easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

bolyard

advolvant

omnipotence

matthijs

innominatum

maculaverant

foolishest

destituavissentque

giselbert

phototypesetting

tussars

saleable

confirmaremque

spooneys

legislatorship

cleghorn

hotspurs

shary


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: succederes
cipher variations:
tvddfefsft uweegfgtgu vxffhghuhv wyggihiviw xzhhjijwjx
yaiikjkxky zbjjlklylz ackkmlmzma bdllnmnanb cemmonoboc
dfnnpopcpd egooqpqdqe fhpprqrerf giqqsrsfsg hjrrtstgth
ikssutuhui jlttvuvivj kmuuwvwjwk lnvvxwxkxl mowwyxylym
npxxzyzmzn oqyyazanao przzbabobp qsaacbcpcq rtbbdcdqdr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: succederes
Cipher: hfxxvwvivh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: succederes
Cipher: BAAAB BAABB AAABA AAABA AABAA AAABB AABAA BAAAA AABAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: succederes
cipher variations:
tvddfefsftdjhhnknandnxllvqvivnxlppdwdqdxhzttlclylhrnxxtitgtrlpffjujwjlvdjjrarerv
frnnzgzmzfpfrrhmhuhpztvvpspcpzjhzzxyxkxjuweegfgtguekiioloboeoymmwrwjwoymqqexerey
iauumdmzmisoyyujuhusmqggkvkxkmwekksbsfswgsooahanagqgssiniviqauwwqtqdqakiaayzylyk
vxffhghuhvfljjpmpcpfpznnxsxkxpznrrfyfsfzjbvvnenanjtpzzvkvivtnrhhlwlylnxflltctgtx
htppbibobhrhttjojwjrbvxxrurerbljbbzazmzlwyggihiviwgmkkqnqdqgqaooytylyqaossgzgtga
kcwwofobokuqaawlwjwuosiimxmzmoygmmuduhuyiuqqcjcpcisiuukpkxkscwyysvsfscmkccabanam
xzhhjijwjxhnllrorerhrbppzuzmzrbptthahuhbldxxpgpcplvrbbxmxkxvptjjnynanpzhnnvevivz
jvrrdkdqdjtjvvlqlyltdxzztwtgtdnlddbcbobnyaiikjkxkyiommspsfsiscqqavanascquuibivic
meyyqhqdqmwsccynylywqukkozoboqaioowfwjwakwsselerekukwwmrmzmueyaauxuhueomeecdcpco
zbjjlklylzjpnntqtgtjtdrrbwbobtdrvvjcjwjdnfzzrirernxtddzozmzxrvllpapcprbjppxgxkxb
lxttfmfsflvlxxnsnanvfzbbvyvivfpnffdedqdpackkmlmzmakqoouruhukuesscxcpcueswwkdkxke
ogaasjsfsoyueeapanayswmmqbqdqsckqqyhylycmyuugngtgmwmyyotobowgaccwzwjwgqoggefereq
bdllnmnanblrppvsvivlvfttdydqdvftxxlelylfphbbtktgtpzvffbqbobztxnnrcrertdlrrzizmzd
nzvvhohuhnxnzzpupcpxhbddxaxkxhrphhfgfsfrcemmonobocmsqqwtwjwmwguuezerewguyymfmzmg
qicculuhuqawggcrcpcauyoosdsfsuemssajanaeoawwipivioyoaaqvqdqyiceeybylyisqiighgtgs
dfnnpopcpdntrrxuxkxnxhvvfafsfxhvzzngnanhrjddvmvivrbxhhdsdqdbvzpptetgtvfnttbkbobf
pbxxjqjwjpzpbbrwrerzjdffzczmzjtrjjhihuhtegooqpqdqeoussyvylyoyiwwgbgtgyiwaaohoboi
skeewnwjwscyiieterecwaqqufuhuwgouuclcpcgqcyykrkxkqaqccsxsfsakeggadanakuskkijiviu
fhpprqrerfpvttzwzmzpzjxxhchuhzjxbbpipcpjtlffxoxkxtdzjjfufsfdxbrrvgvivxhpvvdmdqdh
rdzzlslylrbrddtytgtblfhhbeboblvtlljkjwjvgiqqsrsfsgqwuuaxanaqakyyidiviakyccqjqdqk
umggypylyueakkgvgtgeycsswhwjwyiqwwenereiseaamtmzmscseeuzuhucmgiicfcpcmwummklkxkw
hjrrtstgthrxvvbybobrblzzjejwjblzddrkrerlvnhhzqzmzvfbllhwhuhfzdttxixkxzjrxxfofsfj
tfbbnunantdtffvavivdnhjjdgdqdnxvnnlmlylxikssutuhuisywwczcpcscmaakfkxkcmaeeslsfsm
woiiaranawgcmmixivigaeuuyjylyaksyygpgtgkugccovoboueuggwbwjweoikkehereoywoomnmzmy
jlttvuvivjtzxxdadqdtdnbblglyldnbfftmtgtnxpjjbsbobxhdnnjyjwjhbfvvzkzmzbltzzhqhuhl
vhddpwpcpvfvhhxcxkxfpjllfifsfpzxppnonanzkmuuwvwjwkuayyebereueoccmhmzmeocggunuhuo
yqkkctcpcyieookzkxkicgwwalanacmuaairivimwieeqxqdqwgwiiydylygqkmmgjgtgqayqqopoboa
lnvvxwxkxlvbzzfcfsfvfpddninanfpdhhvovivpzrlldudqdzjfpplalyljdhxxbmbobdnvbbjsjwjn
xjffryrerxhxjjzezmzhrlnnhkhuhrbzrrpqpcpbmowwyxylymwcaagdgtgwgqeeojobogqeiiwpwjwq
asmmevereakgqqmbmzmkeiyycncpceowccktkxkoykggszsfsyiykkafanaismooiliviscassqrqdqc
npxxzyzmznxdbbhehuhxhrffpkpcphrfjjxqxkxrbtnnfwfsfblhrrncnanlfjzzdodqdfpxddlulylp
zlhhtatgtzjzllbgbobjtnppjmjwjtdbttrsrerdoqyyazanaoyeccifiviyisggqlqdqisgkkyrylys
cuoogxgtgcmissodobomgkaaeperegqyeemvmzmqamiiubuhuakammchcpckuoqqknkxkuecuustsfse
przzbabobpzfddjgjwjzjthhrmrerjthllzszmztdvpphyhuhdnjttpepcpnhlbbfqfsfhrzffnwnanr
bnjjvcvivblbnndidqdlvprrlolylvfdvvtutgtfqsaacbcpcqageekhkxkakuiisnsfskuimmatanau
ewqqizivieokuuqfqdqoimccgrgtgisaggoxoboscokkwdwjwcmcooejeremwqssmpmzmwgewwuvuhug
rtbbdcdqdrbhfflilylblvjjtotgtlvjnnbubobvfxrrjajwjfplvvrgrerpjnddhshuhjtbhhpypcpt
dpllxexkxdndppfkfsfnxrttnqnanxhfxxvwvivhsuccederesciggmjmzmcmwkkupuhumwkoocvcpcw
gysskbkxkgqmwwshsfsqkoeeitivikuciiqzqdqueqmmyfylyeoeqqglgtgoysuuoroboyigyywxwjwi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: succederes
Cipher: fhpprqrerf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: succederes
Cipher: 34543131514151245134

