easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

unconfinable

alduas

omenque

preucil

hogwashes

triodia

saeptis

toluyl

unintelligent

westinghouse

rakishly

tilaite

relinquatis

rademaker

dehorns

riverward

unwading

doucine


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: summerbird
cipher variations:
tvnnfscjse uwoogtdktf vxpphuelug wyqqivfmvh xzrrjwgnwi
yasskxhoxj zbttlyipyk acuumzjqzl bdvvnakram cewwoblsbn
dfxxpcmtco egyyqdnudp fhzzreoveq giaasfpwfr hjbbtgqxgs
ikccuhryht jlddvisziu kmeewjtajv lnffxkubkw moggylvclx
nphhzmwdmy oqiianxenz prjjboyfoa qskkcpzgpb rtlldqahqc

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: summerbird
Cipher: hfnnviyriw

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: summerbird
Cipher: BAAAB BAABB ABABB ABABB AABAA BAAAA AAAAB ABAAA BAAAA AAABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: summerbird
cipher variations:
tvnnfscjsedjllnaezaknxjjvigpiqxlhhdqifqwhzfflykvycrnddtgmlgilpzzjwqrwuvdxxreshea
frvvzmuxmgpftthuwnumztrrpcydcsjhppxkatkyuwoogtdktfekmmobfabloykkwjhqjrymiierjgrx
iaggmzlwzdsoeeuhnmhjmqaakxrsxvweyysftifbgswwanvynhqguuivxovnaussqdzedtkiqqylbulz
vxpphuelugflnnpcgbcmpzllxkirksznjjfskhsyjbhhnamxaetpffvioniknrbblystywxfzztgujgc
htxxbowzoirhvvjwypwobvttreafeuljrrzmcvmawyqqivfmvhgmooqdhcdnqammyljsltaokkgtlitz
kciiobnybfuqggwjpojlosccmztuzxygaauhvkhdiuyycpxapjsiwwkxzqxpcwuusfbgfvmkssandwnb
xzrrjwgnwihnppreideorbnnzmktmubpllhumjualdjjpcozcgvrhhxkqpkmptddnauvayzhbbviwlie
jvzzdqybqktjxxlyaryqdxvvtgchgwnlttboexocyasskxhoxjioqqsfjefpscooanlunvcqmmivnkvb
mekkqdpadhwsiiylrqlnqueeobvwbzaiccwjxmjfkwaaerzcrlukyymzbszreywwuhdihxomuucpfypd
zbttlyipykjprrtgkfgqtdppbomvowdrnnjwolwcnfllreqbeixtjjzmsrmorvffpcwxcabjddxkynkg
lxbbfsadsmvlzznactasfzxxviejiypnvvdqgzqeacuumzjqzlkqssuhlghrueqqcpnwpxesookxpmxd
ogmmsfrcfjyukkantsnpswggqdxydbckeeylzolhmyccgtbetnwmaaobdubtgayywjfkjzqowwerharf
bdvvnakramlrttvimhisvfrrdqoxqyftpplyqnyephnntgsdgkzvllboutoqtxhhreyzecdlffzmapmi
nzddhucfuoxnbbpcevcuhbzzxkglkarpxxfsibsgcewwoblsbnmsuuwjnijtwgsserpyrzguqqmzrozf
qioouhtehlawmmcpvupruyiisfzafdemgganbqnjoaeeivdgvpyoccqdfwdvicaaylhmlbsqyygtjcth
dfxxpcmtcontvvxkojkuxhttfsqzsahvrrnaspagrjppviufimbxnndqwvqsvzjjtgabgefnhhbocrok
pbffjwehwqzpddregxewjdbbzminmctrzzhukduiegyyqdnudpouwwylpklvyiuugtratbiwssobtqbh
skqqwjvgjncyooerxwrtwakkuhbchfgoiicpdsplqcggkxfixraqeesfhyfxkeccanjondusaaivlevj
fhzzreoveqpvxxzmqlmwzjvvhusbucjxttpcurcitlrrxkwhkodzppfsyxsuxbllvicdighpjjdqetqm
rdhhlygjysbrfftgizgylfddbokpoevtbbjwmfwkgiaasfpwfrqwyyanrmnxakwwivtcvdkyuuqdvsdj
umssylxilpeaqqgtzytvycmmwjdejhiqkkerfurnseiimzhkztcsgguhjahzmgeecplqpfwucckxngxl
hjbbtgqxgsrxzzbosnoyblxxjwudwelzvvrewtekvnttzmyjmqfbrrhuazuwzdnnxkefkijrllfsgvso
tfjjnailaudthhvikbianhffdqmrqgxvddlyohymikccuhryhtsyaacptopzcmyykxvexfmawwsfxufl
wouuanzknrgcssivbavxaeooylfgljksmmgthwtpugkkobjmbveuiiwjlcjboiggernsrhyweemzpizn
jlddvisziutzbbdqupqadnzzlywfygnbxxtgyvgmxpvvboaloshdttjwcbwybfppzmghmkltnnhuixuq
vhllpckncwfvjjxkmdkcpjhhfsotsizxffnaqjaokmeewjtajvuaccervqrbeoaamzxgzhocyyuhzwhn
yqwwcpbmptieuukxdcxzcgqqanhinlmuooivjyvrwimmqdlodxgwkkylneldqkiigtputjayggobrkbp
lnffxkubkwvbddfswrscfpbbnayhaipdzzviaxiozrxxdqcnqujfvvlyedyadhrrboijomnvppjwkzws
xjnnrempeyhxllzmofmerljjhuqvukbzhhpcslcqmoggylvclxwceegtxstdgqccobzibjqeaawjbyjp
asyyerdorvkgwwmzfezbeisscpjkpnowqqkxlaxtykoosfnqfziymmanpgnfsmkkivrwvlcaiiqdtmdr
nphhzmwdmyxdffhuytuehrddpcajckrfbbxkczkqbtzzfsepswlhxxnagfacfjttdqklqopxrrlymbyu
zlpptgorgajznnboqhogtnlljwsxwmdbjjreunesoqiianxenzyeggivzuvfiseeqdbkdlsgccyldalr
cuaagtfqtxmiyyobhgbdgkuuerlmrpqyssmznczvamqquhpshbkaoocpriphuommkxtyxneckksfvoft
prjjboyfoazfhhjwavwgjtffreclemthddzmebmsdvbbhugruynjzzpcihcehlvvfsmnsqrzttnaodaw
bnrrviqticlbppdqsjqivpnnlyuzyofdlltgwpguqskkcpzgpbagiikxbwxhkuggsfdmfnuieeanfcnt
ewccivhsvzokaaqdjidfimwwgtnotrsauuobpebxcosswjrujdmcqqertkrjwqoomzvazpgemmuhxqhv
rtlldqahqcbhjjlycxyilvhhtgengovjffbogdoufxddjwitwaplbbrekjegjnxxhuopustbvvpcqfcy
dpttxksvkendrrfsulskxrppnawbaqhfnnviyriwsummerbirdcikkmzdyzjmwiiuhfohpwkggcphepv
gyeekxjuxbqmccsflkfhkoyyivpqvtucwwqdrgdzequuyltwlfoessgtvmtlysqqobxcbrigoowjzsjx

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: summerbird
Cipher: fhzzreoveq

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: summerbird
Cipher: 34542323512421422441

Extended Methods:
Method #1

Plaintext: summerbird
method variations:
xzrrkwgowicewwpbmtbohkbbugrygtnpggzmwdmy

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s u m m e r b i r d 
3 5 2 2 5 2 2 4 2 4 
4 4 3 3 1 4 1 2 4 1 
They are then read out in rows:
35225224244433141241
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: summerbird
Cipher: xgkrrtnqfd

Read more ...
Method #3

Plaintext: summerbird
method variations:
yihxfiqgtl ihxfiqgtly hxfiqgtlyi
xfiqgtlyih fiqgtlyihx iqgtlyihxf
qgtlyihxfi gtlyihxfiq tlyihxfiqg
lyihxfiqgt

