easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

amodeo

entrench

aldinger

midwifed

cinquecento

antimaterialistic

easterroad

uenireque

phengitical

augie

categorematic

dowden

heritable

trahuntque

malderone

sommerfeld

rectitis

ramesh


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: susumu
cipher variations:
tvtvnv uwuwow vxvxpx wywyqy xzxzrz
yayasa zbzbtb acacuc bdbdvd cecewe
dfdfxf egegyg fhfhzh gigiai hjhjbj
ikikck jljldl kmkmem lnlnfn momogo
npnphp oqoqiq prprjr qsqsks rtrtlt

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: susumu
Cipher: hfhfnf

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: susumu
Cipher: BAAAB BAABB BAAAB BAABB ABABB BAABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: susumu
cipher variations:
tvtvnvdjdjljnxnxjxxlxlhlhzhzfzrnrndnlplpzpvdvdxd
frfrvrpfpftfztztrtjhjhphuwuwowekekmkoyoykyymymim
iaiagasosoeomqmqaqweweyegsgswsqgqgugauausukikiqi
vxvxpxflflnlpzpzlzznznjnjbjbhbtptpfpnrnrbrxfxfzf
hthtxtrhrhvhbvbvtvljljrjwywyqygmgmomqaqamaaoaoko
kckcicuquqgqososcsygygagiuiuyusisiwicwcwuwmkmksk
xzxzrzhnhnpnrbrbnbbpbplpldldjdvrvrhrptptdtzhzhbh
jvjvzvtjtjxjdxdxvxnlnltlyayasaioioqoscscoccqcqmq
memekewswsisququeuaiaicikwkwawukukykeyeywyomomum
zbzbtbjpjprptdtdpddrdrnrnfnflfxtxtjtrvrvfvbjbjdj
lxlxbxvlvlzlfzfzxzpnpnvnacacuckqkqsqueueqeesesos
ogogmgyuyukuswswgwckckekmymycywmwmamgagayaqoqowo
bdbdvdlrlrtrvfvfrfftftptphphnhzvzvlvtxtxhxdldlfl
nznzdzxnxnbnhbhbzbrprpxpcecewemsmsuswgwgsgguguqu
qiqioiawawmwuyuyiyememgmoaoaeayoyocoicicacsqsqyq
dfdfxfntntvtxhxhthhvhvrvrjrjpjbxbxnxvzvzjzfnfnhn
pbpbfbzpzpdpjdjdbdtrtrzregegygououwuyiyiuiiwiwsw
skskqkcycyoywawakagogoioqcqcgcaqaqeqkekeceususas
fhfhzhpvpvxvzjzjvjjxjxtxtltlrldzdzpzxbxblbhphpjp
rdrdhdbrbrfrlflfdfvtvtbtgigiaiqwqwywakakwkkykyuy
umumsmeaeaqaycycmciqiqkqseseiecscsgsmgmgegwuwucu
hjhjbjrxrxzxblblxllzlzvzvnvntnfbfbrbzdzdndjrjrlr
tftfjfdtdthtnhnhfhxvxvdvikikcksysyaycmcmymmamawa
wowouogcgcscaeaeoeksksmsugugkgeueuiuoioigiywywew
jljldltztzbzdndnznnbnbxbxpxpvphdhdtdbfbfpfltltnt
vhvhlhfvfvjvpjpjhjzxzxfxkmkmemuauacaeoeoaoococyc
yqyqwqieieuecgcgqgmumuouwiwimigwgwkwqkqkikayaygy
lnlnfnvbvbdbfpfpbppdpdzdzrzrxrjfjfvfdhdhrhnvnvpv
xjxjnjhxhxlxrlrljlbzbzhzmomogowcwcecgqgqcqqeqeae
asasyskgkgwgeieisiowowqwykykokiyiymysmsmkmcacaia
npnphpxdxdfdhrhrdrrfrfbfbtbtztlhlhxhfjfjtjpxpxrx
zlzlpljzjznztntnlndbdbjboqoqiqyeyegeisisessgsgcg
cucuaumimiyigkgkukqyqysyamamqmkakaoauouomoececkc
prprjrzfzfhfjtjtftththdhdvdvbvnjnjzjhlhlvlrzrztz
bnbnrnlblbpbvpvpnpfdfdldqsqsksagagigkukuguuiuiei
ewewcwokokakimimwmsasauacocosomcmcqcwqwqoqgegeme
rtrtltbhbhjhlvlvhvvjvjfjfxfxdxplplbljnjnxntbtbvb
dpdptpndndrdxrxrprhfhfnfsusumucicikimwmwiwwkwkgk
gygyeyqmqmcmkokoyoucucwceqequqoeoeseysysqsigigog