Extended Methods:
Method #1

Plaintext: succederes
method variations:
xzhhkikwkxcennpopbpchkssutuguhnpxxzyzmzn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s u c c e d e r e s 
3 5 3 3 5 4 5 2 5 3 
4 4 1 1 1 1 1 4 1 4 
They are then read out in rows:
35335452534411111414
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: succederes
Cipher: xnukptaaqq

Read more ...
Method #3

Plaintext: succederes
method variations:
yolvqvfylo olvqvfyloy lvqvfyloyo
vqvfyloyol qvfyloyolv vfyloyolvq
fyloyolvqv yloyolvqvf loyolvqvfy
oyolvqvfyl

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: succederes

first 5040 cipher variations(3628800 total)
succederes succederse succedeers succedeesr succedeser succedesre succedrees succedrese succedrees succedrese succedrsee
succedrsee succederes succederse succedeers succedeesr succedeser succedesre succedsree succedsree succedsere succedseer
succedseer succedsere succeedres succeedrse succeeders succeedesr succeedser succeedsre succeerdes succeerdse succeereds
succeeresd succeersed succeersde succeeerds succeeersd succeeedrs succeeedsr succeeesdr succeeesrd succeesred succeesrde
succeeserd succeesedr succeesder succeesdre succeredes succeredse succereeds succereesd succeresed succeresde succerdees
succerdese succerdees succerdese succerdsee succerdsee succeredes succeredse succereeds succereesd succeresed succeresde
succersdee succersdee succersede succerseed succerseed succersede succeeerds succeeersd succeeedrs succeeedsr succeeesdr
succeeesrd succeereds succeeresd succeerdes succeerdse succeersde succeersed succeedres succeedrse succeeders succeedesr
succeedser succeedsre succeesrde succeesred succeesdre succeesder succeesedr succeeserd succesered succeserde succeseerd
succeseedr succeseder succesedre succesreed succesrede succesreed succesrede succesrdee succesrdee succesered succeserde
succeseerd succeseedr succeseder succesedre succesdree succesdree succesdere succesdeer succesdeer succesdere succdeeres
succdeerse succdeeers succdeeesr succdeeser succdeesre succderees succderese succderees succderese succdersee succdersee
succdeeres succdeerse succdeeers succdeeesr succdeeser succdeesre succdesree succdesree succdesere succdeseer succdeseer
succdesere succdeeres succdeerse succdeeers succdeeesr succdeeser succdeesre succderees succderese succderees succderese
succdersee succdersee succdeeres succdeerse succdeeers succdeeesr succdeeser succdeesre succdesree succdesree succdesere
succdeseer succdeseer succdesere succdreees succdreese succdreees succdreese succdresee succdresee succdreees succdreese
succdreees succdreese succdresee succdresee succdreees succdreese succdreees succdreese succdresee succdresee succdrseee
succdrseee succdrseee succdrseee succdrseee succdrseee succdeeres succdeerse succdeeers succdeeesr succdeeser succdeesre
succderees succderese succderees succderese succdersee succdersee succdeeres succdeerse succdeeers succdeeesr succdeeser
succdeesre succdesree succdesree succdesere succdeseer succdeseer succdesere succdseree succdseree succdseere succdseeer
succdseeer succdseere succdsreee succdsreee succdsreee succdsreee succdsreee succdsreee succdseree succdseree succdseere
succdseeer succdseeer succdseere succdseree succdseree succdseere succdseeer succdseeer succdseere succederes succederse
succedeers succedeesr succedeser succedesre succedrees succedrese succedrees succedrese succedrsee succedrsee succederes
succederse succedeers succedeesr succedeser succedesre succedsree succedsree succedsere succedseer succedseer succedsere
succeedres succeedrse succeeders succeedesr succeedser succeedsre succeerdes succeerdse succeereds succeeresd succeersed
succeersde succeeerds succeeersd succeeedrs succeeedsr succeeesdr succeeesrd succeesred succeesrde succeeserd succeesedr
succeesder succeesdre succeredes succeredse succereeds succereesd succeresed succeresde succerdees succerdese succerdees
succerdese succerdsee succerdsee succeredes succeredse succereeds succereesd succeresed succeresde succersdee succersdee
succersede succerseed succerseed succersede succeeerds succeeersd succeeedrs succeeedsr succeeesdr succeeesrd succeereds
succeeresd succeerdes succeerdse succeersde succeersed succeedres succeedrse succeeders succeedesr succeedser succeedsre
succeesrde succeesred succeesdre succeesder succeesedr succeeserd succesered succeserde succeseerd succeseedr succeseder