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: summerbird

first 5040 cipher variations(3628800 total)
summerbird summerbidr summerbrid summerbrdi summerbdri summerbdir summeribrd summeribdr summerirbd summerirdb summeridrb
summeridbr summerribd summerridb summerrbid summerrbdi summerrdbi summerrdib summerdirb summerdibr summerdrib summerdrbi
summerdbri summerdbir summebrird summebridr summebrrid summebrrdi summebrdri summebrdir summebirrd summebirdr summebirrd
summebirdr summebidrr summebidrr summebrird summebridr summebrrid summebrrdi summebrdri summebrdir summebdirr summebdirr
summebdrir summebdrri summebdrri summebdrir summeibrrd summeibrdr summeibrrd summeibrdr summeibdrr summeibdrr summeirbrd
summeirbdr summeirrbd summeirrdb summeirdrb summeirdbr summeirrbd summeirrdb summeirbrd summeirbdr summeirdbr summeirdrb
summeidrrb summeidrbr summeidrrb summeidrbr summeidbrr summeidbrr summerbird summerbidr summerbrid summerbrdi summerbdri
summerbdir summeribrd summeribdr summerirbd summerirdb summeridrb summeridbr summerribd summerridb summerrbid summerrbdi
summerrdbi summerrdib summerdirb summerdibr summerdrib summerdrbi summerdbri summerdbir summedbirr summedbirr summedbrir
summedbrri summedbrri summedbrir summedibrr summedibrr summedirbr summedirrb summedirrb summedirbr summedribr summedrirb
summedrbir summedrbri summedrrbi summedrrib summedrirb summedribr summedrrib summedrrbi summedrbri summedrbir summrebird
summrebidr summrebrid summrebrdi summrebdri summrebdir summreibrd summreibdr summreirbd summreirdb summreidrb summreidbr
summreribd summreridb summrerbid summrerbdi summrerdbi summrerdib summredirb summredibr summredrib summredrbi summredbri
summredbir summrbeird summrbeidr summrberid summrberdi summrbedri summrbedir summrbierd summrbiedr summrbired summrbirde
summrbidre summrbider summrbried summrbride summrbreid summrbredi summrbrdei summrbrdie summrbdire summrbdier summrbdrie
summrbdrei summrbderi summrbdeir summriberd summribedr summribred summribrde summribdre summribder summriebrd summriebdr
summrierbd summrierdb summriedrb summriedbr summrirebd summriredb summrirbed summrirbde summrirdbe summrirdeb summriderb
summridebr summridreb summridrbe summridbre summridber summrrbied summrrbide summrrbeid summrrbedi summrrbdei summrrbdie
summrribed summrribde summrriebd summrriedb summrrideb summrridbe summrreibd summrreidb summrrebid summrrebdi summrredbi
summrredib summrrdieb summrrdibe summrrdeib summrrdebi summrrdbei summrrdbie summrdbire summrdbier summrdbrie summrdbrei
summrdberi summrdbeir summrdibre summrdiber summrdirbe summrdireb summrdierb summrdiebr summrdribe summrdrieb summrdrbie
summrdrbei summrdrebi summrdreib summrdeirb summrdeibr summrderib summrderbi summrdebri summrdebir summbreird summbreidr
summbrerid summbrerdi summbredri summbredir summbrierd summbriedr summbrired summbrirde summbridre summbrider summbrried
summbrride summbrreid summbrredi summbrrdei summbrrdie summbrdire summbrdier summbrdrie summbrdrei summbrderi summbrdeir
summberird summberidr summberrid summberrdi summberdri summberdir summbeirrd summbeirdr summbeirrd summbeirdr summbeidrr
summbeidrr summberird summberidr summberrid summberrdi summberdri summberdir summbedirr summbedirr summbedrir summbedrri
summbedrri summbedrir summbierrd summbierdr summbierrd summbierdr summbiedrr summbiedrr summbirerd summbiredr summbirred
summbirrde summbirdre summbirder summbirred summbirrde summbirerd summbiredr summbirder summbirdre summbidrre summbidrer
summbidrre summbidrer summbiderr summbiderr summbreird summbreidr summbrerid summbrerdi summbredri summbredir summbrierd
summbriedr summbrired summbrirde summbridre summbrider summbrried summbrride summbrreid summbrredi summbrrdei summbrrdie
summbrdire summbrdier summbrdrie summbrdrei summbrderi summbrdeir summbdeirr summbdeirr summbderir summbderri summbderri
summbderir summbdierr summbdierr summbdirer summbdirre summbdirre summbdirer summbdrier summbdrire summbdreir summbdreri
summbdrrei summbdrrie summbdrire summbdrier summbdrrie summbdrrei summbdreri summbdreir summirberd summirbedr summirbred
summirbrde summirbdre summirbder summirebrd summirebdr summirerbd summirerdb summiredrb summiredbr summirrebd summirredb
summirrbed summirrbde summirrdbe summirrdeb summirderb summirdebr summirdreb summirdrbe summirdbre summirdber summibrerd
summibredr summibrred summibrrde summibrdre summibrder summiberrd summiberdr summiberrd summiberdr summibedrr summibedrr
summibrerd summibredr summibrred summibrrde summibrdre summibrder summibderr summibderr summibdrer summibdrre summibdrre
summibdrer summiebrrd summiebrdr summiebrrd summiebrdr summiebdrr summiebdrr summierbrd summierbdr summierrbd summierrdb
summierdrb summierdbr summierrbd summierrdb summierbrd summierbdr summierdbr summierdrb summiedrrb summiedrbr summiedrrb
summiedrbr summiedbrr summiedbrr summirberd summirbedr summirbred summirbrde summirbdre summirbder summirebrd summirebdr
summirerbd summirerdb summiredrb summiredbr summirrebd summirredb summirrbed summirrbde summirrdbe summirrdeb summirderb
summirdebr summirdreb summirdrbe summirdbre summirdber summidberr summidberr summidbrer summidbrre summidbrre summidbrer
summidebrr summidebrr summiderbr summiderrb summiderrb summiderbr summidrebr summidrerb summidrber summidrbre summidrrbe
summidrreb summidrerb summidrebr summidrreb summidrrbe summidrbre summidrber summrrbied summrrbide summrrbeid summrrbedi
summrrbdei summrrbdie summrribed summrribde summrriebd summrriedb summrrideb summrridbe summrreibd summrreidb summrrebid
summrrebdi summrredbi summrredib summrrdieb summrrdibe summrrdeib summrrdebi summrrdbei summrrdbie summrbried summrbride
summrbreid summrbredi summrbrdei summrbrdie summrbired summrbirde summrbierd summrbiedr summrbider summrbidre summrbeird
summrbeidr summrberid summrberdi summrbedri summrbedir summrbdier summrbdire summrbdeir summrbderi summrbdrei summrbdrie
summribred summribrde summriberd summribedr summribder summribdre summrirbed summrirbde summrirebd summriredb summrirdeb
summrirdbe summrierbd summrierdb summriebrd summriebdr summriedbr summriedrb summridreb summridrbe summriderb summridebr
summridber summridbre summrebird summrebidr summrebrid summrebrdi summrebdri summrebdir summreibrd summreibdr summreirbd
summreirdb summreidrb summreidbr summreribd summreridb summrerbid summrerbdi summrerdbi summrerdib summredirb summredibr
summredrib summredrbi summredbri summredbir summrdbier summrdbire summrdbeir summrdberi summrdbrei summrdbrie summrdiber
summrdibre summrdiebr summrdierb summrdireb summrdirbe summrdeibr summrdeirb summrdebir summrdebri summrderbi summrderib
summrdrieb summrdribe summrdreib summrdrebi summrdrbei summrdrbie summdrbire summdrbier summdrbrie summdrbrei summdrberi
summdrbeir summdribre summdriber summdrirbe summdrireb summdrierb summdriebr summdrribe summdrrieb summdrrbie summdrrbei
summdrrebi summdrreib summdreirb summdreibr summdrerib summdrerbi summdrebri summdrebir summdbrire summdbrier summdbrrie
summdbrrei summdbreri summdbreir summdbirre summdbirer summdbirre summdbirer summdbierr summdbierr summdbrire summdbrier
summdbrrie summdbrrei summdbreri summdbreir summdbeirr summdbeirr summdberir summdberri summdberri summdberir summdibrre
summdibrer summdibrre summdibrer summdiberr summdiberr summdirbre summdirber summdirrbe summdirreb summdirerb summdirebr
summdirrbe summdirreb summdirbre summdirber summdirebr summdirerb summdierrb summdierbr summdierrb summdierbr summdiebrr
summdiebrr summdrbire summdrbier summdrbrie summdrbrei summdrberi summdrbeir summdribre summdriber summdrirbe summdrireb
summdrierb summdriebr summdrribe summdrrieb summdrrbie summdrrbei summdrrebi summdrreib summdreirb summdreibr summdrerib
summdrerbi summdrebri summdrebir summdebirr summdebirr summdebrir summdebrri summdebrri summdebrir summdeibrr summdeibrr
summdeirbr summdeirrb summdeirrb summdeirbr summderibr summderirb summderbir summderbri summderrbi summderrib summderirb
