easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

larrivee

subdolum

jennette

allwork

desinence

bratke

maculavisse

beamed

dobesh

demitterentque

miraculize

institueritisque

strivings

severny

oversparred

praeteritisque

multisonous

maculavistis


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: sychem
cipher variations:
tzdifn uaejgo vbfkhp wcgliq xdhmjr
yeinks zfjolt agkpmu bhlqnv cimrow
djnspx ekotqy flpurz gmqvsa hnrwtb
iosxuc jptyvd kquzwe lrvaxf mswbyg
ntxczh ouydai pvzebj qwafck rxbgdl

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: sychem
Cipher: hbxsvn

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: sychem
Cipher: BAAAB BABBA AAABA AABBB AABAA ABABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: sychem
cipher variations:
tzdifndvhwnlnrlkvjxnpydhhjtmlfrfxatdlxfcjzvtjqrx
fpnezvplrshtzhvgprjdzuxpuaejgoewixomosmlwkyoqzei
ikunmgsgybuemygdkawukrsygqofawqmstiuaiwhqskeavyq
vbfkhpfxjypnptnmxlzprafjjlvonhthzcvfnzhelbxvlstz
hrpgbxrntujvbjxirtlfbwzrwcgliqgykzqoquonymaqsbgk
kmwpoiuiadwgoaifmcywmtuaisqhcysouvkwckyjsumgcxas
xdhmjrhzlarprvpoznbrtchllnxqpjvjbexhpbjgndzxnuvb
jtridztpvwlxdlzktvnhdybtyeinksiambsqswqpaocsudim
moyrqkwkcfyiqckhoeayovwckusjeauqwxmyemaluwoiezcu
zfjoltjbnctrtxrqbpdtvejnnpzsrlxldgzjrdlipfbzpwxd
lvtkfbvrxynzfnbmvxpjfadvagkpmukcodusuysrcqeuwfko
oqatsmymehaksemjqgcaqxyemwulgcwsyzoagocnwyqkgbew
bhlqnvldpevtvztsdrfvxglpprbutnznfibltfnkrhdbryzf
nxvmhdxtzapbhpdoxzrlhcfxcimrowmeqfwuwautesgwyhmq
qscvuoaogjcmugolsiecszagoywnieyuabqciqepyasmidgy
djnspxnfrgxvxbvufthxzinrrtdwvpbphkdnvhpmtjfdtabh
pzxojfzvbcrdjrfqzbtnjehzekotqyogshywycwvguiyajos
suexwqcqileowiqnukgeubciqaypkgawcdseksgracuokfia
flpurzphtizxzdxwhvjzbkpttvfyxrdrjmfpxjrovlhfvcdj
rbzqlhbxdetflthsbdvplgjbgmqvsaqiujayaeyxiwkaclqu
uwgzyseskngqykspwmigwdekscarmicyefugmuitcewqmhkc
hnrwtbrjvkbzbfzyjxlbdmrvvxhaztftlohrzltqxnjhxefl
tdbsnjdzfgvhnvjudfxrnildiosxucskwlcacgazkymcensw
wyibaugumpisamuryokiyfgmuectokeaghwiowkvegysojme
jptyvdtlxmdbdhbalzndfotxxzjcbvhvnqjtbnvszpljzghn
vfduplfbhixjpxlwfhztpknfkquzweumyneceicbmaoegpuy
yakdcwiworkucowtaqmkahiowgevqmgcijykqymxgiauqlog
lrvaxfvnzofdfjdcnbpfhqvzzbledxjxpslvdpxubrnlbijp
xhfwrnhdjkzlrznyhjbvrmphmswbygwoapgegkedocqgirwa
acmfeykyqtmweqyvcsomcjkqyigxsoieklamsaozikcwsnqi
ntxczhxpbqhfhlfepdrhjsxbbdngfzlzrunxfrzwdtpndklr
zjhytpjflmbntbpajldxtorjouydaiyqcrigimgfqesiktyc
ceohgamasvoygsaxeuqoelmsakizuqkgmncoucqbkmeyupsk
pvzebjzrdsjhjnhgrftjluzddfpihbnbtwpzhtbyfvrpfmnt
bljavrlhnodpvdrclnfzvqtlqwafckasetkikoihsgukmvae
egqjicocuxqaiuczgwsqgnoucmkbwsmiopeqwesdmogawrum
rxbgdlbtfuljlpjithvlnwbffhrkjdpdvyrbjvdahxtrhopv
dnlcxtnjpqfrxftenphbxsvnsychemcugvmkmqkjuiwmoxcg
gislkeqewzsckwebiyusipqweomdyuokqrgsygufoqicytwo