succesedre succesreed succesrede succesreed succesrede succesrdee succesrdee succesered succeserde succeseerd succeseedr
succeseder succesedre succesdree succesdree succesdere succesdeer succesdeer succesdere succrdeees succrdeese succrdeees
succrdeese succrdesee succrdesee succrdeees succrdeese succrdeees succrdeese succrdesee succrdesee succrdeees succrdeese
succrdeees succrdeese succrdesee succrdesee succrdseee succrdseee succrdseee succrdseee succrdseee succrdseee succredees
succredese succredees succredese succredsee succredsee succreedes succreedse succreeeds succreeesd succreesed succreesde
succreeeds succreeesd succreedes succreedse succreesde succreesed succreseed succresede succreseed succresede succresdee
succresdee succreedes succreedse succreeeds succreeesd succreesed succreesde succredees succredese succredees succredese
succredsee succredsee succreedes succreedse succreeeds succreeesd succreesed succreesde succresdee succresdee succresede
succreseed succreseed succresede succreeeds succreeesd succreedes succreedse succreesde succreesed succreeeds succreeesd
succreedes succreedse succreesde succreesed succredees succredese succredees succredese succredsee succredsee succresede
succreseed succresdee succresdee succresede succreseed succrseeed succrseede succrseeed succrseede succrsedee succrsedee
succrseeed succrseede succrseeed succrseede succrsedee succrsedee succrseeed succrseede succrseeed succrseede succrsedee
succrsedee succrsdeee succrsdeee succrsdeee succrsdeee succrsdeee succrsdeee succederes succederse succedeers succedeesr
succedeser succedesre succedrees succedrese succedrees succedrese succedrsee succedrsee succederes succederse succedeers
succedeesr succedeser succedesre succedsree succedsree succedsere succedseer succedseer succedsere succeedres succeedrse
succeeders succeedesr succeedser succeedsre succeerdes succeerdse succeereds succeeresd succeersed succeersde succeeerds
succeeersd succeeedrs succeeedsr succeeesdr succeeesrd succeesred succeesrde succeeserd succeesedr succeesder succeesdre
succeredes succeredse succereeds succereesd succeresed succeresde succerdees succerdese succerdees succerdese succerdsee
succerdsee succeredes succeredse succereeds succereesd succeresed succeresde succersdee succersdee succersede succerseed
succerseed succersede succeeerds succeeersd succeeedrs succeeedsr succeeesdr succeeesrd succeereds succeeresd succeerdes
succeerdse succeersde succeersed succeedres succeedrse succeeders succeedesr succeedser succeedsre succeesrde succeesred
succeesdre succeesder succeesedr succeeserd succesered succeserde succeseerd succeseedr succeseder succesedre succesreed
succesrede succesreed succesrede succesrdee succesrdee succesered succeserde succeseerd succeseedr succeseder succesedre
succesdree succesdree succesdere succesdeer succesdeer succesdere succsderee succsderee succsdeere succsdeeer succsdeeer
succsdeere succsdreee succsdreee succsdreee succsdreee succsdreee succsdreee succsderee succsderee succsdeere succsdeeer
succsdeeer succsdeere succsderee succsderee succsdeere succsdeeer succsdeeer succsdeere succsedree succsedree succsedere
succsedeer succsedeer succsedere succserdee succserdee succserede succsereed succsereed succserede succseerde succseered
succseedre succseeder succseeedr succseeerd succseered succseerde succseeerd succseeedr succseeder succseedre succsredee
succsredee succsreede succsreeed succsreeed succsreede succsrdeee succsrdeee succsrdeee succsrdeee succsrdeee succsrdeee
succsredee succsredee succsreede succsreeed succsreeed succsreede succsredee succsredee succsreede succsreeed succsreeed
succsreede succseerde succseered succseedre succseeder succseeedr succseeerd succserede succsereed succserdee succserdee
succserede succsereed succsedree succsedree succsedere succsedeer succsedeer succsedere succseerde succseered succseedre
succseeder succseeedr succseeerd succseered succseerde succseeerd succseeedr succseeder succseedre succsereed succserede
succsereed succserede succserdee succserdee succseered succseerde succseeerd succseeedr succseeder succseedre succsedree
succsedree succsedere succsedeer succsedeer succsedere sucecderes sucecderse sucecdeers sucecdeesr sucecdeser sucecdesre
sucecdrees sucecdrese sucecdrees sucecdrese sucecdrsee sucecdrsee sucecderes sucecderse sucecdeers sucecdeesr sucecdeser