summderibr summderrib summderrbi summderbri summderbir sumemrbird sumemrbidr sumemrbrid sumemrbrdi sumemrbdri sumemrbdir
sumemribrd sumemribdr sumemrirbd sumemrirdb sumemridrb sumemridbr sumemrribd sumemrridb sumemrrbid sumemrrbdi sumemrrdbi
sumemrrdib sumemrdirb sumemrdibr sumemrdrib sumemrdrbi sumemrdbri sumemrdbir sumembrird sumembridr sumembrrid sumembrrdi
sumembrdri sumembrdir sumembirrd sumembirdr sumembirrd sumembirdr sumembidrr sumembidrr sumembrird sumembridr sumembrrid
sumembrrdi sumembrdri sumembrdir sumembdirr sumembdirr sumembdrir sumembdrri sumembdrri sumembdrir sumemibrrd sumemibrdr
sumemibrrd sumemibrdr sumemibdrr sumemibdrr sumemirbrd sumemirbdr sumemirrbd sumemirrdb sumemirdrb sumemirdbr sumemirrbd
sumemirrdb sumemirbrd sumemirbdr sumemirdbr sumemirdrb sumemidrrb sumemidrbr sumemidrrb sumemidrbr sumemidbrr sumemidbrr
sumemrbird sumemrbidr sumemrbrid sumemrbrdi sumemrbdri sumemrbdir sumemribrd sumemribdr sumemrirbd sumemrirdb sumemridrb
sumemridbr sumemrribd sumemrridb sumemrrbid sumemrrbdi sumemrrdbi sumemrrdib sumemrdirb sumemrdibr sumemrdrib sumemrdrbi
sumemrdbri sumemrdbir sumemdbirr sumemdbirr sumemdbrir sumemdbrri sumemdbrri sumemdbrir sumemdibrr sumemdibrr sumemdirbr
sumemdirrb sumemdirrb sumemdirbr sumemdribr sumemdrirb sumemdrbir sumemdrbri sumemdrrbi sumemdrrib sumemdrirb sumemdribr
sumemdrrib sumemdrrbi sumemdrbri sumemdrbir sumermbird sumermbidr sumermbrid sumermbrdi sumermbdri sumermbdir sumermibrd
sumermibdr sumermirbd sumermirdb sumermidrb sumermidbr sumermribd sumermridb sumermrbid sumermrbdi sumermrdbi sumermrdib
sumermdirb sumermdibr sumermdrib sumermdrbi sumermdbri sumermdbir sumerbmird sumerbmidr sumerbmrid sumerbmrdi sumerbmdri
sumerbmdir sumerbimrd sumerbimdr sumerbirmd sumerbirdm sumerbidrm sumerbidmr sumerbrimd sumerbridm sumerbrmid sumerbrmdi
sumerbrdmi sumerbrdim sumerbdirm sumerbdimr sumerbdrim sumerbdrmi sumerbdmri sumerbdmir sumeribmrd sumeribmdr sumeribrmd
sumeribrdm sumeribdrm sumeribdmr sumerimbrd sumerimbdr sumerimrbd sumerimrdb sumerimdrb sumerimdbr sumerirmbd sumerirmdb
sumerirbmd sumerirbdm sumerirdbm sumerirdmb sumeridmrb sumeridmbr sumeridrmb sumeridrbm sumeridbrm sumeridbmr sumerrbimd
sumerrbidm sumerrbmid sumerrbmdi sumerrbdmi sumerrbdim sumerribmd sumerribdm sumerrimbd sumerrimdb sumerridmb sumerridbm
sumerrmibd sumerrmidb sumerrmbid sumerrmbdi sumerrmdbi sumerrmdib sumerrdimb sumerrdibm sumerrdmib sumerrdmbi sumerrdbmi
sumerrdbim sumerdbirm sumerdbimr sumerdbrim sumerdbrmi sumerdbmri sumerdbmir sumerdibrm sumerdibmr sumerdirbm sumerdirmb
sumerdimrb sumerdimbr sumerdribm sumerdrimb sumerdrbim sumerdrbmi sumerdrmbi sumerdrmib sumerdmirb sumerdmibr sumerdmrib
sumerdmrbi sumerdmbri sumerdmbir sumebrmird sumebrmidr sumebrmrid sumebrmrdi sumebrmdri sumebrmdir sumebrimrd sumebrimdr
sumebrirmd sumebrirdm sumebridrm sumebridmr sumebrrimd sumebrridm sumebrrmid sumebrrmdi sumebrrdmi sumebrrdim sumebrdirm
sumebrdimr sumebrdrim sumebrdrmi sumebrdmri sumebrdmir sumebmrird sumebmridr sumebmrrid sumebmrrdi sumebmrdri sumebmrdir
sumebmirrd sumebmirdr sumebmirrd sumebmirdr sumebmidrr sumebmidrr sumebmrird sumebmridr sumebmrrid sumebmrrdi sumebmrdri
sumebmrdir sumebmdirr sumebmdirr sumebmdrir sumebmdrri sumebmdrri sumebmdrir sumebimrrd sumebimrdr sumebimrrd sumebimrdr
sumebimdrr sumebimdrr sumebirmrd sumebirmdr sumebirrmd sumebirrdm sumebirdrm sumebirdmr sumebirrmd sumebirrdm sumebirmrd
sumebirmdr sumebirdmr sumebirdrm sumebidrrm sumebidrmr sumebidrrm sumebidrmr sumebidmrr sumebidmrr sumebrmird sumebrmidr
sumebrmrid sumebrmrdi sumebrmdri sumebrmdir sumebrimrd sumebrimdr sumebrirmd sumebrirdm sumebridrm sumebridmr sumebrrimd
sumebrridm sumebrrmid sumebrrmdi sumebrrdmi sumebrrdim sumebrdirm sumebrdimr sumebrdrim sumebrdrmi sumebrdmri sumebrdmir
sumebdmirr sumebdmirr sumebdmrir sumebdmrri sumebdmrri sumebdmrir sumebdimrr sumebdimrr sumebdirmr sumebdirrm sumebdirrm
sumebdirmr sumebdrimr sumebdrirm sumebdrmir sumebdrmri sumebdrrmi sumebdrrim sumebdrirm sumebdrimr sumebdrrim sumebdrrmi
sumebdrmri sumebdrmir sumeirbmrd sumeirbmdr sumeirbrmd sumeirbrdm sumeirbdrm sumeirbdmr sumeirmbrd sumeirmbdr sumeirmrbd
sumeirmrdb sumeirmdrb sumeirmdbr sumeirrmbd sumeirrmdb sumeirrbmd sumeirrbdm sumeirrdbm sumeirrdmb sumeirdmrb sumeirdmbr
sumeirdrmb sumeirdrbm sumeirdbrm sumeirdbmr sumeibrmrd sumeibrmdr sumeibrrmd sumeibrrdm sumeibrdrm sumeibrdmr sumeibmrrd
sumeibmrdr sumeibmrrd sumeibmrdr sumeibmdrr sumeibmdrr sumeibrmrd sumeibrmdr sumeibrrmd sumeibrrdm sumeibrdrm sumeibrdmr
sumeibdmrr sumeibdmrr sumeibdrmr sumeibdrrm sumeibdrrm sumeibdrmr sumeimbrrd sumeimbrdr sumeimbrrd sumeimbrdr sumeimbdrr
sumeimbdrr sumeimrbrd sumeimrbdr sumeimrrbd sumeimrrdb sumeimrdrb sumeimrdbr sumeimrrbd sumeimrrdb sumeimrbrd sumeimrbdr
sumeimrdbr sumeimrdrb sumeimdrrb sumeimdrbr sumeimdrrb sumeimdrbr sumeimdbrr sumeimdbrr sumeirbmrd sumeirbmdr sumeirbrmd
sumeirbrdm sumeirbdrm sumeirbdmr sumeirmbrd sumeirmbdr sumeirmrbd sumeirmrdb sumeirmdrb sumeirmdbr sumeirrmbd sumeirrmdb
sumeirrbmd sumeirrbdm sumeirrdbm sumeirrdmb sumeirdmrb sumeirdmbr sumeirdrmb sumeirdrbm sumeirdbrm sumeirdbmr sumeidbmrr
sumeidbmrr sumeidbrmr sumeidbrrm sumeidbrrm sumeidbrmr sumeidmbrr sumeidmbrr sumeidmrbr sumeidmrrb sumeidmrrb sumeidmrbr
sumeidrmbr sumeidrmrb sumeidrbmr sumeidrbrm sumeidrrbm sumeidrrmb sumeidrmrb sumeidrmbr sumeidrrmb sumeidrrbm sumeidrbrm
sumeidrbmr sumerrbimd sumerrbidm sumerrbmid sumerrbmdi sumerrbdmi sumerrbdim sumerribmd sumerribdm sumerrimbd sumerrimdb
sumerridmb sumerridbm sumerrmibd sumerrmidb sumerrmbid sumerrmbdi sumerrmdbi sumerrmdib sumerrdimb sumerrdibm sumerrdmib
sumerrdmbi sumerrdbmi sumerrdbim sumerbrimd sumerbridm sumerbrmid sumerbrmdi sumerbrdmi sumerbrdim sumerbirmd sumerbirdm
sumerbimrd sumerbimdr sumerbidmr sumerbidrm sumerbmird sumerbmidr sumerbmrid sumerbmrdi sumerbmdri sumerbmdir sumerbdimr
sumerbdirm sumerbdmir sumerbdmri sumerbdrmi sumerbdrim sumeribrmd sumeribrdm sumeribmrd sumeribmdr sumeribdmr sumeribdrm
sumerirbmd sumerirbdm sumerirmbd sumerirmdb sumerirdmb sumerirdbm sumerimrbd sumerimrdb sumerimbrd sumerimbdr sumerimdbr
sumerimdrb sumeridrmb sumeridrbm sumeridmrb sumeridmbr sumeridbmr sumeridbrm sumermbird sumermbidr sumermbrid sumermbrdi
sumermbdri sumermbdir sumermibrd sumermibdr sumermirbd sumermirdb sumermidrb sumermidbr sumermribd sumermridb sumermrbid
sumermrbdi sumermrdbi sumermrdib sumermdirb sumermdibr sumermdrib sumermdrbi sumermdbri sumermdbir sumerdbimr sumerdbirm
sumerdbmir sumerdbmri sumerdbrmi sumerdbrim sumerdibmr sumerdibrm sumerdimbr sumerdimrb sumerdirmb sumerdirbm sumerdmibr
sumerdmirb sumerdmbir sumerdmbri sumerdmrbi sumerdmrib sumerdrimb sumerdribm sumerdrmib sumerdrmbi sumerdrbmi sumerdrbim
sumedrbirm sumedrbimr sumedrbrim sumedrbrmi sumedrbmri sumedrbmir sumedribrm sumedribmr sumedrirbm sumedrirmb sumedrimrb
sumedrimbr sumedrribm sumedrrimb sumedrrbim sumedrrbmi sumedrrmbi sumedrrmib sumedrmirb sumedrmibr sumedrmrib sumedrmrbi
sumedrmbri sumedrmbir sumedbrirm sumedbrimr sumedbrrim sumedbrrmi sumedbrmri sumedbrmir sumedbirrm sumedbirmr sumedbirrm
sumedbirmr sumedbimrr sumedbimrr sumedbrirm sumedbrimr sumedbrrim sumedbrrmi sumedbrmri sumedbrmir sumedbmirr sumedbmirr
sumedbmrir sumedbmrri sumedbmrri sumedbmrir sumedibrrm sumedibrmr sumedibrrm sumedibrmr sumedibmrr sumedibmrr sumedirbrm
sumedirbmr sumedirrbm sumedirrmb sumedirmrb sumedirmbr sumedirrbm sumedirrmb sumedirbrm sumedirbmr sumedirmbr sumedirmrb
sumedimrrb sumedimrbr sumedimrrb sumedimrbr sumedimbrr sumedimbrr sumedrbirm sumedrbimr sumedrbrim sumedrbrmi sumedrbmri
sumedrbmir sumedribrm sumedribmr sumedrirbm sumedrirmb sumedrimrb sumedrimbr sumedrribm sumedrrimb sumedrrbim sumedrrbmi
sumedrrmbi sumedrrmib sumedrmirb sumedrmibr sumedrmrib sumedrmrbi sumedrmbri sumedrmbir sumedmbirr sumedmbirr sumedmbrir
sumedmbrri sumedmbrri sumedmbrir sumedmibrr sumedmibrr sumedmirbr sumedmirrb sumedmirrb sumedmirbr sumedmribr sumedmrirb