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: susumu
Cipher: fhfhzh

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: susumu
Cipher: 345434542354

Extended Methods:
Method #1

Plaintext: susumu
method variations:
xzxzrzcecewehkhkbknpnpgp

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s u s u m u 
3 5 3 5 2 5 
4 4 4 4 3 4 
They are then read out in rows:
353525444434
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: susumu
Cipher: xxwtts

Read more ...
Method #3

Plaintext: susumu
method variations:
yoyixo oyixoy yixoyo
ixoyoy xoyoyi oyoyix

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: susumu

all 720 cipher variations:
susumu susuum susmuu susmuu susumu susuum suusmu suusum suumsu suumus suuums
suuusm sumusu sumuus sumsuu sumsuu sumusu sumuus suuums suuusm suumus suumsu
suusmu suusum ssuumu ssuuum ssumuu ssumuu ssuumu ssuuum ssuumu ssuuum ssumuu
ssumuu ssuumu ssuuum ssmuuu ssmuuu ssmuuu ssmuuu ssmuuu ssmuuu ssuumu ssuuum
ssumuu ssumuu ssuumu ssuuum susumu susuum susmuu susmuu susumu susuum suusmu
suusum suumsu suumus suuums suuusm sumusu sumuus sumsuu sumsuu sumusu sumuus
suuums suuusm suumus suumsu suusmu suusum smsuuu smsuuu smsuuu smsuuu smsuuu
smsuuu smusuu smusuu smuusu smuuus smuuus smuusu smuusu smuuus smusuu smusuu
smuusu smuuus smuuus smuusu smuuus smuusu smusuu smusuu susumu susuum susmuu
susmuu susumu susuum suusmu suusum suumsu suumus suuums suuusm sumusu sumuus
sumsuu sumsuu sumusu sumuus suuums suuusm suumus suumsu suusmu suusum ussumu
ussuum ussmuu ussmuu ussumu ussuum ususmu ususum usumsu usumus usuums usuusm
usmusu usmuus usmsuu usmsuu usmusu usmuus usuums usuusm usumus usumsu ususmu
ususum ussumu ussuum ussmuu ussmuu ussumu ussuum ususmu ususum usumsu usumus
usuums usuusm usmusu usmuus usmsuu usmsuu usmusu usmuus usuums usuusm usumus
usumsu ususmu ususum uussmu uussum uusmsu uusmus uusums uususm uussmu uussum
uusmsu uusmus uusums uususm uumssu uumsus uumssu uumsus uumuss uumuss uuusms
uuussm uuumss uuumss uuusms uuussm umsusu umsuus umssuu umssuu umsusu umsuus
umussu umusus umussu umusus umuuss umuuss umsusu umsuus umssuu umssuu umsusu
umsuus umuuss umuuss umusus umussu umussu umusus uusums uususm uusmus uusmsu
uussmu uussum uuusms uuussm uuumss uuumss uuusms uuussm uumuss uumuss uumsus
uumssu uumssu uumsus uusums uususm uusmus uusmsu uussmu uussum susumu susuum
susmuu susmuu susumu susuum suusmu suusum suumsu suumus suuums suuusm sumusu
sumuus sumsuu sumsuu sumusu sumuus suuums suuusm suumus suumsu suusmu suusum
ssuumu ssuuum ssumuu ssumuu ssuumu ssuuum ssuumu ssuuum ssumuu ssumuu ssuumu
ssuuum ssmuuu ssmuuu ssmuuu ssmuuu ssmuuu ssmuuu ssuumu ssuuum ssumuu ssumuu
ssuumu ssuuum susumu susuum susmuu susmuu susumu susuum suusmu suusum suumsu
suumus suuums suuusm sumusu sumuus sumsuu sumsuu sumusu sumuus suuums suuusm
suumus suumsu suusmu suusum smsuuu smsuuu smsuuu smsuuu smsuuu smsuuu smusuu