sucecdesre sucecdsree sucecdsree sucecdsere sucecdseer sucecdseer sucecdsere sucecedres sucecedrse suceceders sucecedesr
sucecedser sucecedsre sucecerdes sucecerdse sucecereds suceceresd sucecersed sucecersde suceceerds suceceersd suceceedrs
suceceedsr suceceesdr suceceesrd sucecesred sucecesrde suceceserd sucecesedr sucecesder sucecesdre sucecredes sucecredse
sucecreeds sucecreesd sucecresed sucecresde sucecrdees sucecrdese sucecrdees sucecrdese sucecrdsee sucecrdsee sucecredes
sucecredse sucecreeds sucecreesd sucecresed sucecresde sucecrsdee sucecrsdee sucecrsede sucecrseed sucecrseed sucecrsede
suceceerds suceceersd suceceedrs suceceedsr suceceesdr suceceesrd sucecereds suceceresd sucecerdes sucecerdse sucecersde
sucecersed sucecedres sucecedrse suceceders sucecedesr sucecedser sucecedsre sucecesrde sucecesred sucecesdre sucecesder
sucecesedr suceceserd sucecsered sucecserde sucecseerd sucecseedr sucecseder sucecsedre sucecsreed sucecsrede sucecsreed
sucecsrede sucecsrdee sucecsrdee sucecsered sucecserde sucecseerd sucecseedr sucecseder sucecsedre sucecsdree sucecsdree
sucecsdere sucecsdeer sucecsdeer sucecsdere sucedceres sucedcerse sucedceers sucedceesr sucedceser sucedcesre sucedcrees
sucedcrese sucedcrees sucedcrese sucedcrsee sucedcrsee sucedceres sucedcerse sucedceers sucedceesr sucedceser sucedcesre
sucedcsree sucedcsree sucedcsere sucedcseer sucedcseer sucedcsere sucedecres sucedecrse sucedecers sucedecesr sucedecser
sucedecsre sucederces sucedercse sucederecs sucederesc sucedersec sucedersce sucedeercs sucedeersc sucedeecrs sucedeecsr
sucedeescr sucedeesrc sucedesrec sucedesrce sucedeserc sucedesecr sucedescer sucedescre sucedreces sucedrecse sucedreecs
sucedreesc sucedresec sucedresce sucedrcees sucedrcese sucedrcees sucedrcese sucedrcsee sucedrcsee sucedreces sucedrecse
sucedreecs sucedreesc sucedresec sucedresce sucedrscee sucedrscee sucedrsece sucedrseec sucedrseec sucedrsece sucedeercs
sucedeersc sucedeecrs sucedeecsr sucedeescr sucedeesrc sucederecs sucederesc sucederces sucedercse sucedersce sucedersec
sucedecres sucedecrse sucedecers sucedecesr sucedecser sucedecsre sucedesrce sucedesrec sucedescre sucedescer sucedesecr
sucedeserc sucedserec sucedserce sucedseerc sucedseecr sucedsecer sucedsecre sucedsreec sucedsrece sucedsreec sucedsrece
sucedsrcee sucedsrcee sucedserec sucedserce sucedseerc sucedseecr sucedsecer sucedsecre sucedscree sucedscree sucedscere
sucedsceer sucedsceer sucedscere suceedcres suceedcrse suceedcers suceedcesr suceedcser suceedcsre suceedrces suceedrcse
suceedrecs suceedresc suceedrsec suceedrsce suceedercs suceedersc suceedecrs suceedecsr suceedescr suceedesrc suceedsrec
suceedsrce suceedserc suceedsecr suceedscer suceedscre suceecdres suceecdrse suceecders suceecdesr suceecdser suceecdsre
suceecrdes suceecrdse suceecreds suceecresd suceecrsed suceecrsde suceecerds suceecersd suceecedrs suceecedsr suceecesdr
suceecesrd suceecsred suceecsrde suceecserd suceecsedr suceecsder suceecsdre suceercdes suceercdse suceerceds suceercesd
suceercsed suceercsde suceerdces suceerdcse suceerdecs suceerdesc suceerdsec suceerdsce suceeredcs suceeredsc suceerecds
suceerecsd suceerescd suceeresdc suceersdec suceersdce suceersedc suceersecd suceersced suceerscde suceeecrds suceeecrsd
suceeecdrs suceeecdsr suceeecsdr suceeecsrd suceeercds suceeercsd suceeerdcs suceeerdsc suceeersdc suceeerscd suceeedrcs
suceeedrsc suceeedcrs suceeedcsr suceeedscr suceeedsrc suceeesrdc suceeesrcd suceeesdrc suceeesdcr suceeescdr suceeescrd
suceescred suceescrde suceescerd suceescedr suceescder suceescdre suceesrced suceesrcde suceesrecd suceesredc suceesrdec
suceesrdce suceesercd suceeserdc suceesecrd suceesecdr suceesedcr suceesedrc suceesdrec suceesdrce suceesderc suceesdecr
suceesdcer suceesdcre sucerdeces sucerdecse sucerdeecs sucerdeesc sucerdesec sucerdesce sucerdcees sucerdcese sucerdcees
sucerdcese sucerdcsee sucerdcsee sucerdeces sucerdecse sucerdeecs sucerdeesc sucerdesec sucerdesce sucerdscee sucerdscee
sucerdsece sucerdseec sucerdseec sucerdsece suceredces suceredcse suceredecs suceredesc suceredsec suceredsce sucerecdes
sucerecdse sucereceds sucerecesd sucerecsed sucerecsde sucereecds sucereecsd sucereedcs sucereedsc sucereesdc sucereescd
suceresced sucerescde suceresecd suceresedc suceresdec suceresdce sucercedes sucercedse sucerceeds sucerceesd sucercesed