sumedmrbir sumedmrbri sumedmrrbi sumedmrrib sumedmrirb sumedmribr sumedmrrib sumedmrrbi sumedmrbri sumedmrbir sumrembird
sumrembidr sumrembrid sumrembrdi sumrembdri sumrembdir sumremibrd sumremibdr sumremirbd sumremirdb sumremidrb sumremidbr
sumremribd sumremridb sumremrbid sumremrbdi sumremrdbi sumremrdib sumremdirb sumremdibr sumremdrib sumremdrbi sumremdbri
sumremdbir sumrebmird sumrebmidr sumrebmrid sumrebmrdi sumrebmdri sumrebmdir sumrebimrd sumrebimdr sumrebirmd sumrebirdm
sumrebidrm sumrebidmr sumrebrimd sumrebridm sumrebrmid sumrebrmdi sumrebrdmi sumrebrdim sumrebdirm sumrebdimr sumrebdrim
sumrebdrmi sumrebdmri sumrebdmir sumreibmrd sumreibmdr sumreibrmd sumreibrdm sumreibdrm sumreibdmr sumreimbrd sumreimbdr
sumreimrbd sumreimrdb sumreimdrb sumreimdbr sumreirmbd sumreirmdb sumreirbmd sumreirbdm sumreirdbm sumreirdmb sumreidmrb
sumreidmbr sumreidrmb sumreidrbm sumreidbrm sumreidbmr sumrerbimd sumrerbidm sumrerbmid sumrerbmdi sumrerbdmi sumrerbdim
sumreribmd sumreribdm sumrerimbd sumrerimdb sumreridmb sumreridbm sumrermibd sumrermidb sumrermbid sumrermbdi sumrermdbi
sumrermdib sumrerdimb sumrerdibm sumrerdmib sumrerdmbi sumrerdbmi sumrerdbim sumredbirm sumredbimr sumredbrim sumredbrmi
sumredbmri sumredbmir sumredibrm sumredibmr sumredirbm sumredirmb sumredimrb sumredimbr sumredribm sumredrimb sumredrbim
sumredrbmi sumredrmbi sumredrmib sumredmirb sumredmibr sumredmrib sumredmrbi sumredmbri sumredmbir sumrmebird sumrmebidr
sumrmebrid sumrmebrdi sumrmebdri sumrmebdir sumrmeibrd sumrmeibdr sumrmeirbd sumrmeirdb sumrmeidrb sumrmeidbr sumrmeribd
sumrmeridb sumrmerbid sumrmerbdi sumrmerdbi sumrmerdib sumrmedirb sumrmedibr sumrmedrib sumrmedrbi sumrmedbri sumrmedbir
sumrmbeird sumrmbeidr sumrmberid sumrmberdi sumrmbedri sumrmbedir sumrmbierd sumrmbiedr sumrmbired sumrmbirde sumrmbidre
sumrmbider sumrmbried sumrmbride sumrmbreid sumrmbredi sumrmbrdei sumrmbrdie sumrmbdire sumrmbdier sumrmbdrie sumrmbdrei
sumrmbderi sumrmbdeir sumrmiberd sumrmibedr sumrmibred sumrmibrde sumrmibdre sumrmibder sumrmiebrd sumrmiebdr sumrmierbd
sumrmierdb sumrmiedrb sumrmiedbr sumrmirebd sumrmiredb sumrmirbed sumrmirbde sumrmirdbe sumrmirdeb sumrmiderb sumrmidebr
sumrmidreb sumrmidrbe sumrmidbre sumrmidber sumrmrbied sumrmrbide sumrmrbeid sumrmrbedi sumrmrbdei sumrmrbdie sumrmribed
sumrmribde sumrmriebd sumrmriedb sumrmrideb sumrmridbe sumrmreibd sumrmreidb sumrmrebid sumrmrebdi sumrmredbi sumrmredib
sumrmrdieb sumrmrdibe sumrmrdeib sumrmrdebi sumrmrdbei sumrmrdbie sumrmdbire sumrmdbier sumrmdbrie sumrmdbrei sumrmdberi
sumrmdbeir sumrmdibre sumrmdiber sumrmdirbe sumrmdireb sumrmdierb sumrmdiebr sumrmdribe sumrmdrieb sumrmdrbie sumrmdrbei
sumrmdrebi sumrmdreib sumrmdeirb sumrmdeibr sumrmderib sumrmderbi sumrmdebri sumrmdebir sumrbmeird sumrbmeidr sumrbmerid
sumrbmerdi sumrbmedri sumrbmedir sumrbmierd sumrbmiedr sumrbmired sumrbmirde sumrbmidre sumrbmider sumrbmried sumrbmride
sumrbmreid sumrbmredi sumrbmrdei sumrbmrdie sumrbmdire sumrbmdier sumrbmdrie sumrbmdrei sumrbmderi sumrbmdeir sumrbemird
sumrbemidr sumrbemrid sumrbemrdi sumrbemdri sumrbemdir sumrbeimrd sumrbeimdr sumrbeirmd sumrbeirdm sumrbeidrm sumrbeidmr
sumrberimd sumrberidm sumrbermid sumrbermdi sumrberdmi sumrberdim sumrbedirm sumrbedimr sumrbedrim sumrbedrmi sumrbedmri
sumrbedmir sumrbiemrd sumrbiemdr sumrbiermd sumrbierdm sumrbiedrm sumrbiedmr sumrbimerd sumrbimedr sumrbimred sumrbimrde
sumrbimdre sumrbimder sumrbirmed sumrbirmde sumrbiremd sumrbiredm sumrbirdem sumrbirdme sumrbidmre sumrbidmer sumrbidrme
sumrbidrem sumrbiderm sumrbidemr sumrbreimd sumrbreidm sumrbremid sumrbremdi sumrbredmi sumrbredim sumrbriemd sumrbriedm
sumrbrimed sumrbrimde sumrbridme sumrbridem sumrbrmied sumrbrmide sumrbrmeid sumrbrmedi sumrbrmdei sumrbrmdie sumrbrdime
sumrbrdiem sumrbrdmie sumrbrdmei sumrbrdemi sumrbrdeim sumrbdeirm sumrbdeimr sumrbderim sumrbdermi sumrbdemri sumrbdemir
sumrbdierm sumrbdiemr sumrbdirem sumrbdirme sumrbdimre sumrbdimer sumrbdriem sumrbdrime sumrbdreim sumrbdremi sumrbdrmei
sumrbdrmie sumrbdmire sumrbdmier sumrbdmrie sumrbdmrei sumrbdmeri sumrbdmeir sumrimberd sumrimbedr sumrimbred sumrimbrde
sumrimbdre sumrimbder sumrimebrd sumrimebdr sumrimerbd sumrimerdb sumrimedrb sumrimedbr sumrimrebd sumrimredb sumrimrbed
sumrimrbde sumrimrdbe sumrimrdeb sumrimderb sumrimdebr sumrimdreb sumrimdrbe sumrimdbre sumrimdber sumribmerd sumribmedr
sumribmred sumribmrde sumribmdre sumribmder sumribemrd sumribemdr sumribermd sumriberdm sumribedrm sumribedmr sumribremd
sumribredm sumribrmed sumribrmde sumribrdme sumribrdem sumribderm sumribdemr sumribdrem sumribdrme sumribdmre sumribdmer
sumriebmrd sumriebmdr sumriebrmd sumriebrdm sumriebdrm sumriebdmr sumriembrd sumriembdr sumriemrbd sumriemrdb sumriemdrb
sumriemdbr sumriermbd sumriermdb sumrierbmd sumrierbdm sumrierdbm sumrierdmb sumriedmrb sumriedmbr sumriedrmb sumriedrbm
sumriedbrm sumriedbmr sumrirbemd sumrirbedm sumrirbmed sumrirbmde sumrirbdme sumrirbdem sumrirebmd sumrirebdm sumrirembd
sumriremdb sumriredmb sumriredbm sumrirmebd sumrirmedb sumrirmbed sumrirmbde sumrirmdbe sumrirmdeb sumrirdemb sumrirdebm
sumrirdmeb sumrirdmbe sumrirdbme sumrirdbem sumridberm sumridbemr sumridbrem sumridbrme sumridbmre sumridbmer sumridebrm
sumridebmr sumriderbm sumridermb sumridemrb sumridembr sumridrebm sumridremb sumridrbem sumridrbme sumridrmbe sumridrmeb
sumridmerb sumridmebr sumridmreb sumridmrbe sumridmbre sumridmber sumrrmbied sumrrmbide sumrrmbeid sumrrmbedi sumrrmbdei
sumrrmbdie sumrrmibed sumrrmibde sumrrmiebd sumrrmiedb sumrrmideb sumrrmidbe sumrrmeibd sumrrmeidb sumrrmebid sumrrmebdi
sumrrmedbi sumrrmedib sumrrmdieb sumrrmdibe sumrrmdeib sumrrmdebi sumrrmdbei sumrrmdbie sumrrbmied sumrrbmide sumrrbmeid
sumrrbmedi sumrrbmdei sumrrbmdie sumrrbimed sumrrbimde sumrrbiemd sumrrbiedm sumrrbidem sumrrbidme sumrrbeimd sumrrbeidm
sumrrbemid sumrrbemdi sumrrbedmi sumrrbedim sumrrbdiem sumrrbdime sumrrbdeim sumrrbdemi sumrrbdmei sumrrbdmie sumrribmed
sumrribmde sumrribemd sumrribedm sumrribdem sumrribdme sumrrimbed sumrrimbde sumrrimebd sumrrimedb sumrrimdeb sumrrimdbe
sumrriembd sumrriemdb sumrriebmd sumrriebdm sumrriedbm sumrriedmb sumrridmeb sumrridmbe sumrridemb sumrridebm sumrridbem
sumrridbme sumrrebimd sumrrebidm sumrrebmid sumrrebmdi sumrrebdmi sumrrebdim sumrreibmd sumrreibdm sumrreimbd sumrreimdb
sumrreidmb sumrreidbm sumrremibd sumrremidb sumrrembid sumrrembdi sumrremdbi sumrremdib sumrredimb sumrredibm sumrredmib
sumrredmbi sumrredbmi sumrredbim sumrrdbiem sumrrdbime sumrrdbeim sumrrdbemi sumrrdbmei sumrrdbmie sumrrdibem sumrrdibme
sumrrdiebm sumrrdiemb sumrrdimeb sumrrdimbe sumrrdeibm sumrrdeimb sumrrdebim sumrrdebmi sumrrdembi sumrrdemib sumrrdmieb
sumrrdmibe sumrrdmeib sumrrdmebi sumrrdmbei sumrrdmbie sumrdmbire sumrdmbier sumrdmbrie sumrdmbrei sumrdmberi sumrdmbeir
sumrdmibre sumrdmiber sumrdmirbe sumrdmireb sumrdmierb sumrdmiebr sumrdmribe sumrdmrieb sumrdmrbie sumrdmrbei sumrdmrebi
sumrdmreib sumrdmeirb sumrdmeibr sumrdmerib sumrdmerbi sumrdmebri sumrdmebir sumrdbmire sumrdbmier sumrdbmrie sumrdbmrei
sumrdbmeri sumrdbmeir sumrdbimre sumrdbimer sumrdbirme sumrdbirem sumrdbierm sumrdbiemr sumrdbrime sumrdbriem sumrdbrmie
sumrdbrmei sumrdbremi sumrdbreim sumrdbeirm sumrdbeimr sumrdberim sumrdbermi sumrdbemri sumrdbemir sumrdibmre sumrdibmer
sumrdibrme sumrdibrem sumrdiberm sumrdibemr sumrdimbre sumrdimber sumrdimrbe sumrdimreb sumrdimerb sumrdimebr sumrdirmbe
sumrdirmeb sumrdirbme sumrdirbem sumrdirebm sumrdiremb sumrdiemrb sumrdiembr sumrdiermb sumrdierbm sumrdiebrm sumrdiebmr
sumrdrbime sumrdrbiem sumrdrbmie sumrdrbmei sumrdrbemi sumrdrbeim sumrdribme sumrdribem sumrdrimbe sumrdrimeb sumrdriemb
sumrdriebm sumrdrmibe sumrdrmieb sumrdrmbie sumrdrmbei sumrdrmebi sumrdrmeib sumrdreimb sumrdreibm sumrdremib sumrdrembi
sumrdrebmi sumrdrebim sumrdebirm sumrdebimr sumrdebrim sumrdebrmi sumrdebmri sumrdebmir sumrdeibrm sumrdeibmr sumrdeirbm
sumrdeirmb sumrdeimrb sumrdeimbr sumrderibm sumrderimb sumrderbim sumrderbmi sumrdermbi sumrdermib sumrdemirb sumrdemibr