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: sychem
Cipher: flpurz

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: sychem
Cipher: 344531325123

Extended Methods:
Method #1

Plaintext: sychem
method variations:
xdhnkrcinspwhosxubntxczg

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s y c h e m 
3 4 3 3 5 2 
4 5 1 2 1 3 
They are then read out in rows:
343352451213
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: sychem
Cipher: snkyfl

Read more ...
Method #3

Plaintext: sychem
method variations:
tplwfn plwfnt lwfntp
wfntpl fntplw ntplwf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: sychem

all 720 cipher variations:
sychem sychme sycehm sycemh sycmeh sycmhe syhcem syhcme syhecm syhemc syhmec
syhmce syehcm syehmc syechm syecmh syemch syemhc symhec symhce symehc symech
symceh symche scyhem scyhme scyehm scyemh scymeh scymhe schyem schyme scheym
schemy schmey schmye scehym scehmy sceyhm sceymh scemyh scemhy scmhey scmhye
scmehy scmeyh scmyeh scmyhe shcyem shcyme shceym shcemy shcmey shcmye shycem
shycme shyecm shyemc shymec shymce sheycm sheymc shecym shecmy shemcy shemyc
shmyec shmyce shmeyc shmecy shmcey shmcye sechym sechmy secyhm secymh secmyh
secmhy sehcym sehcmy sehycm sehymc sehmyc sehmcy seyhcm seyhmc seychm seycmh
seymch seymhc semhyc semhcy semyhc semych semcyh semchy smchey smchye smcehy
smceyh smcyeh smcyhe smhcey smhcye smhecy smheyc smhyec smhyce smehcy smehyc
smechy smecyh smeych smeyhc smyhec smyhce smyehc smyech smyceh smyche yschem
yschme yscehm yscemh yscmeh yscmhe yshcem yshcme yshecm yshemc yshmec yshmce
ysehcm ysehmc ysechm ysecmh ysemch ysemhc ysmhec ysmhce ysmehc ysmech ysmceh
ysmche ycshem ycshme ycsehm ycsemh ycsmeh ycsmhe ychsem ychsme ychesm ychems
ychmes ychmse ycehsm ycehms yceshm ycesmh ycemsh ycemhs ycmhes ycmhse ycmehs
ycmesh ycmseh ycmshe yhcsem yhcsme yhcesm yhcems yhcmes yhcmse yhscem yhscme
yhsecm yhsemc yhsmec yhsmce yhescm yhesmc yhecsm yhecms yhemcs yhemsc yhmsec
yhmsce yhmesc yhmecs yhmces yhmcse yechsm yechms yecshm yecsmh yecmsh yecmhs
yehcsm yehcms yehscm yehsmc yehmsc yehmcs yeshcm yeshmc yeschm yescmh yesmch
yesmhc yemhsc yemhcs yemshc yemsch yemcsh yemchs ymches ymchse ymcehs ymcesh
ymcseh ymcshe ymhces ymhcse ymhecs ymhesc ymhsec ymhsce ymehcs ymehsc ymechs
ymecsh ymesch ymeshc ymshec ymshce ymsehc ymsech ymsceh ymsche cyshem cyshme
cysehm cysemh cysmeh cysmhe cyhsem cyhsme cyhesm cyhems cyhmes cyhmse cyehsm
cyehms cyeshm cyesmh cyemsh cyemhs cymhes cymhse cymehs cymesh cymseh cymshe
csyhem csyhme csyehm csyemh csymeh csymhe cshyem cshyme csheym cshemy cshmey
cshmye csehym csehmy cseyhm cseymh csemyh csemhy csmhey csmhye csmehy csmeyh
csmyeh csmyhe chsyem chsyme chseym chsemy chsmey chsmye chysem chysme chyesm
chyems chymes chymse cheysm cheyms chesym chesmy chemsy chemys chmyes chmyse
chmeys chmesy chmsey chmsye ceshym ceshmy cesyhm cesymh cesmyh cesmhy cehsym