sucercesde sucercdees sucercdese sucercdees sucercdese sucercdsee sucercdsee sucercedes sucercedse sucerceeds sucerceesd
sucercesed sucercesde sucercsdee sucercsdee sucercsede sucercseed sucercseed sucercsede sucereecds sucereecsd sucereedcs
sucereedsc sucereesdc sucereescd sucereceds sucerecesd sucerecdes sucerecdse sucerecsde sucerecsed suceredces suceredcse
suceredecs suceredesc suceredsec suceredsce sucerescde suceresced suceresdce suceresdec suceresedc suceresecd sucerseced
sucersecde sucerseecd sucerseedc sucersedec sucersedce sucersceed sucerscede sucersceed sucerscede sucerscdee sucerscdee
sucerseced sucersecde sucerseecd sucerseedc sucersedec sucersedce sucersdcee sucersdcee sucersdece sucersdeec sucersdeec
sucersdece suceedercs suceedersc suceedecrs suceedecsr suceedescr suceedesrc suceedrecs suceedresc suceedrces suceedrcse
suceedrsce suceedrsec suceedcres suceedcrse suceedcers suceedcesr suceedcser suceedcsre suceedsrce suceedsrec suceedscre
suceedscer suceedsecr suceedserc suceeedrcs suceeedrsc suceeedcrs suceeedcsr suceeedscr suceeedsrc suceeerdcs suceeerdsc
suceeercds suceeercsd suceeerscd suceeersdc suceeecrds suceeecrsd suceeecdrs suceeecdsr suceeecsdr suceeecsrd suceeesrcd
suceeesrdc suceeescrd suceeescdr suceeesdcr suceeesdrc suceeredcs suceeredsc suceerecds suceerecsd suceerescd suceeresdc
suceerdecs suceerdesc suceerdces suceerdcse suceerdsce suceerdsec suceercdes suceercdse suceerceds suceercesd suceercsed
suceercsde suceersdce suceersdec suceerscde suceersced suceersecd suceersedc suceecerds suceecersd suceecedrs suceecedsr
suceecesdr suceecesrd suceecreds suceecresd suceecrdes suceecrdse suceecrsde suceecrsed suceecdres suceecdrse suceecders
suceecdesr suceecdser suceecdsre suceecsrde suceecsred suceecsdre suceecsder suceecsedr suceecserd suceesercd suceeserdc
suceesecrd suceesecdr suceesedcr suceesedrc suceesrecd suceesredc suceesrced suceesrcde suceesrdce suceesrdec suceescred
suceescrde suceescerd suceescedr suceescder suceescdre suceesdrce suceesdrec suceesdcre suceesdcer suceesdecr suceesderc
sucesderec sucesderce sucesdeerc sucesdeecr sucesdecer sucesdecre sucesdreec sucesdrece sucesdreec sucesdrece sucesdrcee
sucesdrcee sucesderec sucesderce sucesdeerc sucesdeecr sucesdecer sucesdecre sucesdcree sucesdcree sucesdcere sucesdceer
sucesdceer sucesdcere sucesedrec sucesedrce sucesederc sucesedecr sucesedcer sucesedcre suceserdec suceserdce suceseredc
suceserecd suceserced sucesercde suceseerdc suceseercd suceseedrc suceseedcr suceseecdr suceseecrd sucesecred sucesecrde
sucesecerd sucesecedr sucesecder sucesecdre sucesredec sucesredce sucesreedc sucesreecd sucesreced sucesrecde sucesrdeec
sucesrdece sucesrdeec sucesrdece sucesrdcee sucesrdcee sucesredec sucesredce sucesreedc sucesreecd sucesreced sucesrecde
sucesrcdee sucesrcdee sucesrcede sucesrceed sucesrceed sucesrcede suceseerdc suceseercd suceseedrc suceseedcr suceseecdr
suceseecrd suceseredc suceserecd suceserdec suceserdce sucesercde suceserced sucesedrec sucesedrce sucesederc sucesedecr
sucesedcer sucesedcre sucesecrde sucesecred sucesecdre sucesecder sucesecedr sucesecerd sucescered sucescerde sucesceerd
sucesceedr sucesceder sucescedre sucescreed sucescrede sucescreed sucescrede sucescrdee sucescrdee sucescered sucescerde
sucesceerd sucesceedr sucesceder sucescedre sucescdree sucescdree sucescdere sucescdeer sucescdeer sucescdere sucdeceres
sucdecerse sucdeceers sucdeceesr sucdeceser sucdecesre sucdecrees sucdecrese sucdecrees sucdecrese sucdecrsee sucdecrsee
sucdeceres sucdecerse sucdeceers sucdeceesr sucdeceser sucdecesre sucdecsree sucdecsree sucdecsere sucdecseer sucdecseer
sucdecsere sucdeecres sucdeecrse sucdeecers sucdeecesr sucdeecser sucdeecsre sucdeerces sucdeercse sucdeerecs sucdeeresc
sucdeersec sucdeersce sucdeeercs sucdeeersc sucdeeecrs sucdeeecsr sucdeeescr sucdeeesrc sucdeesrec sucdeesrce sucdeeserc
sucdeesecr sucdeescer sucdeescre sucdereces sucderecse sucdereecs sucdereesc sucderesec sucderesce sucdercees sucdercese
sucdercees sucdercese sucdercsee sucdercsee sucdereces sucderecse sucdereecs sucdereesc sucderesec sucderesce sucderscee
sucderscee sucdersece sucderseec sucderseec sucdersece sucdeeercs sucdeeersc sucdeeecrs sucdeeecsr sucdeeescr sucdeeesrc
sucdeerecs sucdeeresc sucdeerces sucdeercse sucdeersce sucdeersec sucdeecres sucdeecrse sucdeecers sucdeecesr sucdeecser