sumrdemrib sumrdemrbi sumrdembri sumrdembir sumbermird sumbermidr sumbermrid sumbermrdi sumbermdri sumbermdir sumberimrd
sumberimdr sumberirmd sumberirdm sumberidrm sumberidmr sumberrimd sumberridm sumberrmid sumberrmdi sumberrdmi sumberrdim
sumberdirm sumberdimr sumberdrim sumberdrmi sumberdmri sumberdmir sumbemrird sumbemridr sumbemrrid sumbemrrdi sumbemrdri
sumbemrdir sumbemirrd sumbemirdr sumbemirrd sumbemirdr sumbemidrr sumbemidrr sumbemrird sumbemridr sumbemrrid sumbemrrdi
sumbemrdri sumbemrdir sumbemdirr sumbemdirr sumbemdrir sumbemdrri sumbemdrri sumbemdrir sumbeimrrd sumbeimrdr sumbeimrrd
sumbeimrdr sumbeimdrr sumbeimdrr sumbeirmrd sumbeirmdr sumbeirrmd sumbeirrdm sumbeirdrm sumbeirdmr sumbeirrmd sumbeirrdm
sumbeirmrd sumbeirmdr sumbeirdmr sumbeirdrm sumbeidrrm sumbeidrmr sumbeidrrm sumbeidrmr sumbeidmrr sumbeidmrr sumbermird
sumbermidr sumbermrid sumbermrdi sumbermdri sumbermdir sumberimrd sumberimdr sumberirmd sumberirdm sumberidrm sumberidmr
sumberrimd sumberridm sumberrmid sumberrmdi sumberrdmi sumberrdim sumberdirm sumberdimr sumberdrim sumberdrmi sumberdmri
sumberdmir sumbedmirr sumbedmirr sumbedmrir sumbedmrri sumbedmrri sumbedmrir sumbedimrr sumbedimrr sumbedirmr sumbedirrm
sumbedirrm sumbedirmr sumbedrimr sumbedrirm sumbedrmir sumbedrmri sumbedrrmi sumbedrrim sumbedrirm sumbedrimr sumbedrrim
sumbedrrmi sumbedrmri sumbedrmir sumbremird sumbremidr sumbremrid sumbremrdi sumbremdri sumbremdir sumbreimrd sumbreimdr
sumbreirmd sumbreirdm sumbreidrm sumbreidmr sumbrerimd sumbreridm sumbrermid sumbrermdi sumbrerdmi sumbrerdim sumbredirm
sumbredimr sumbredrim sumbredrmi sumbredmri sumbredmir sumbrmeird sumbrmeidr sumbrmerid sumbrmerdi sumbrmedri sumbrmedir
sumbrmierd sumbrmiedr sumbrmired sumbrmirde sumbrmidre sumbrmider sumbrmried sumbrmride sumbrmreid sumbrmredi sumbrmrdei
sumbrmrdie sumbrmdire sumbrmdier sumbrmdrie sumbrmdrei sumbrmderi sumbrmdeir sumbrimerd sumbrimedr sumbrimred sumbrimrde
sumbrimdre sumbrimder sumbriemrd sumbriemdr sumbriermd sumbrierdm sumbriedrm sumbriedmr sumbriremd sumbriredm sumbrirmed
sumbrirmde sumbrirdme sumbrirdem sumbriderm sumbridemr sumbridrem sumbridrme sumbridmre sumbridmer sumbrrmied sumbrrmide
sumbrrmeid sumbrrmedi sumbrrmdei sumbrrmdie sumbrrimed sumbrrimde sumbrriemd sumbrriedm sumbrridem sumbrridme sumbrreimd
sumbrreidm sumbrremid sumbrremdi sumbrredmi sumbrredim sumbrrdiem sumbrrdime sumbrrdeim sumbrrdemi sumbrrdmei sumbrrdmie
sumbrdmire sumbrdmier sumbrdmrie sumbrdmrei sumbrdmeri sumbrdmeir sumbrdimre sumbrdimer sumbrdirme sumbrdirem sumbrdierm
sumbrdiemr sumbrdrime sumbrdriem sumbrdrmie sumbrdrmei sumbrdremi sumbrdreim sumbrdeirm sumbrdeimr sumbrderim sumbrdermi
sumbrdemri sumbrdemir sumbmreird sumbmreidr sumbmrerid sumbmrerdi sumbmredri sumbmredir sumbmrierd sumbmriedr sumbmrired
sumbmrirde sumbmridre sumbmrider sumbmrried sumbmrride sumbmrreid sumbmrredi sumbmrrdei sumbmrrdie sumbmrdire sumbmrdier
sumbmrdrie sumbmrdrei sumbmrderi sumbmrdeir sumbmerird sumbmeridr sumbmerrid sumbmerrdi sumbmerdri sumbmerdir sumbmeirrd
sumbmeirdr sumbmeirrd sumbmeirdr sumbmeidrr sumbmeidrr sumbmerird sumbmeridr sumbmerrid sumbmerrdi sumbmerdri sumbmerdir
sumbmedirr sumbmedirr sumbmedrir sumbmedrri sumbmedrri sumbmedrir sumbmierrd sumbmierdr sumbmierrd sumbmierdr sumbmiedrr
sumbmiedrr sumbmirerd sumbmiredr sumbmirred sumbmirrde sumbmirdre sumbmirder sumbmirred sumbmirrde sumbmirerd sumbmiredr
sumbmirder sumbmirdre sumbmidrre sumbmidrer sumbmidrre sumbmidrer sumbmiderr sumbmiderr sumbmreird sumbmreidr sumbmrerid
sumbmrerdi sumbmredri sumbmredir sumbmrierd sumbmriedr sumbmrired sumbmrirde sumbmridre sumbmrider sumbmrried sumbmrride
sumbmrreid sumbmrredi sumbmrrdei sumbmrrdie sumbmrdire sumbmrdier sumbmrdrie sumbmrdrei sumbmrderi sumbmrdeir sumbmdeirr
sumbmdeirr sumbmderir sumbmderri sumbmderri sumbmderir sumbmdierr sumbmdierr sumbmdirer sumbmdirre sumbmdirre sumbmdirer
sumbmdrier sumbmdrire sumbmdreir sumbmdreri sumbmdrrei sumbmdrrie sumbmdrire sumbmdrier sumbmdrrie sumbmdrrei sumbmdreri
sumbmdreir sumbirmerd sumbirmedr sumbirmred sumbirmrde sumbirmdre sumbirmder sumbiremrd sumbiremdr sumbirermd sumbirerdm
sumbiredrm sumbiredmr sumbirremd sumbirredm sumbirrmed sumbirrmde sumbirrdme sumbirrdem sumbirderm sumbirdemr sumbirdrem
sumbirdrme sumbirdmre sumbirdmer sumbimrerd sumbimredr sumbimrred sumbimrrde sumbimrdre sumbimrder sumbimerrd sumbimerdr
sumbimerrd sumbimerdr sumbimedrr sumbimedrr sumbimrerd sumbimredr sumbimrred sumbimrrde sumbimrdre sumbimrder sumbimderr
sumbimderr sumbimdrer sumbimdrre sumbimdrre sumbimdrer sumbiemrrd sumbiemrdr sumbiemrrd sumbiemrdr sumbiemdrr sumbiemdrr
sumbiermrd sumbiermdr sumbierrmd sumbierrdm sumbierdrm sumbierdmr sumbierrmd sumbierrdm sumbiermrd sumbiermdr sumbierdmr
sumbierdrm sumbiedrrm sumbiedrmr sumbiedrrm sumbiedrmr sumbiedmrr sumbiedmrr sumbirmerd sumbirmedr sumbirmred sumbirmrde
sumbirmdre sumbirmder sumbiremrd sumbiremdr sumbirermd sumbirerdm sumbiredrm sumbiredmr sumbirremd sumbirredm sumbirrmed
sumbirrmde sumbirrdme sumbirrdem sumbirderm sumbirdemr sumbirdrem sumbirdrme sumbirdmre sumbirdmer sumbidmerr sumbidmerr
sumbidmrer sumbidmrre sumbidmrre sumbidmrer sumbidemrr sumbidemrr sumbidermr sumbiderrm sumbiderrm sumbidermr sumbidremr
sumbidrerm sumbidrmer sumbidrmre sumbidrrme sumbidrrem sumbidrerm sumbidremr sumbidrrem sumbidrrme sumbidrmre sumbidrmer
sumbrrmied sumbrrmide sumbrrmeid sumbrrmedi sumbrrmdei sumbrrmdie sumbrrimed sumbrrimde sumbrriemd sumbrriedm sumbrridem
sumbrridme sumbrreimd sumbrreidm sumbrremid sumbrremdi sumbrredmi sumbrredim sumbrrdiem sumbrrdime sumbrrdeim sumbrrdemi
sumbrrdmei sumbrrdmie sumbrmried sumbrmride sumbrmreid sumbrmredi sumbrmrdei sumbrmrdie sumbrmired sumbrmirde sumbrmierd
sumbrmiedr sumbrmider sumbrmidre sumbrmeird sumbrmeidr sumbrmerid sumbrmerdi sumbrmedri sumbrmedir sumbrmdier sumbrmdire
sumbrmdeir sumbrmderi sumbrmdrei sumbrmdrie sumbrimred sumbrimrde sumbrimerd sumbrimedr sumbrimder sumbrimdre sumbrirmed
sumbrirmde sumbriremd sumbriredm sumbrirdem sumbrirdme sumbriermd sumbrierdm sumbriemrd sumbriemdr sumbriedmr sumbriedrm
sumbridrem sumbridrme sumbriderm sumbridemr sumbridmer sumbridmre sumbremird sumbremidr sumbremrid sumbremrdi sumbremdri
sumbremdir sumbreimrd sumbreimdr sumbreirmd sumbreirdm sumbreidrm sumbreidmr sumbrerimd sumbreridm sumbrermid sumbrermdi
sumbrerdmi sumbrerdim sumbredirm sumbredimr sumbredrim sumbredrmi sumbredmri sumbredmir sumbrdmier sumbrdmire sumbrdmeir
sumbrdmeri sumbrdmrei sumbrdmrie sumbrdimer sumbrdimre sumbrdiemr sumbrdierm sumbrdirem sumbrdirme sumbrdeimr sumbrdeirm
sumbrdemir sumbrdemri sumbrdermi sumbrderim sumbrdriem sumbrdrime sumbrdreim sumbrdremi sumbrdrmei sumbrdrmie sumbdrmire
sumbdrmier sumbdrmrie sumbdrmrei sumbdrmeri sumbdrmeir sumbdrimre sumbdrimer sumbdrirme sumbdrirem sumbdrierm sumbdriemr
sumbdrrime sumbdrriem sumbdrrmie sumbdrrmei sumbdrremi sumbdrreim sumbdreirm sumbdreimr sumbdrerim sumbdrermi sumbdremri
sumbdremir sumbdmrire sumbdmrier sumbdmrrie sumbdmrrei sumbdmreri sumbdmreir sumbdmirre sumbdmirer sumbdmirre sumbdmirer
sumbdmierr sumbdmierr sumbdmrire sumbdmrier sumbdmrrie sumbdmrrei sumbdmreri sumbdmreir sumbdmeirr sumbdmeirr sumbdmerir
sumbdmerri sumbdmerri sumbdmerir sumbdimrre sumbdimrer sumbdimrre sumbdimrer sumbdimerr sumbdimerr sumbdirmre sumbdirmer
sumbdirrme sumbdirrem sumbdirerm sumbdiremr sumbdirrme sumbdirrem sumbdirmre sumbdirmer sumbdiremr sumbdirerm sumbdierrm
sumbdiermr sumbdierrm sumbdiermr sumbdiemrr sumbdiemrr sumbdrmire sumbdrmier sumbdrmrie sumbdrmrei sumbdrmeri sumbdrmeir
sumbdrimre sumbdrimer sumbdrirme sumbdrirem sumbdrierm sumbdriemr sumbdrrime sumbdrriem sumbdrrmie sumbdrrmei sumbdrremi
sumbdrreim sumbdreirm sumbdreimr sumbdrerim sumbdrermi sumbdremri sumbdremir sumbdemirr sumbdemirr sumbdemrir sumbdemrri
sumbdemrri sumbdemrir sumbdeimrr sumbdeimrr sumbdeirmr sumbdeirrm sumbdeirrm sumbdeirmr sumbderimr sumbderirm sumbdermir
sumbdermri sumbderrmi sumbderrim sumbderirm sumbderimr sumbderrim sumbderrmi sumbdermri sumbdermir sumierbmrd sumierbmdr
