easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

rimabaris

inhiansque

exoascales

scops

lagerquist

kootcha

anthriscus

fanaticism

retiring

libation

looper

uictore

bruckner

leucopoietic

radiotelegraphic

muscari

terminolog

beefwood


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: teethe
cipher variations:
uffuif vggvjg whhwkh xiixli yjjymj
zkkznk allaol bmmbpm cnncqn doodro
eppesp fqqftq grrgur hsshvs ittiwt
juujxu kvvkyv lwwlzw mxxmax nyynby
ozzocz paapda qbbqeb rccrfc sddsgd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: teethe
Cipher: gvvgsv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: teethe
Cipher: BAABA AABAA AABAA BAABA AABBB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: teethe
cipher variations:
uffuifgnngwnsvvskveddeydqllqmlcttcatajjacjmrrmqr
yzzyezkhhkshwppwgpixxiuxvggvjghoohxotwwtlwfeefze
rmmrnmduudbubkkbdknssnrszaazfaliiltixqqxhqjyyjvy
whhwkhippiypuxxumxgffgafsnnsonevvecvcllcelottost
abbagbmjjmujyrryirkzzkwzxiixlijqqjzqvyyvnyhgghbg
tootpofwwfdwdmmdfmpuuptubccbhcnkknvkzsszjslaalxa
yjjymjkrrkarwzzwozihhichuppuqpgxxgexennegnqvvquv
cddcidollowlattaktmbbmybzkkznklsslbsxaaxpajiijdi
vqqvrqhyyhfyfoofhorwwrvwdeedjepmmpxmbuublunccnzc
allaolmttmctybbyqbkjjkejwrrwsrizzigzgppgipsxxswx
effekfqnnqyncvvcmvoddoadbmmbpmnuunduzcczrclkklfk
xssxtsjaajhahqqhjqtyytxyfggflgroorzodwwdnwpeepbe
cnncqnovvoevaddasdmllmglyttyutkbbkibirrikruzzuyz
ghhgmhsppsapexxeoxqffqcfdoodropwwpfwbeebtenmmnhm
zuuzvulccljcjssjlsvaavzahiihnitqqtbqfyyfpyrggrdg
eppespqxxqgxcffcufonnoinavvawvmddmkdkttkmtwbbwab
ijjiojurrucrgzzgqzshhsehfqqftqryyrhydggdvgpoopjo
bwwbxwneenleluulnuxccxbcjkkjpkvssvdshaahratiitfi
grrgurszzsizehhewhqppqkpcxxcyxoffomfmvvmovyddycd
kllkqlwttwetibbisbujjugjhsshvstaatjafiifxirqqrlq
dyydzypggpngnwwnpwzeezdelmmlrmxuuxfujccjtcvkkvhk
ittiwtubbukbgjjgyjsrrsmrezzeazqhhqohoxxoqxaffaef
mnnmsnyvvygvkddkudwllwiljuujxuvccvlchkkhzktsstns
faafbariirpipyyprybggbfgnoontozwwzhwleelvexmmxjm
kvvkyvwddwmdillialuttuotgbbgcbsjjsqjqzzqszchhcgh
oppoupaxxaixmffmwfynnyknlwwlzwxeexnejmmjbmvuuvpu
hcchdctkktrkraartadiidhipqqpvqbyybjynggnxgzoozlo
mxxmaxyffyofknnkcnwvvwqviddiedulluslsbbsubejjeij
qrrqwrczzckzohhoyhappampnyynbyzggzpglooldoxwwxrw
jeejfevmmvtmtcctvcfkkfjkrssrxsdaadlapiipzibqqbnq
ozzoczahhaqhmppmepyxxysxkffkgfwnnwunudduwdgllgkl
sttsytebbembqjjqajcrrcorpaapdabiibrinqqnfqzyyzty
lgglhgxooxvoveevxehmmhlmtuutzufccfncrkkrbkdssdps
qbbqebcjjcsjorrograzzauzmhhmihyppywpwffwyfinnimn
uvvuavgddgodsllscletteqtrccrfcdkkdtkpssphsbaabva
niinjizqqzxqxggxzgjoojnovwwvbwheehpetmmtdmfuufru
sddsgdelleulqttqitcbbcwbojjokjarrayryhhyahkppkop
wxxwcxiffiqfunnuengvvgsvteethefmmfvmruurjudccdxc
pkkplkbssbzsziizbilqqlpqxyyxdyjggjrgvoovfohwwhtw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: teethe
Cipher: grrgur

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: teethe
Cipher: 445151443251

Extended Methods:
Method #1

Plaintext: teethe
method variations:
ykkynkdppdspiuuixuozzocz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
t e e t h e 
4 5 5 4 3 5 
4 1 1 4 2 1 
They are then read out in rows:
455435411421
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: teethe
Cipher: yuxdqb