sucdeecsre sucdeesrce sucdeesrec sucdeescre sucdeescer sucdeesecr sucdeeserc sucdeserec sucdeserce sucdeseerc sucdeseecr
sucdesecer sucdesecre sucdesreec sucdesrece sucdesreec sucdesrece sucdesrcee sucdesrcee sucdeserec sucdeserce sucdeseerc
sucdeseecr sucdesecer sucdesecre sucdescree sucdescree sucdescere sucdesceer sucdesceer sucdescere sucdceeres sucdceerse
sucdceeers sucdceeesr sucdceeser sucdceesre sucdcerees sucdcerese sucdcerees sucdcerese sucdcersee sucdcersee sucdceeres
sucdceerse sucdceeers sucdceeesr sucdceeser sucdceesre sucdcesree sucdcesree sucdcesere sucdceseer sucdceseer sucdcesere
sucdceeres sucdceerse sucdceeers sucdceeesr sucdceeser sucdceesre sucdcerees sucdcerese sucdcerees sucdcerese sucdcersee
sucdcersee sucdceeres sucdceerse sucdceeers sucdceeesr sucdceeser sucdceesre sucdcesree sucdcesree sucdcesere sucdceseer
sucdceseer sucdcesere sucdcreees sucdcreese sucdcreees sucdcreese sucdcresee sucdcresee sucdcreees sucdcreese sucdcreees
sucdcreese sucdcresee sucdcresee sucdcreees sucdcreese sucdcreees sucdcreese sucdcresee sucdcresee sucdcrseee sucdcrseee
sucdcrseee sucdcrseee sucdcrseee sucdcrseee sucdceeres sucdceerse sucdceeers sucdceeesr sucdceeser sucdceesre sucdcerees
sucdcerese sucdcerees sucdcerese sucdcersee sucdcersee sucdceeres sucdceerse sucdceeers sucdceeesr sucdceeser sucdceesre
sucdcesree sucdcesree sucdcesere sucdceseer sucdceseer sucdcesere sucdcseree sucdcseree sucdcseere sucdcseeer sucdcseeer
sucdcseere sucdcsreee sucdcsreee sucdcsreee sucdcsreee sucdcsreee sucdcsreee sucdcseree sucdcseree sucdcseere sucdcseeer
sucdcseeer sucdcseere sucdcseree sucdcseree sucdcseere sucdcseeer sucdcseeer sucdcseere sucdeceres sucdecerse sucdeceers
sucdeceesr sucdeceser sucdecesre sucdecrees sucdecrese sucdecrees sucdecrese sucdecrsee sucdecrsee sucdeceres sucdecerse
sucdeceers sucdeceesr sucdeceser sucdecesre sucdecsree sucdecsree sucdecsere sucdecseer sucdecseer sucdecsere sucdeecres
sucdeecrse sucdeecers sucdeecesr sucdeecser sucdeecsre sucdeerces sucdeercse sucdeerecs sucdeeresc sucdeersec sucdeersce
sucdeeercs sucdeeersc sucdeeecrs sucdeeecsr sucdeeescr sucdeeesrc sucdeesrec sucdeesrce sucdeeserc sucdeesecr sucdeescer
sucdeescre sucdereces sucderecse sucdereecs sucdereesc sucderesec sucderesce sucdercees sucdercese sucdercees sucdercese
sucdercsee sucdercsee sucdereces sucderecse sucdereecs sucdereesc sucderesec sucderesce sucderscee sucderscee sucdersece
sucderseec sucderseec sucdersece sucdeeercs sucdeeersc sucdeeecrs sucdeeecsr sucdeeescr sucdeeesrc sucdeerecs sucdeeresc
sucdeerces sucdeercse sucdeersce sucdeersec sucdeecres sucdeecrse sucdeecers sucdeecesr sucdeecser sucdeecsre sucdeesrce
sucdeesrec sucdeescre sucdeescer sucdeesecr sucdeeserc sucdeserec sucdeserce sucdeseerc sucdeseecr sucdesecer sucdesecre
sucdesreec sucdesrece sucdesreec sucdesrece sucdesrcee sucdesrcee sucdeserec sucdeserce sucdeseerc sucdeseecr sucdesecer
sucdesecre sucdescree sucdescree sucdescere sucdesceer sucdesceer sucdescere sucdrceees sucdrceese sucdrceees sucdrceese
sucdrcesee sucdrcesee sucdrceees sucdrceese sucdrceees sucdrceese sucdrcesee sucdrcesee sucdrceees sucdrceese sucdrceees
sucdrceese sucdrcesee sucdrcesee sucdrcseee sucdrcseee sucdrcseee sucdrcseee sucdrcseee sucdrcseee sucdrecees sucdrecese
sucdrecees sucdrecese sucdrecsee sucdrecsee sucdreeces sucdreecse sucdreeecs sucdreeesc sucdreesec sucdreesce sucdreeecs
sucdreeesc sucdreeces sucdreecse sucdreesce sucdreesec sucdreseec sucdresece sucdreseec sucdresece sucdrescee sucdrescee
sucdreeces sucdreecse sucdreeecs sucdreeesc sucdreesec sucdreesce sucdrecees sucdrecese sucdrecees sucdrecese sucdrecsee
sucdrecsee sucdreeces sucdreecse sucdreeecs sucdreeesc sucdreesec sucdreesce sucdrescee sucdrescee sucdresece sucdreseec
sucdreseec sucdresece sucdreeecs sucdreeesc sucdreeces sucdreecse sucdreesce sucdreesec sucdreeecs sucdreeesc sucdreeces
sucdreecse sucdreesce sucdreesec sucdrecees sucdrecese sucdrecees sucdrecese sucdrecsee sucdrecsee sucdresece sucdreseec
sucdrescee sucdrescee sucdresece sucdreseec sucdrseeec sucdrseece sucdrseeec sucdrseece sucdrsecee sucdrsecee sucdrseeec
sucdrseece sucdrseeec sucdrseece sucdrsecee sucdrsecee sucdrseeec sucdrseece sucdrseeec sucdrseece sucdrsecee sucdrsecee
sucdrsceee sucdrsceee sucdrsceee sucdrsceee sucdrsceee sucdrsceee sucdeceres sucdecerse sucdeceers sucdeceesr sucdeceser