sumierbrmd sumierbrdm sumierbdrm sumierbdmr sumiermbrd sumiermbdr sumiermrbd sumiermrdb sumiermdrb sumiermdbr sumierrmbd
sumierrmdb sumierrbmd sumierrbdm sumierrdbm sumierrdmb sumierdmrb sumierdmbr sumierdrmb sumierdrbm sumierdbrm sumierdbmr
sumiebrmrd sumiebrmdr sumiebrrmd sumiebrrdm sumiebrdrm sumiebrdmr sumiebmrrd sumiebmrdr sumiebmrrd sumiebmrdr sumiebmdrr
sumiebmdrr sumiebrmrd sumiebrmdr sumiebrrmd sumiebrrdm sumiebrdrm sumiebrdmr sumiebdmrr sumiebdmrr sumiebdrmr sumiebdrrm
sumiebdrrm sumiebdrmr sumiembrrd sumiembrdr sumiembrrd sumiembrdr sumiembdrr sumiembdrr sumiemrbrd sumiemrbdr sumiemrrbd
sumiemrrdb sumiemrdrb sumiemrdbr sumiemrrbd sumiemrrdb sumiemrbrd sumiemrbdr sumiemrdbr sumiemrdrb sumiemdrrb sumiemdrbr
sumiemdrrb sumiemdrbr sumiemdbrr sumiemdbrr sumierbmrd sumierbmdr sumierbrmd sumierbrdm sumierbdrm sumierbdmr sumiermbrd
sumiermbdr sumiermrbd sumiermrdb sumiermdrb sumiermdbr sumierrmbd sumierrmdb sumierrbmd sumierrbdm sumierrdbm sumierrdmb
sumierdmrb sumierdmbr sumierdrmb sumierdrbm sumierdbrm sumierdbmr sumiedbmrr sumiedbmrr sumiedbrmr sumiedbrrm sumiedbrrm
sumiedbrmr sumiedmbrr sumiedmbrr sumiedmrbr sumiedmrrb sumiedmrrb sumiedmrbr sumiedrmbr sumiedrmrb sumiedrbmr sumiedrbrm
sumiedrrbm sumiedrrmb sumiedrmrb sumiedrmbr sumiedrrmb sumiedrrbm sumiedrbrm sumiedrbmr sumirebmrd sumirebmdr sumirebrmd
sumirebrdm sumirebdrm sumirebdmr sumirembrd sumirembdr sumiremrbd sumiremrdb sumiremdrb sumiremdbr sumirermbd sumirermdb
sumirerbmd sumirerbdm sumirerdbm sumirerdmb sumiredmrb sumiredmbr sumiredrmb sumiredrbm sumiredbrm sumiredbmr sumirbemrd
sumirbemdr sumirbermd sumirberdm sumirbedrm sumirbedmr sumirbmerd sumirbmedr sumirbmred sumirbmrde sumirbmdre sumirbmder
sumirbrmed sumirbrmde sumirbremd sumirbredm sumirbrdem sumirbrdme sumirbdmre sumirbdmer sumirbdrme sumirbdrem sumirbderm
sumirbdemr sumirmberd sumirmbedr sumirmbred sumirmbrde sumirmbdre sumirmbder sumirmebrd sumirmebdr sumirmerbd sumirmerdb
sumirmedrb sumirmedbr sumirmrebd sumirmredb sumirmrbed sumirmrbde sumirmrdbe sumirmrdeb sumirmderb sumirmdebr sumirmdreb
sumirmdrbe sumirmdbre sumirmdber sumirrbmed sumirrbmde sumirrbemd sumirrbedm sumirrbdem sumirrbdme sumirrmbed sumirrmbde
sumirrmebd sumirrmedb sumirrmdeb sumirrmdbe sumirrembd sumirremdb sumirrebmd sumirrebdm sumirredbm sumirredmb sumirrdmeb
sumirrdmbe sumirrdemb sumirrdebm sumirrdbem sumirrdbme sumirdbmre sumirdbmer sumirdbrme sumirdbrem sumirdberm sumirdbemr
sumirdmbre sumirdmber sumirdmrbe sumirdmreb sumirdmerb sumirdmebr sumirdrmbe sumirdrmeb sumirdrbme sumirdrbem sumirdrebm
sumirdremb sumirdemrb sumirdembr sumirdermb sumirderbm sumirdebrm sumirdebmr sumibremrd sumibremdr sumibrermd sumibrerdm
sumibredrm sumibredmr sumibrmerd sumibrmedr sumibrmred sumibrmrde sumibrmdre sumibrmder sumibrrmed sumibrrmde sumibrremd
sumibrredm sumibrrdem sumibrrdme sumibrdmre sumibrdmer sumibrdrme sumibrdrem sumibrderm sumibrdemr sumibermrd sumibermdr
sumiberrmd sumiberrdm sumiberdrm sumiberdmr sumibemrrd sumibemrdr sumibemrrd sumibemrdr sumibemdrr sumibemdrr sumibermrd
sumibermdr sumiberrmd sumiberrdm sumiberdrm sumiberdmr sumibedmrr sumibedmrr sumibedrmr sumibedrrm sumibedrrm sumibedrmr
sumibmerrd sumibmerdr sumibmerrd sumibmerdr sumibmedrr sumibmedrr sumibmrerd sumibmredr sumibmrred sumibmrrde sumibmrdre
sumibmrder sumibmrred sumibmrrde sumibmrerd sumibmredr sumibmrder sumibmrdre sumibmdrre sumibmdrer sumibmdrre sumibmdrer
sumibmderr sumibmderr sumibremrd sumibremdr sumibrermd sumibrerdm sumibredrm sumibredmr sumibrmerd sumibrmedr sumibrmred
sumibrmrde sumibrmdre sumibrmder sumibrrmed sumibrrmde sumibrremd sumibrredm sumibrrdem sumibrrdme sumibrdmre sumibrdmer
sumibrdrme sumibrdrem sumibrderm sumibrdemr sumibdemrr sumibdemrr sumibdermr sumibderrm sumibderrm sumibdermr sumibdmerr
sumibdmerr sumibdmrer sumibdmrre sumibdmrre sumibdmrer sumibdrmer sumibdrmre sumibdremr sumibdrerm sumibdrrem sumibdrrme
sumibdrmre sumibdrmer sumibdrrme sumibdrrem sumibdrerm sumibdremr sumimrberd sumimrbedr sumimrbred sumimrbrde sumimrbdre
sumimrbder sumimrebrd sumimrebdr sumimrerbd sumimrerdb sumimredrb sumimredbr sumimrrebd sumimrredb sumimrrbed sumimrrbde
sumimrrdbe sumimrrdeb sumimrderb sumimrdebr sumimrdreb sumimrdrbe sumimrdbre sumimrdber sumimbrerd sumimbredr sumimbrred
sumimbrrde sumimbrdre sumimbrder sumimberrd sumimberdr sumimberrd sumimberdr sumimbedrr sumimbedrr sumimbrerd sumimbredr
sumimbrred sumimbrrde sumimbrdre sumimbrder sumimbderr sumimbderr sumimbdrer sumimbdrre sumimbdrre sumimbdrer sumimebrrd
sumimebrdr sumimebrrd sumimebrdr sumimebdrr sumimebdrr sumimerbrd sumimerbdr sumimerrbd sumimerrdb sumimerdrb sumimerdbr
sumimerrbd sumimerrdb sumimerbrd sumimerbdr sumimerdbr sumimerdrb sumimedrrb sumimedrbr sumimedrrb sumimedrbr sumimedbrr
sumimedbrr sumimrberd sumimrbedr sumimrbred sumimrbrde sumimrbdre sumimrbder sumimrebrd sumimrebdr sumimrerbd sumimrerdb
sumimredrb sumimredbr sumimrrebd sumimrredb sumimrrbed sumimrrbde sumimrrdbe sumimrrdeb sumimrderb sumimrdebr sumimrdreb
sumimrdrbe sumimrdbre sumimrdber sumimdberr sumimdberr sumimdbrer sumimdbrre sumimdbrre sumimdbrer sumimdebrr sumimdebrr
sumimderbr sumimderrb sumimderrb sumimderbr sumimdrebr sumimdrerb sumimdrber sumimdrbre sumimdrrbe sumimdrreb sumimdrerb
sumimdrebr sumimdrreb sumimdrrbe sumimdrbre sumimdrber sumirrbmed sumirrbmde sumirrbemd sumirrbedm sumirrbdem sumirrbdme
sumirrmbed sumirrmbde sumirrmebd sumirrmedb sumirrmdeb sumirrmdbe sumirrembd sumirremdb sumirrebmd sumirrebdm sumirredbm
sumirredmb sumirrdmeb sumirrdmbe sumirrdemb sumirrdebm sumirrdbem sumirrdbme sumirbrmed sumirbrmde sumirbremd sumirbredm
sumirbrdem sumirbrdme sumirbmred sumirbmrde sumirbmerd sumirbmedr sumirbmder sumirbmdre sumirbemrd sumirbemdr sumirbermd
sumirberdm sumirbedrm sumirbedmr sumirbdmer sumirbdmre sumirbdemr sumirbderm sumirbdrem sumirbdrme sumirmbred sumirmbrde
sumirmberd sumirmbedr sumirmbder sumirmbdre sumirmrbed sumirmrbde sumirmrebd sumirmredb sumirmrdeb sumirmrdbe sumirmerbd
sumirmerdb sumirmebrd sumirmebdr sumirmedbr sumirmedrb sumirmdreb sumirmdrbe sumirmderb sumirmdebr sumirmdber sumirmdbre
sumirebmrd sumirebmdr sumirebrmd sumirebrdm sumirebdrm sumirebdmr sumirembrd sumirembdr sumiremrbd sumiremrdb sumiremdrb
sumiremdbr sumirermbd sumirermdb sumirerbmd sumirerbdm sumirerdbm sumirerdmb sumiredmrb sumiredmbr sumiredrmb sumiredrbm
sumiredbrm sumiredbmr sumirdbmer sumirdbmre sumirdbemr sumirdberm sumirdbrem sumirdbrme sumirdmber sumirdmbre sumirdmebr
sumirdmerb sumirdmreb sumirdmrbe sumirdembr sumirdemrb sumirdebmr sumirdebrm sumirderbm sumirdermb sumirdrmeb sumirdrmbe
sumirdremb sumirdrebm sumirdrbem sumirdrbme sumidrbmre sumidrbmer sumidrbrme sumidrbrem sumidrberm sumidrbemr sumidrmbre
sumidrmber sumidrmrbe sumidrmreb sumidrmerb sumidrmebr sumidrrmbe sumidrrmeb sumidrrbme sumidrrbem sumidrrebm sumidrremb
sumidremrb sumidrembr sumidrermb sumidrerbm sumidrebrm sumidrebmr sumidbrmre sumidbrmer sumidbrrme sumidbrrem sumidbrerm
sumidbremr sumidbmrre sumidbmrer sumidbmrre sumidbmrer sumidbmerr sumidbmerr sumidbrmre sumidbrmer sumidbrrme sumidbrrem
sumidbrerm sumidbremr sumidbemrr sumidbemrr sumidbermr sumidberrm sumidberrm sumidbermr sumidmbrre sumidmbrer sumidmbrre
sumidmbrer sumidmberr sumidmberr sumidmrbre sumidmrber sumidmrrbe sumidmrreb sumidmrerb sumidmrebr sumidmrrbe sumidmrreb
sumidmrbre sumidmrber sumidmrebr sumidmrerb sumidmerrb sumidmerbr sumidmerrb sumidmerbr sumidmebrr sumidmebrr sumidrbmre
sumidrbmer sumidrbrme sumidrbrem sumidrberm sumidrbemr sumidrmbre sumidrmber sumidrmrbe sumidrmreb sumidrmerb sumidrmebr
sumidrrmbe sumidrrmeb sumidrrbme sumidrrbem sumidrrebm sumidrremb sumidremrb sumidrembr sumidrermb sumidrerbm sumidrebrm
sumidrebmr sumidebmrr sumidebmrr sumidebrmr sumidebrrm sumidebrrm sumidebrmr sumidembrr sumidembrr sumidemrbr sumidemrrb
sumidemrrb sumidemrbr sumidermbr sumidermrb sumiderbmr sumiderbrm sumiderrbm sumiderrmb sumidermrb sumidermbr sumiderrmb
