutno teueiqtnuo teueiqtnou teueiqtuno teueiqtuon teueiqtoun
teueiqtonu teueiuoqnt teueiuoqtn teueiuonqt teueiuontq teueiuotnq teueiuotqn teueiuqont teueiuqotn teueiuqnot teueiuqnto
teueiuqtno teueiuqton teueiunqot teueiunqto teueiunoqt teueiunotq teueiuntoq teueiuntqo teueiutqno teueiutqon teueiutnqo
teueiutnoq teueiutonq teueiutoqn teueitoqun teueitoqnu teueitouqn teueitounq teueitonuq teueitonqu teueitqoun teueitqonu
teueitquon teueitquno teueitqnuo teueitqnou teueituqon teueituqno teueituoqn teueituonq teueitunoq teueitunqo teueitnquo
teueitnqou teueitnuqo teueitnuoq teueitnouq teueitnoqu teueqniout teueqniotu teueqniuot teueqniuto teueqnituo teueqnitou
teueqnoiut teueqnoitu teueqnouit teueqnouti teueqnotui teueqnotiu teueqnuoit teueqnuoti teueqnuiot teueqnuito teueqnutio
teueqnutoi teueqntoui teueqntoiu teueqntuoi teueqntuio teueqntiuo teueqntiou teueqinout teueqinotu teueqinuot teueqinuto
teueqintuo teueqintou teueqionut teueqiontu teueqiount teueqioutn teueqiotun teueqiotnu teueqiuont teueqiuotn teueqiunot
teueqiunto teueqiutno teueqiuton teueqitoun teueqitonu teueqituon teueqituno teueqitnuo teueqitnou teueqoinut teueqointu
teueqoiunt teueqoiutn teueqoitun teueqoitnu teueqoniut teueqonitu teueqonuit teueqonuti teueqontui teueqontiu teueqounit
teueqounti teueqouint teueqouitn teueqoutin teueqoutni teueqotnui teueqotniu teueqotuni teueqotuin teueqotiun teueqotinu
teuequiont teuequiotn teuequinot teuequinto teuequitno teuequiton teuequoint teuequoitn teuequonit teuequonti teuequotni
teuequotin teuequnoit teuequnoti teuequniot teuequnito teuequntio teuequntoi teuequtoni teuequtoin teuequtnoi teuequtnio
teuequtino teueqution teueqtioun teueqtionu teueqtiuon teueqtiuno teueqtinuo teueqtinou teueqtoiun teueqtoinu teueqtouin
teueqtouni teueqtonui teueqtoniu teueqtuoin teueqtuoni teueqtuion teueqtuino teueqtunio teueqtunoi teueqtnoui teueqtnoiu
teueqtnuoi teueqtnuio teueqtniuo teueqtniou teueuniqot teueuniqto teueunioqt teueuniotq teueunitoq teueunitqo teueunqiot
teueunqito teueunqoit teueunqoti teueunqtoi teueunqtio teueunoqit teueunoqti teueunoiqt teueunoitq teueunotiq teueunotqi
teueuntqoi teueuntqio teueuntoqi teueuntoiq teueuntioq teueuntiqo teueuinqot teueuinqto teueuinoqt teueuinotq teueuintoq
teueuintqo teueuiqnot teueuiqnto teueuiqont teueuiqotn teueuiqton teueuiqtno teueuioqnt teueuioqtn teueuionqt teueuiontq
teueuiotnq teueuiotqn teueuitqon teueuitqno teueuitoqn teueuitonq teueuitnoq teueuitnqo teueuqinot teueuqinto teueuqiont
teueuqiotn teueuqiton teueuqitno teueuqniot teueuqnito teueuqnoit teueuqnoti teueuqntoi teueuqntio teueuqonit teueuqonti
teueuqoint teueuqoitn teueuqotin teueuqotni teueuqtnoi teueuqtnio teueuqtoni teueuqtoin teueuqtion teueuqtino teueuoiqnt
teueuoiqtn teueuoinqt teueuointq teueuoitnq teueuoitqn teueuoqint teueuoqitn teueuoqnit teueuoqnti teueuoqtni teueuoqtin
teueuonqit teueuonqti teueuoniqt teueuonitq teueuontiq teueuontqi teueuotqni teueuotqin teueuotnqi teueuotniq teueuotinq
teueuotiqn teueutiqon teueutiqno teueutioqn teueutionq teueutinoq teueutinqo teueutqion teueutqino teueutqoin teueutqoni
teueutqnoi teueutqnio teueutoqin teueutoqni teueutoiqn teueutoinq teueutoniq teueutonqi teueutnqoi teueutnqio teueutnoqi
teueutnoiq teueutnioq teueutniqo teuetniquo teuetniqou teuetniuqo teuetniuoq teuetniouq teuetnioqu teuetnqiuo teuetnqiou
teuetnquio teuetnquoi teuetnqoui teuetnqoiu teuetnuqio teuetnuqoi teuetnuiqo teuetnuioq teuetnuoiq teuetnuoqi teuetnoqui
teuetnoqiu teuetnouqi teuetnouiq teuetnoiuq teuetnoiqu teuetinquo teuetinqou teuetinuqo teuetinuoq teuetinouq teuetinoqu
teuetiqnuo teuetiqnou teuetiquno teuetiquon teuetiqoun teuetiqonu teuetiuqno teuetiuqon teuetiunqo teuetiunoq teuetiuonq
teuetiuoqn teuetioqun teuetioqnu teuetiouqn teuetiounq teuetionuq teuetionqu teuetqinuo teuetqinou teuetqiuno teuetqiuon
teuetqioun teuetqionu teuetqniuo teuetqniou teuetqnuio teuetqnuoi teuetqnoui teuetqnoiu teuetqunio teuetqunoi teuetquino
teuetquion teuetquoin teuetquoni teuetqonui teuetqoniu teuetqouni teuetqouin teuetqoiun teuetqoinu teuetuiqno teuetuiqon
teuetuinqo teuetuinoq teuetuionq teuetuioqn teuetuqino teuetuqion teuetuqnio teuetuqnoi teuetuqoni teuetuqoin teuetunqio
teuetunqoi teuetuniqo teuetunioq teuetunoiq teuetunoqi teuetuoqni teuetuoqin teuetuonqi teuetuoniq teuetuoinq teuetuoiqn
teuetoiqun teuetoiqnu teuetoiuqn teuetoiunq teuetoinuq teuetoinqu teuetoqiun teuetoqinu teuetoquin teuetoquni teuetoqnui
teuetoqniu teuetouqin teuetouqni teuetouiqn teuetouinq teuetouniq teuetounqi teuetonqui teuetonqiu teuetonuqi teuetonuiq
teuetoniuq teuetoniqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us