Read more ...
Method #3

Plaintext: teethe
method variations:
yvqowq vqowqy qowqyv
owqyvq wqyvqo qyvqow

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: teethe

all 720 cipher variations:
teethe teeteh teehte teehet teeeht teeeth tetehe teteeh tethee tethee tetehe
teteeh tehtee tehtee tehete teheet teheet tehete teethe teeteh teehte teehet
teeeht teeeth teethe teeteh teehte teehet teeeht teeeth tetehe teteeh tethee
tethee tetehe teteeh tehtee tehtee tehete teheet teheet tehete teethe teeteh
teehte teehet teeeht teeeth tteehe tteeeh ttehee ttehee tteehe tteeeh tteehe
tteeeh ttehee ttehee tteehe tteeeh ttheee ttheee ttheee ttheee ttheee ttheee
tteehe tteeeh ttehee ttehee tteehe tteeeh thetee thetee theete theeet theeet
theete thteee thteee thteee thteee thteee thteee thetee thetee theete theeet
theeet theete thetee thetee theete theeet theeet theete teethe teeteh teehte
teehet teeeht teeeth tetehe teteeh tethee tethee tetehe teteeh tehtee tehtee
tehete teheet teheet tehete teethe teeteh teehte teehet teeeht teeeth etethe
eteteh etehte etehet eteeht eteeth ettehe etteeh etthee etthee ettehe etteeh
ethtee ethtee ethete etheet etheet ethete etethe eteteh etehte etehet eteeht
eteeth eetthe eetteh eethte eethet eeteht eeteth eetthe eetteh eethte eethet
eeteht eeteth eehtte eehtet eehtte eehtet eehett eehett eeetht eeetth eeehtt
eeehtt eeetht eeetth etethe eteteh etehte etehet eteeht eteeth ettehe etteeh
etthee etthee ettehe etteeh ethtee ethtee ethete etheet etheet ethete etethe
eteteh etehte etehet eteeht eteeth ehette ehetet ehette ehetet eheett eheett
ehtete ehteet ehttee ehttee ehtete ehteet ehttee ehttee ehtete ehteet ehteet
ehtete ehette ehetet ehette ehetet eheett eheett eeetht eeetth eeehtt eeehtt
eeetht eeetth eeteht eeteth eethet eethte eetthe eetteh eehtet eehtte eehett
eehett eehtet eehtte eetthe eetteh eethte eethet eeteht eeteth eetthe eetteh
eethte eethet eeteht eeteth eetthe eetteh eethte eethet eeteht eeteth eehtte
eehtet eehtte eehtet eehett eehett eeetht eeetth eeehtt eeehtt eeetht eeetth
etethe eteteh etehte etehet eteeht eteeth ettehe etteeh etthee etthee ettehe
etteeh ethtee ethtee ethete etheet etheet ethete etethe eteteh etehte etehet
eteeht eteeth ettehe etteeh etthee etthee ettehe etteeh etethe eteteh etehte
etehet eteeht eteeth ethete etheet ethtee ethtee ethete etheet eteeht eteeth
etehet etehte etethe eteteh ehttee ehttee ehtete ehteet ehteet ehtete ehttee
ehttee ehtete ehteet ehteet ehtete ehette ehetet ehette ehetet eheett eheett
ehetet ehette eheett eheett ehetet ehette eetthe eetteh eethte eethet eeteht
eeteth eetthe eetteh eethte eethet eeteht eeteth eehtte eehtet eehtte eehtet
eehett eehett eeetht eeetth eeehtt eeehtt eeetht eeetth teethe teeteh teehte
teehet teeeht teeeth tetehe teteeh tethee tethee tetehe teteeh tehtee tehtee
tehete teheet teheet tehete teethe teeteh teehte teehet teeeht teeeth teethe
teeteh teehte teehet teeeht teeeth tetehe teteeh tethee tethee tetehe teteeh
tehtee tehtee tehete teheet teheet tehete teethe teeteh teehte teehet teeeht
teeeth tteehe tteeeh ttehee ttehee tteehe tteeeh tteehe tteeeh ttehee ttehee
tteehe tteeeh ttheee ttheee ttheee ttheee ttheee ttheee tteehe tteeeh ttehee
ttehee tteehe tteeeh thetee thetee theete theeet theeet theete thteee thteee
thteee thteee thteee thteee thetee thetee theete theeet theeet theete thetee
thetee theete theeet theeet theete teethe teeteh teehte teehet teeeht teeeth
tetehe teteeh tethee tethee tetehe teteeh tehtee tehtee tehete teheet teheet
tehete teethe teeteh teehte teehet teeeht teeeth heette heetet heette heetet
heeett heeett hetete heteet hettee hettee hetete heteet hettee hettee hetete
heteet heteet hetete heette heetet heette heetet heeett heeett heette heetet
heette heetet heeett heeett hetete heteet hettee hettee hetete heteet hettee
hettee hetete heteet heteet hetete heette heetet heette heetet heeett heeett
hteete hteeet htetee htetee hteete hteeet hteete hteeet htetee htetee hteete
hteeet htteee htteee htteee htteee htteee htteee hteete hteeet htetee htetee
hteete hteeet htetee htetee hteete hteeet hteeet hteete htteee htteee htteee
htteee htteee htteee htetee htetee hteete hteeet hteeet hteete htetee htetee
hteete hteeet hteeet hteete heette heetet heette heetet heeett heeett hetete
heteet hettee hettee hetete heteet hettee hettee hetete heteet heteet hetete
heette heetet heette heetet heeett heeett eeetht eeetth eeehtt eeehtt eeetht
eeetth eeteht eeteth eethet eethte eetthe eetteh eehtet eehtte eehett eehett
eehtet eehtte eetthe eetteh eethte eethet eeteht eeteth eeetht eeetth eeehtt
eeehtt eeetht eeetth eeteht eeteth eethet eethte eetthe eetteh eehtet eehtte
eehett eehett eehtet eehtte eetthe eetteh eethte eethet eeteht eeteth eteeht
eteeth etehet etehte etethe eteteh eteeht eteeth etehet etehte etethe eteteh
etheet ethete etheet ethete ethtee ethtee ettehe etteeh etthee etthee ettehe
etteeh ehetet ehette eheett eheett ehetet ehette ehteet ehtete ehteet ehtete
ehttee ehttee ehetet ehette eheett eheett ehetet ehette ehttee ehttee ehtete
ehteet ehteet ehtete etethe eteteh etehte etehet eteeht eteeth ettehe etteeh
etthee etthee ettehe etteeh ethtee ethtee ethete etheet etheet ethete etethe
eteteh etehte etehet eteeht eteeth

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us