sumiderrbm sumiderbrm sumiderbmr sumrerbimd sumrerbidm sumrerbmid sumrerbmdi sumrerbdmi sumrerbdim sumreribmd sumreribdm
sumrerimbd sumrerimdb sumreridmb sumreridbm sumrermibd sumrermidb sumrermbid sumrermbdi sumrermdbi sumrermdib sumrerdimb
sumrerdibm sumrerdmib sumrerdmbi sumrerdbmi sumrerdbim sumrebrimd sumrebridm sumrebrmid sumrebrmdi sumrebrdmi sumrebrdim
sumrebirmd sumrebirdm sumrebimrd sumrebimdr sumrebidmr sumrebidrm sumrebmird sumrebmidr sumrebmrid sumrebmrdi sumrebmdri
sumrebmdir sumrebdimr sumrebdirm sumrebdmir sumrebdmri sumrebdrmi sumrebdrim sumreibrmd sumreibrdm sumreibmrd sumreibmdr
sumreibdmr sumreibdrm sumreirbmd sumreirbdm sumreirmbd sumreirmdb sumreirdmb sumreirdbm sumreimrbd sumreimrdb sumreimbrd
sumreimbdr sumreimdbr sumreimdrb sumreidrmb sumreidrbm sumreidmrb sumreidmbr sumreidbmr sumreidbrm sumrembird sumrembidr
sumrembrid sumrembrdi sumrembdri sumrembdir sumremibrd sumremibdr sumremirbd sumremirdb sumremidrb sumremidbr sumremribd
sumremridb sumremrbid sumremrbdi sumremrdbi sumremrdib sumremdirb sumremdibr sumremdrib sumremdrbi sumremdbri sumremdbir
sumredbimr sumredbirm sumredbmir sumredbmri sumredbrmi sumredbrim sumredibmr sumredibrm sumredimbr sumredimrb sumredirmb
sumredirbm sumredmibr sumredmirb sumredmbir sumredmbri sumredmrbi sumredmrib sumredrimb sumredribm sumredrmib sumredrmbi
sumredrbmi sumredrbim sumrrebimd sumrrebidm sumrrebmid sumrrebmdi sumrrebdmi sumrrebdim sumrreibmd sumrreibdm sumrreimbd
sumrreimdb sumrreidmb sumrreidbm sumrremibd sumrremidb sumrrembid sumrrembdi sumrremdbi sumrremdib sumrredimb sumrredibm
sumrredmib sumrredmbi sumrredbmi sumrredbim sumrrbeimd sumrrbeidm sumrrbemid sumrrbemdi sumrrbedmi sumrrbedim sumrrbiemd
sumrrbiedm sumrrbimed sumrrbimde sumrrbidme sumrrbidem sumrrbmied sumrrbmide sumrrbmeid sumrrbmedi sumrrbmdei sumrrbmdie
sumrrbdime sumrrbdiem sumrrbdmie sumrrbdmei sumrrbdemi sumrrbdeim sumrribemd sumrribedm sumrribmed sumrribmde sumrribdme
sumrribdem sumrriebmd sumrriebdm sumrriembd sumrriemdb sumrriedmb sumrriedbm sumrrimebd sumrrimedb sumrrimbed sumrrimbde
sumrrimdbe sumrrimdeb sumrridemb sumrridebm sumrridmeb sumrridmbe sumrridbme sumrridbem sumrrmbied sumrrmbide sumrrmbeid
sumrrmbedi sumrrmbdei sumrrmbdie sumrrmibed sumrrmibde sumrrmiebd sumrrmiedb sumrrmideb sumrrmidbe sumrrmeibd sumrrmeidb
sumrrmebid sumrrmebdi sumrrmedbi sumrrmedib sumrrmdieb sumrrmdibe sumrrmdeib sumrrmdebi sumrrmdbei sumrrmdbie sumrrdbime
sumrrdbiem sumrrdbmie sumrrdbmei sumrrdbemi sumrrdbeim sumrrdibme sumrrdibem sumrrdimbe sumrrdimeb sumrrdiemb sumrrdiebm
sumrrdmibe sumrrdmieb sumrrdmbie sumrrdmbei sumrrdmebi sumrrdmeib sumrrdeimb sumrrdeibm sumrrdemib sumrrdembi sumrrdebmi
sumrrdebim sumrbreimd sumrbreidm sumrbremid sumrbremdi sumrbredmi sumrbredim sumrbriemd sumrbriedm sumrbrimed sumrbrimde
sumrbridme sumrbridem sumrbrmied sumrbrmide sumrbrmeid sumrbrmedi sumrbrmdei sumrbrmdie sumrbrdime sumrbrdiem sumrbrdmie
sumrbrdmei sumrbrdemi sumrbrdeim sumrberimd sumrberidm sumrbermid sumrbermdi sumrberdmi sumrberdim sumrbeirmd sumrbeirdm
sumrbeimrd sumrbeimdr sumrbeidmr sumrbeidrm sumrbemird sumrbemidr sumrbemrid sumrbemrdi sumrbemdri sumrbemdir sumrbedimr
sumrbedirm sumrbedmir sumrbedmri sumrbedrmi sumrbedrim sumrbiermd sumrbierdm sumrbiemrd sumrbiemdr sumrbiedmr sumrbiedrm
sumrbiremd sumrbiredm sumrbirmed sumrbirmde sumrbirdme sumrbirdem sumrbimred sumrbimrde sumrbimerd sumrbimedr sumrbimder
sumrbimdre sumrbidrme sumrbidrem sumrbidmre sumrbidmer sumrbidemr sumrbiderm sumrbmeird sumrbmeidr sumrbmerid sumrbmerdi
sumrbmedri sumrbmedir sumrbmierd sumrbmiedr sumrbmired sumrbmirde sumrbmidre sumrbmider sumrbmried sumrbmride sumrbmreid
sumrbmredi sumrbmrdei sumrbmrdie sumrbmdire sumrbmdier sumrbmdrie sumrbmdrei sumrbmderi sumrbmdeir sumrbdeimr sumrbdeirm
sumrbdemir sumrbdemri sumrbdermi sumrbderim sumrbdiemr sumrbdierm sumrbdimer sumrbdimre sumrbdirme sumrbdirem sumrbdmier
sumrbdmire sumrbdmeir sumrbdmeri sumrbdmrei sumrbdmrie sumrbdrime sumrbdriem sumrbdrmie sumrbdrmei sumrbdremi sumrbdreim
sumrirbemd sumrirbedm sumrirbmed sumrirbmde sumrirbdme sumrirbdem sumrirebmd sumrirebdm sumrirembd sumriremdb sumriredmb
sumriredbm sumrirmebd sumrirmedb sumrirmbed sumrirmbde sumrirmdbe sumrirmdeb sumrirdemb sumrirdebm sumrirdmeb sumrirdmbe
sumrirdbme sumrirdbem sumribremd sumribredm sumribrmed sumribrmde sumribrdme sumribrdem sumribermd sumriberdm sumribemrd
sumribemdr sumribedmr sumribedrm sumribmerd sumribmedr sumribmred sumribmrde sumribmdre sumribmder sumribdemr sumribderm
sumribdmer sumribdmre sumribdrme sumribdrem sumriebrmd sumriebrdm sumriebmrd sumriebmdr sumriebdmr sumriebdrm sumrierbmd
sumrierbdm sumriermbd sumriermdb sumrierdmb sumrierdbm sumriemrbd sumriemrdb sumriembrd sumriembdr sumriemdbr sumriemdrb
sumriedrmb sumriedrbm sumriedmrb sumriedmbr sumriedbmr sumriedbrm sumrimberd sumrimbedr sumrimbred sumrimbrde sumrimbdre
sumrimbder sumrimebrd sumrimebdr sumrimerbd sumrimerdb sumrimedrb sumrimedbr sumrimrebd sumrimredb sumrimrbed sumrimrbde
sumrimrdbe sumrimrdeb sumrimderb sumrimdebr sumrimdreb sumrimdrbe sumrimdbre sumrimdber sumridbemr sumridberm sumridbmer
sumridbmre sumridbrme sumridbrem sumridebmr sumridebrm sumridembr sumridemrb sumridermb sumriderbm sumridmebr sumridmerb
sumridmber sumridmbre sumridmrbe sumridmreb sumridremb sumridrebm sumridrmeb sumridrmbe sumridrbme sumridrbem sumrmrbied
sumrmrbide sumrmrbeid sumrmrbedi sumrmrbdei sumrmrbdie sumrmribed sumrmribde sumrmriebd sumrmriedb sumrmrideb sumrmridbe
sumrmreibd sumrmreidb sumrmrebid sumrmrebdi sumrmredbi sumrmredib sumrmrdieb sumrmrdibe sumrmrdeib sumrmrdebi sumrmrdbei
sumrmrdbie sumrmbried sumrmbride sumrmbreid sumrmbredi sumrmbrdei sumrmbrdie sumrmbired sumrmbirde sumrmbierd sumrmbiedr
sumrmbider sumrmbidre sumrmbeird sumrmbeidr sumrmberid sumrmberdi sumrmbedri sumrmbedir sumrmbdier sumrmbdire sumrmbdeir
sumrmbderi sumrmbdrei sumrmbdrie sumrmibred sumrmibrde sumrmiberd sumrmibedr sumrmibder sumrmibdre sumrmirbed sumrmirbde
sumrmirebd sumrmiredb sumrmirdeb sumrmirdbe sumrmierbd sumrmierdb sumrmiebrd sumrmiebdr sumrmiedbr sumrmiedrb sumrmidreb
sumrmidrbe sumrmiderb sumrmidebr sumrmidber sumrmidbre sumrmebird sumrmebidr sumrmebrid sumrmebrdi sumrmebdri sumrmebdir
sumrmeibrd sumrmeibdr sumrmeirbd sumrmeirdb sumrmeidrb sumrmeidbr sumrmeribd sumrmeridb sumrmerbid sumrmerbdi sumrmerdbi
sumrmerdib sumrmedirb sumrmedibr sumrmedrib sumrmedrbi sumrmedbri sumrmedbir sumrmdbier sumrmdbire sumrmdbeir sumrmdberi
sumrmdbrei sumrmdbrie sumrmdiber sumrmdibre sumrmdiebr sumrmdierb sumrmdireb sumrmdirbe sumrmdeibr sumrmdeirb sumrmdebir
sumrmdebri sumrmderbi sumrmderib sumrmdrieb sumrmdribe sumrmdreib sumrmdrebi sumrmdrbei sumrmdrbie sumrdrbime sumrdrbiem
sumrdrbmie sumrdrbmei sumrdrbemi sumrdrbeim sumrdribme sumrdribem sumrdrimbe sumrdrimeb sumrdriemb sumrdriebm sumrdrmibe
sumrdrmieb sumrdrmbie sumrdrmbei sumrdrmebi sumrdrmeib sumrdreimb sumrdreibm sumrdremib sumrdrembi sumrdrebmi sumrdrebim
sumrdbrime sumrdbriem sumrdbrmie sumrdbrmei sumrdbremi sumrdbreim sumrdbirme sumrdbirem sumrdbimre sumrdbimer sumrdbiemr
sumrdbierm sumrdbmire sumrdbmier sumrdbmrie sumrdbmrei sumrdbmeri sumrdbmeir sumrdbeimr sumrdbeirm sumrdbemir sumrdbemri
sumrdbermi sumrdberim sumrdibrme sumrdibrem sumrdibmre sumrdibmer sumrdibemr sumrdiberm sumrdirbme sumrdirbem sumrdirmbe
sumrdirmeb sumrdiremb sumrdirebm sumrdimrbe sumrdimreb sumrdimbre sumrdimber sumrdimebr sumrdimerb sumrdiermb sumrdierbm
sumrdiemrb sumrdiembr sumrdiebmr sumrdiebrm sumrdmbire sumrdmbier sumrdmbrie sumrdmbrei sumrdmberi sumrdmbeir sumrdmibre
sumrdmiber sumrdmirbe sumrdmireb sumrdmierb sumrdmiebr sumrdmribe sumrdmrieb sumrdmrbie sumrdmrbei sumrdmrebi sumrdmreib
sumrdmeirb sumrdmeibr sumrdmerib sumrdmerbi sumrdmebri sumrdmebir sumrdebimr sumrdebirm sumrdebmir sumrdebmri sumrdebrmi
sumrdebrim sumrdeibmr sumrdeibrm sumrdeimbr sumrdeimrb sumrdeirmb sumrdeirbm sumrdemibr sumrdemirb sumrdembir sumrdembri
sumrdemrbi sumrdemrib sumrderimb sumrderibm sumrdermib sumrdermbi sumrderbmi sumrderbim sumderbirm sumderbimr sumderbrim