cehsmy cehysm cehyms cehmys cehmsy ceyhsm ceyhms ceyshm ceysmh ceymsh ceymhs
cemhys cemhsy cemyhs cemysh cemsyh cemshy cmshey cmshye cmsehy cmseyh cmsyeh
cmsyhe cmhsey cmhsye cmhesy cmheys cmhyes cmhyse cmehsy cmehys cmeshy cmesyh
cmeysh cmeyhs cmyhes cmyhse cmyehs cmyesh cmyseh cmyshe hycsem hycsme hycesm
hycems hycmes hycmse hyscem hyscme hysecm hysemc hysmec hysmce hyescm hyesmc
hyecsm hyecms hyemcs hyemsc hymsec hymsce hymesc hymecs hymces hymcse hcysem
hcysme hcyesm hcyems hcymes hcymse hcsyem hcsyme hcseym hcsemy hcsmey hcsmye
hcesym hcesmy hceysm hceyms hcemys hcemsy hcmsey hcmsye hcmesy hcmeys hcmyes
hcmyse hscyem hscyme hsceym hscemy hscmey hscmye hsycem hsycme hsyecm hsyemc
hsymec hsymce hseycm hseymc hsecym hsecmy hsemcy hsemyc hsmyec hsmyce hsmeyc
hsmecy hsmcey hsmcye hecsym hecsmy hecysm hecyms hecmys hecmsy hescym hescmy
hesycm hesymc hesmyc hesmcy heyscm heysmc heycsm heycms heymcs heymsc hemsyc
hemscy hemysc hemycs hemcys hemcsy hmcsey hmcsye hmcesy hmceys hmcyes hmcyse
hmscey hmscye hmsecy hmseyc hmsyec hmsyce hmescy hmesyc hmecsy hmecys hmeycs
hmeysc hmysec hmysce hmyesc hmyecs hmyces hmycse eychsm eychms eycshm eycsmh
eycmsh eycmhs eyhcsm eyhcms eyhscm eyhsmc eyhmsc eyhmcs eyshcm eyshmc eyschm
eyscmh eysmch eysmhc eymhsc eymhcs eymshc eymsch eymcsh eymchs ecyhsm ecyhms
ecyshm ecysmh ecymsh ecymhs echysm echyms echsym echsmy echmsy echmys ecshym
ecshmy ecsyhm ecsymh ecsmyh ecsmhy ecmhsy ecmhys ecmshy ecmsyh ecmysh ecmyhs
ehcysm ehcyms ehcsym ehcsmy ehcmsy ehcmys ehycsm ehycms ehyscm ehysmc ehymsc
ehymcs ehsycm ehsymc ehscym ehscmy ehsmcy ehsmyc ehmysc ehmycs ehmsyc ehmscy
ehmcsy ehmcys eschym eschmy escyhm escymh escmyh escmhy eshcym eshcmy eshycm
eshymc eshmyc eshmcy esyhcm esyhmc esychm esycmh esymch esymhc esmhyc esmhcy
esmyhc esmych esmcyh esmchy emchsy emchys emcshy emcsyh emcysh emcyhs emhcsy
emhcys emhscy emhsyc emhysc emhycs emshcy emshyc emschy emscyh emsych emsyhc
emyhsc emyhcs emyshc emysch emycsh emychs myches mychse mycehs mycesh mycseh
mycshe myhces myhcse myhecs myhesc myhsec myhsce myehcs myehsc myechs myecsh
myesch myeshc myshec myshce mysehc mysech mysceh mysche mcyhes mcyhse mcyehs
mcyesh mcyseh mcyshe mchyes mchyse mcheys mchesy mchsey mchsye mcehys mcehsy
mceyhs mceysh mcesyh mceshy mcshey mcshye mcsehy mcseyh mcsyeh mcsyhe mhcyes
mhcyse mhceys mhcesy mhcsey mhcsye mhyces mhycse mhyecs mhyesc mhysec mhysce
mheycs mheysc mhecys mhecsy mhescy mhesyc mhsyec mhsyce mhseyc mhsecy mhscey
mhscye mechys mechsy mecyhs mecysh mecsyh mecshy mehcys mehcsy mehycs mehysc
mehsyc mehscy meyhcs meyhsc meychs meycsh meysch meyshc meshyc meshcy mesyhc
mesych mescyh meschy mschey mschye mscehy msceyh mscyeh mscyhe mshcey mshcye
mshecy msheyc mshyec mshyce msehcy msehyc msechy msecyh mseych mseyhc msyhec
msyhce msyehc msyech msyceh msyche

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us