smusuu smuusu smuuus smuuus smuusu smuusu smuuus smusuu smusuu smuusu smuuus
smuuus smuusu smuuus smuusu smusuu smusuu susumu susuum susmuu susmuu susumu
susuum suusmu suusum suumsu suumus suuums suuusm sumusu sumuus sumsuu sumsuu
sumusu sumuus suuums suuusm suumus suumsu suusmu suusum uussmu uussum uusmsu
uusmus uusums uususm uussmu uussum uusmsu uusmus uusums uususm uumssu uumsus
uumssu uumsus uumuss uumuss uuusms uuussm uuumss uuumss uuusms uuussm ususmu
ususum usumsu usumus usuums usuusm ussumu ussuum ussmuu ussmuu ussumu ussuum
usmsuu usmsuu usmusu usmuus usmuus usmusu ususmu ususum usumsu usumus usuums
usuusm ussumu ussuum ussmuu ussmuu ussumu ussuum ususmu ususum usumsu usumus
usuums usuusm usmusu usmuus usmsuu usmsuu usmusu usmuus usuums usuusm usumus
usumsu ususmu ususum umssuu umssuu umsusu umsuus umsuus umsusu umssuu umssuu
umsusu umsuus umsuus umsusu umussu umusus umussu umusus umuuss umuuss umusus
umussu umuuss umuuss umusus umussu uussmu uussum uusmsu uusmus uusums uususm
uussmu uussum uusmsu uusmus uusums uususm uumssu uumsus uumssu uumsus uumuss
uumuss uuusms uuussm uuumss uuumss uuusms uuussm mususu musuus mussuu mussuu
mususu musuus muussu muusus muussu muusus muuuss muuuss mususu musuus mussuu
mussuu mususu musuus muuuss muuuss muusus muussu muussu muusus msuusu msuuus
msusuu msusuu msuusu msuuus msuusu msuuus msusuu msusuu msuusu msuuus mssuuu
mssuuu mssuuu mssuuu mssuuu mssuuu msuusu msuuus msusuu msusuu msuusu msuuus
mususu musuus mussuu mussuu mususu musuus muussu muusus muussu muusus muuuss
muuuss mususu musuus mussuu mussuu mususu musuus muuuss muuuss muusus muussu
muussu muusus mssuuu mssuuu mssuuu mssuuu mssuuu mssuuu msusuu msusuu msuusu
msuuus msuuus msuusu msuusu msuuus msusuu msusuu msuusu msuuus msuuus msuusu
msuuus msuusu msusuu msusuu mususu musuus mussuu mussuu mususu musuus muussu
muusus muussu muusus muuuss muuuss mususu musuus mussuu mussuu mususu musuus
muuuss muuuss muusus muussu muussu muusus uusums uususm uusmus uusmsu uussmu
uussum uuusms uuussm uuumss uuumss uuusms uuussm uumuss uumuss uumsus uumssu
uumssu uumsus uusums uususm uusmus uusmsu uussmu uussum usuums usuusm usumus
usumsu ususmu ususum usuums usuusm usumus usumsu ususmu ususum usmuus usmusu
usmuus usmusu usmsuu usmsuu ussumu ussuum ussmuu ussmuu ussumu ussuum uusums
uususm uusmus uusmsu uussmu uussum uuusms uuussm uuumss uuumss uuusms uuussm
uumuss uumuss uumsus uumssu uumssu uumsus uusums uususm uusmus uusmsu uussmu
uussum umsuus umsusu umsuus umsusu umssuu umssuu umusus umussu umuuss umuuss
umusus umussu umuuss umuuss umusus umussu umussu umusus umsuus umsusu umsuus
umsusu umssuu umssuu ussumu ussuum ussmuu ussmuu ussumu ussuum ususmu ususum
usumsu usumus usuums usuusm usmusu usmuus usmsuu usmsuu usmusu usmuus usuums
usuusm usumus usumsu ususmu ususum

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us