sumderbrmi sumderbmri sumderbmir sumderibrm sumderibmr sumderirbm sumderirmb sumderimrb sumderimbr sumderribm sumderrimb
sumderrbim sumderrbmi sumderrmbi sumderrmib sumdermirb sumdermibr sumdermrib sumdermrbi sumdermbri sumdermbir sumdebrirm
sumdebrimr sumdebrrim sumdebrrmi sumdebrmri sumdebrmir sumdebirrm sumdebirmr sumdebirrm sumdebirmr sumdebimrr sumdebimrr
sumdebrirm sumdebrimr sumdebrrim sumdebrrmi sumdebrmri sumdebrmir sumdebmirr sumdebmirr sumdebmrir sumdebmrri sumdebmrri
sumdebmrir sumdeibrrm sumdeibrmr sumdeibrrm sumdeibrmr sumdeibmrr sumdeibmrr sumdeirbrm sumdeirbmr sumdeirrbm sumdeirrmb
sumdeirmrb sumdeirmbr sumdeirrbm sumdeirrmb sumdeirbrm sumdeirbmr sumdeirmbr sumdeirmrb sumdeimrrb sumdeimrbr sumdeimrrb
sumdeimrbr sumdeimbrr sumdeimbrr sumderbirm sumderbimr sumderbrim sumderbrmi sumderbmri sumderbmir sumderibrm sumderibmr
sumderirbm sumderirmb sumderimrb sumderimbr sumderribm sumderrimb sumderrbim sumderrbmi sumderrmbi sumderrmib sumdermirb
sumdermibr sumdermrib sumdermrbi sumdermbri sumdermbir sumdembirr sumdembirr sumdembrir sumdembrri sumdembrri sumdembrir
sumdemibrr sumdemibrr sumdemirbr sumdemirrb sumdemirrb sumdemirbr sumdemribr sumdemrirb sumdemrbir sumdemrbri sumdemrrbi
sumdemrrib sumdemrirb sumdemribr sumdemrrib sumdemrrbi sumdemrbri sumdemrbir sumdrebirm sumdrebimr sumdrebrim sumdrebrmi
sumdrebmri sumdrebmir sumdreibrm sumdreibmr sumdreirbm sumdreirmb sumdreimrb sumdreimbr sumdreribm sumdrerimb sumdrerbim
sumdrerbmi sumdrermbi sumdrermib sumdremirb sumdremibr sumdremrib sumdremrbi sumdrembri sumdrembir sumdrbeirm sumdrbeimr
sumdrberim sumdrbermi sumdrbemri sumdrbemir sumdrbierm sumdrbiemr sumdrbirem sumdrbirme sumdrbimre sumdrbimer sumdrbriem
sumdrbrime sumdrbreim sumdrbremi sumdrbrmei sumdrbrmie sumdrbmire sumdrbmier sumdrbmrie sumdrbmrei sumdrbmeri sumdrbmeir
sumdriberm sumdribemr sumdribrem sumdribrme sumdribmre sumdribmer sumdriebrm sumdriebmr sumdrierbm sumdriermb sumdriemrb
sumdriembr sumdrirebm sumdriremb sumdrirbem sumdrirbme sumdrirmbe sumdrirmeb sumdrimerb sumdrimebr sumdrimreb sumdrimrbe
sumdrimbre sumdrimber sumdrrbiem sumdrrbime sumdrrbeim sumdrrbemi sumdrrbmei sumdrrbmie sumdrribem sumdrribme sumdrriebm
sumdrriemb sumdrrimeb sumdrrimbe sumdrreibm sumdrreimb sumdrrebim sumdrrebmi sumdrrembi sumdrremib sumdrrmieb sumdrrmibe
sumdrrmeib sumdrrmebi sumdrrmbei sumdrrmbie sumdrmbire sumdrmbier sumdrmbrie sumdrmbrei sumdrmberi sumdrmbeir sumdrmibre
sumdrmiber sumdrmirbe sumdrmireb sumdrmierb sumdrmiebr sumdrmribe sumdrmrieb sumdrmrbie sumdrmrbei sumdrmrebi sumdrmreib
sumdrmeirb sumdrmeibr sumdrmerib sumdrmerbi sumdrmebri sumdrmebir sumdbreirm sumdbreimr sumdbrerim sumdbrermi sumdbremri
sumdbremir sumdbrierm sumdbriemr sumdbrirem sumdbrirme sumdbrimre sumdbrimer sumdbrriem sumdbrrime sumdbrreim sumdbrremi
sumdbrrmei sumdbrrmie sumdbrmire sumdbrmier sumdbrmrie sumdbrmrei sumdbrmeri sumdbrmeir sumdberirm sumdberimr sumdberrim
sumdberrmi sumdbermri sumdbermir sumdbeirrm sumdbeirmr sumdbeirrm sumdbeirmr sumdbeimrr sumdbeimrr sumdberirm sumdberimr
sumdberrim sumdberrmi sumdbermri sumdbermir sumdbemirr sumdbemirr sumdbemrir sumdbemrri sumdbemrri sumdbemrir sumdbierrm
sumdbiermr sumdbierrm sumdbiermr sumdbiemrr sumdbiemrr sumdbirerm sumdbiremr sumdbirrem sumdbirrme sumdbirmre sumdbirmer
sumdbirrem sumdbirrme sumdbirerm sumdbiremr sumdbirmer sumdbirmre sumdbimrre sumdbimrer sumdbimrre sumdbimrer sumdbimerr
sumdbimerr sumdbreirm sumdbreimr sumdbrerim sumdbrermi sumdbremri sumdbremir sumdbrierm sumdbriemr sumdbrirem sumdbrirme
sumdbrimre sumdbrimer sumdbrriem sumdbrrime sumdbrreim sumdbrremi sumdbrrmei sumdbrrmie sumdbrmire sumdbrmier sumdbrmrie
sumdbrmrei sumdbrmeri sumdbrmeir sumdbmeirr sumdbmeirr sumdbmerir sumdbmerri sumdbmerri sumdbmerir sumdbmierr sumdbmierr
sumdbmirer sumdbmirre sumdbmirre sumdbmirer sumdbmrier sumdbmrire sumdbmreir sumdbmreri sumdbmrrei sumdbmrrie sumdbmrire
sumdbmrier sumdbmrrie sumdbmrrei sumdbmreri sumdbmreir sumdirberm sumdirbemr sumdirbrem sumdirbrme sumdirbmre sumdirbmer
sumdirebrm sumdirebmr sumdirerbm sumdirermb sumdiremrb sumdirembr sumdirrebm sumdirremb sumdirrbem sumdirrbme sumdirrmbe
sumdirrmeb sumdirmerb sumdirmebr sumdirmreb sumdirmrbe sumdirmbre sumdirmber sumdibrerm sumdibremr sumdibrrem sumdibrrme
sumdibrmre sumdibrmer sumdiberrm sumdibermr sumdiberrm sumdibermr sumdibemrr sumdibemrr sumdibrerm sumdibremr sumdibrrem
sumdibrrme sumdibrmre sumdibrmer sumdibmerr sumdibmerr sumdibmrer sumdibmrre sumdibmrre sumdibmrer sumdiebrrm sumdiebrmr
sumdiebrrm sumdiebrmr sumdiebmrr sumdiebmrr sumdierbrm sumdierbmr sumdierrbm sumdierrmb sumdiermrb sumdiermbr sumdierrbm
sumdierrmb sumdierbrm sumdierbmr sumdiermbr sumdiermrb sumdiemrrb sumdiemrbr sumdiemrrb sumdiemrbr sumdiembrr sumdiembrr
sumdirberm sumdirbemr sumdirbrem sumdirbrme sumdirbmre sumdirbmer sumdirebrm sumdirebmr sumdirerbm sumdirermb sumdiremrb
sumdirembr sumdirrebm sumdirremb sumdirrbem sumdirrbme sumdirrmbe sumdirrmeb sumdirmerb sumdirmebr sumdirmreb sumdirmrbe
sumdirmbre sumdirmber sumdimberr sumdimberr sumdimbrer sumdimbrre sumdimbrre sumdimbrer sumdimebrr sumdimebrr sumdimerbr
sumdimerrb sumdimerrb sumdimerbr sumdimrebr sumdimrerb sumdimrber sumdimrbre sumdimrrbe sumdimrreb sumdimrerb sumdimrebr
sumdimrreb sumdimrrbe sumdimrbre sumdimrber sumdrrbiem sumdrrbime sumdrrbeim sumdrrbemi sumdrrbmei sumdrrbmie sumdrribem
sumdrribme sumdrriebm sumdrriemb sumdrrimeb sumdrrimbe sumdrreibm sumdrreimb sumdrrebim sumdrrebmi sumdrrembi sumdrremib
sumdrrmieb sumdrrmibe sumdrrmeib sumdrrmebi sumdrrmbei sumdrrmbie sumdrbriem sumdrbrime sumdrbreim sumdrbremi sumdrbrmei
sumdrbrmie sumdrbirem sumdrbirme sumdrbierm sumdrbiemr sumdrbimer sumdrbimre sumdrbeirm sumdrbeimr sumdrberim sumdrbermi
sumdrbemri sumdrbemir sumdrbmier sumdrbmire sumdrbmeir sumdrbmeri sumdrbmrei sumdrbmrie sumdribrem sumdribrme sumdriberm
sumdribemr sumdribmer sumdribmre sumdrirbem sumdrirbme sumdrirebm sumdriremb sumdrirmeb sumdrirmbe sumdrierbm sumdriermb
sumdriebrm sumdriebmr sumdriembr sumdriemrb sumdrimreb sumdrimrbe sumdrimerb sumdrimebr sumdrimber sumdrimbre sumdrebirm
sumdrebimr sumdrebrim sumdrebrmi sumdrebmri sumdrebmir sumdreibrm sumdreibmr sumdreirbm sumdreirmb sumdreimrb sumdreimbr
sumdreribm sumdrerimb sumdrerbim sumdrerbmi sumdrermbi sumdrermib sumdremirb sumdremibr sumdremrib sumdremrbi sumdrembri
sumdrembir sumdrmbier sumdrmbire sumdrmbeir sumdrmberi sumdrmbrei sumdrmbrie sumdrmiber sumdrmibre sumdrmiebr sumdrmierb
sumdrmireb sumdrmirbe sumdrmeibr sumdrmeirb sumdrmebir sumdrmebri sumdrmerbi sumdrmerib sumdrmrieb sumdrmribe sumdrmreib
sumdrmrebi sumdrmrbei sumdrmrbie sumdmrbire sumdmrbier sumdmrbrie sumdmrbrei sumdmrberi sumdmrbeir sumdmribre sumdmriber
sumdmrirbe sumdmrireb sumdmrierb sumdmriebr sumdmrribe sumdmrrieb sumdmrrbie sumdmrrbei sumdmrrebi sumdmrreib sumdmreirb
sumdmreibr sumdmrerib sumdmrerbi sumdmrebri sumdmrebir sumdmbrire sumdmbrier sumdmbrrie sumdmbrrei sumdmbreri sumdmbreir
sumdmbirre sumdmbirer sumdmbirre sumdmbirer sumdmbierr sumdmbierr sumdmbrire sumdmbrier sumdmbrrie sumdmbrrei sumdmbreri
sumdmbreir sumdmbeirr sumdmbeirr sumdmberir sumdmberri sumdmberri sumdmberir sumdmibrre sumdmibrer sumdmibrre sumdmibrer
sumdmiberr sumdmiberr sumdmirbre sumdmirber sumdmirrbe sumdmirreb sumdmirerb sumdmirebr sumdmirrbe sumdmirreb sumdmirbre
sumdmirber sumdmirebr sumdmirerb sumdmierrb sumdmierbr sumdmierrb sumdmierbr sumdmiebrr sumdmiebrr sumdmrbire sumdmrbier
sumdmrbrie sumdmrbrei sumdmrberi sumdmrbeir sumdmribre sumdmriber sumdmrirbe sumdmrireb sumdmrierb sumdmriebr sumdmrribe
sumdmrrieb sumdmrrbie sumdmrrbei sumdmrrebi sumdmrreib sumdmreirb sumdmreibr sumdmrerib sumdmrerbi sumdmrebri sumdmrebir
sumdmebirr sumdmebirr sumdmebrir sumdmebrri sumdmebrri sumdmebrir sumdmeibrr sumdmeibrr sumdmeirbr sumdmeirrb sumdmeirrb
sumdmeirbr sumdmeribr sumdmerirb sumdmerbir sumdmerbri sumdmerrbi sumdmerrib sumdmerirb sumdmeribr sumdmerrib sumdmerrbi
sumdmerbri sumdmerbir

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us