sucdecesre sucdecrees sucdecrese sucdecrees sucdecrese sucdecrsee sucdecrsee sucdeceres sucdecerse sucdeceers sucdeceesr
sucdeceser sucdecesre sucdecsree sucdecsree sucdecsere sucdecseer sucdecseer sucdecsere sucdeecres sucdeecrse sucdeecers
sucdeecesr sucdeecser sucdeecsre sucdeerces sucdeercse sucdeerecs sucdeeresc sucdeersec sucdeersce sucdeeercs sucdeeersc
sucdeeecrs sucdeeecsr sucdeeescr sucdeeesrc sucdeesrec sucdeesrce sucdeeserc sucdeesecr sucdeescer sucdeescre sucdereces
sucderecse sucdereecs sucdereesc sucderesec sucderesce sucdercees sucdercese sucdercees sucdercese sucdercsee sucdercsee
sucdereces sucderecse sucdereecs sucdereesc sucderesec sucderesce sucderscee sucderscee sucdersece sucderseec sucderseec
sucdersece sucdeeercs sucdeeersc sucdeeecrs sucdeeecsr sucdeeescr sucdeeesrc sucdeerecs sucdeeresc sucdeerces sucdeercse
sucdeersce sucdeersec sucdeecres sucdeecrse sucdeecers sucdeecesr sucdeecser sucdeecsre sucdeesrce sucdeesrec sucdeescre
sucdeescer sucdeesecr sucdeeserc sucdeserec sucdeserce sucdeseerc sucdeseecr sucdesecer sucdesecre sucdesreec sucdesrece
sucdesreec sucdesrece sucdesrcee sucdesrcee sucdeserec sucdeserce sucdeseerc sucdeseecr sucdesecer sucdesecre sucdescree
sucdescree sucdescere sucdesceer sucdesceer sucdescere sucdsceree sucdsceree sucdsceere sucdsceeer sucdsceeer sucdsceere
sucdscreee sucdscreee sucdscreee sucdscreee sucdscreee sucdscreee sucdsceree sucdsceree sucdsceere sucdsceeer sucdsceeer
sucdsceere sucdsceree sucdsceree sucdsceere sucdsceeer sucdsceeer sucdsceere sucdsecree sucdsecree sucdsecere sucdseceer
sucdseceer sucdsecere sucdsercee sucdsercee sucdserece sucdsereec sucdsereec sucdserece sucdseerce sucdseerec sucdseecre
sucdseecer sucdseeecr sucdseeerc sucdseerec sucdseerce sucdseeerc sucdseeecr sucdseecer sucdseecre sucdsrecee sucdsrecee
sucdsreece sucdsreeec sucdsreeec sucdsreece sucdsrceee sucdsrceee sucdsrceee sucdsrceee sucdsrceee sucdsrceee sucdsrecee
sucdsrecee sucdsreece sucdsreeec sucdsreeec sucdsreece sucdsrecee sucdsrecee sucdsreece sucdsreeec sucdsreeec sucdsreece
sucdseerce sucdseerec sucdseecre sucdseecer sucdseeecr sucdseeerc sucdserece sucdsereec sucdsercee sucdsercee sucdserece
sucdsereec sucdsecree sucdsecree sucdsecere sucdseceer sucdseceer sucdsecere sucdseerce sucdseerec sucdseecre sucdseecer
sucdseeecr sucdseeerc sucdseerec sucdseerce sucdseeerc sucdseeecr sucdseecer sucdseecre sucdsereec sucdserece sucdsereec
sucdserece sucdsercee sucdsercee sucdseerec sucdseerce sucdseeerc sucdseeecr sucdseecer sucdseecre sucdsecree sucdsecree
sucdsecere sucdseceer sucdseceer sucdsecere suceedcres suceedcrse suceedcers suceedcesr suceedcser suceedcsre suceedrces
suceedrcse suceedrecs suceedresc suceedrsec suceedrsce suceedercs suceedersc suceedecrs suceedecsr suceedescr suceedesrc
suceedsrec suceedsrce suceedserc suceedsecr suceedscer suceedscre suceecdres suceecdrse suceecders suceecdesr suceecdser
suceecdsre suceecrdes suceecrdse suceecreds suceecresd suceecrsed suceecrsde suceecerds suceecersd suceecedrs suceecedsr
suceecesdr suceecesrd suceecsred suceecsrde suceecserd suceecsedr suceecsder suceecsdre suceercdes suceercdse suceerceds
suceercesd suceercsed suceercsde suceerdces suceerdcse suceerdecs suceerdesc suceerdsec suceerdsce suceeredcs suceeredsc
suceerecds suceerecsd suceerescd suceeresdc suceersdec suceersdce suceersedc suceersecd suceersced suceerscde suceeecrds
suceeecrsd suceeecdrs suceeecdsr suceeecsdr suceeecsrd suceeercds suceeercsd suceeerdcs suceeerdsc suceeersdc suceeerscd
suceeedrcs suceeedrsc suceeedcrs suceeedcsr suceeedscr suceeedsrc suceeesrdc suceeesrcd suceeesdrc suceeesdcr suceeescdr
suceeescrd suceescred suceescrde suceescerd suceescedr suceescder suceescdre suceesrced suceesrcde suceesrecd suceesredc
suceesrdec suceesrdce suceesercd suceeserdc suceesecrd suceesecdr suceesedcr suceesedrc suceesdrec suceesdrce suceesderc
suceesdecr suceesdcer suceesdcre sucedecres sucedecrse sucedecers sucedecesr sucedecser sucedecsre sucederces sucedercse
sucederecs sucederesc sucedersec sucedersce sucedeercs sucedeersc sucedeecrs sucedeecsr sucedeescr sucedeesrc sucedesrec
sucedesrce sucedeserc sucedesecr sucedescer sucedescre sucedceres sucedcerse sucedceers sucedceesr sucedceser sucedcesre
sucedcrees sucedcrese sucedcrees sucedcrese sucedcrsee sucedcrsee sucedceres sucedcerse sucedceers sucedceesr sucedceser
sucedcesre sucedcsree sucedcsree sucedcsere sucedcseer sucedcseer sucedcsere sucedrcees sucedrcese sucedrcees sucedrcese
sucedrcsee sucedrcsee sucedreces sucedrecse sucedreecs sucedreesc sucedresec sucedresce sucedreecs sucedreesc sucedreces
sucedrecse sucedresce sucedresec sucedrseec sucedrsece sucedrseec sucedrsece sucedrscee sucedrscee sucedecres sucedecrse
sucedecers sucedecesr sucedecser sucedecsre sucederces sucedercse sucederecs sucederesc sucedersec sucedersce sucedeercs
sucedeersc sucedeecrs sucedeecsr sucedeescr sucedeesrc sucedesrec sucedesrce sucedeserc sucedesecr sucedescer sucedescre
sucedscree sucedscree sucedscere sucedsceer sucedsceer sucedscere sucedsrcee sucedsrcee sucedsrece sucedsreec sucedsreec
sucedsrece sucedserce sucedserec sucedsecre sucedsecer sucedseecr sucedseerc sucedserec sucedserce sucedseerc sucedseecr
sucedsecer sucedsecre sucecderes sucecderse sucecdeers sucecdeesr sucecdeser sucecdesre sucecdrees sucecdrese sucecdrees
sucecdrese sucecdrsee sucecdrsee sucecderes sucecderse sucecdeers sucecdeesr sucecdeser sucecdesre sucecdsree sucecdsree
sucecdsere sucecdseer sucecdseer sucecdsere sucecedres sucecedrse suceceders sucecedesr sucecedser sucecedsre sucecerdes
sucecerdse sucecereds suceceresd sucecersed sucecersde suceceerds suceceersd suceceedrs suceceedsr suceceesdr suceceesrd
sucecesred sucecesrde suceceserd sucecesedr sucecesder sucecesdre sucecredes sucecredse sucecreeds sucecreesd sucecresed
sucecresde sucecrdees sucecrdese sucecrdees sucecrdese sucecrdsee sucecrdsee sucecredes sucecredse sucecreeds sucecreesd
sucecresed sucecresde sucecrsdee sucecrsdee sucecrsede sucecrseed sucecrseed sucecrsede suceceerds suceceersd suceceedrs
suceceedsr suceceesdr suceceesrd sucecereds suceceresd sucecerdes sucecerdse sucecersde sucecersed sucecedres sucecedrse
suceceders sucecedesr sucecedser sucecedsre sucecesrde sucecesred sucecesdre sucecesder sucecesedr suceceserd sucecsered
sucecserde sucecseerd sucecseedr sucecseder sucecsedre sucecsreed sucecsrede sucecsreed sucecsrede sucecsrdee sucecsrdee
sucecsered sucecserde sucecseerd sucecseedr sucecseder sucecsedre sucecsdree sucecsdree sucecsdere sucecsdeer sucecsdeer
sucecsdere sucerdcees sucerdcese sucerdcees sucerdcese sucerdcsee sucerdcsee sucerdeces sucerdecse sucerdeecs sucerdeesc
sucerdesec sucerdesce sucerdeecs sucerdeesc sucerdeces sucerdecse sucerdesce sucerdesec sucerdseec sucerdsece sucerdseec
sucerdsece sucerdscee sucerdscee sucercdees sucercdese sucercdees sucercdese sucercdsee sucercdsee sucercedes sucercedse
sucerceeds sucerceesd sucercesed sucercesde sucerceeds sucerceesd sucercedes sucercedse sucercesde sucercesed sucercseed
sucercsede sucercseed sucercsede sucercsdee sucercsdee sucerecdes sucerecdse sucereceds sucerecesd sucerecsed sucerecsde
suceredces suceredcse suceredecs suceredesc suceredsec suceredsce sucereedcs sucereedsc sucereecds sucereecsd sucereescd
sucereesdc suceresdec suceresdce suceresedc suceresecd suceresced sucerescde sucereceds sucerecesd sucerecdes sucerecdse
sucerecsde sucerecsed sucereecds sucereecsd sucereedcs sucereedsc sucereesdc sucereescd suceredecs suceredesc suceredces
suceredcse suceredsce suceredsec suceresedc suceresecd suceresdec suceresdce sucerescde suceresced sucersceed sucerscede
sucersceed sucerscede sucerscdee sucerscdee sucerseced sucersecde sucerseecd sucerseedc sucersedec sucersedce sucerseecd
sucerseedc sucerseced sucersecde sucersedce sucersedec sucersdeec sucersdece sucersdeec sucersdece sucersdcee sucersdcee
suceedcres suceedcrse suceedcers suceedcesr suceedcser suceedcsre suceedrces suceedrcse suceedrecs suceedresc suceedrsec
suceedrsce suceedercs suceedersc suceedecrs suceedecsr suceedescr suceedesrc suceedsrec suceedsrce suceedserc suceedsecr
suceedscer suceedscre suceecdres suceecdrse suceecders suceecdesr suceecdser suceecdsre suceecrdes suceecrdse suceecreds
suceecresd suceecrsed suceecrsde suceecerds suceecersd suceecedrs suceecedsr suceecesdr suceecesrd suceecsred suceecsrde
suceecserd suceecsedr suceecsder suceecsdre suceercdes suceercdse suceerceds suceercesd suceercsed suceercsde suceerdces
suceerdcse suceerdecs suceerdesc suceerdsec suceerdsce suceeredcs suceeredsc suceerecds suceerecsd suceerescd suceeresdc
suceersdec suceersdce suceersedc suceersecd suceersced suceerscde suceeecrds suceeecrsd suceeecdrs suceeecdsr suceeecsdr
suceeecsrd suceeercds suceeercsd suceeerdcs suceeerdsc suceeersdc suceeerscd suceeedrcs suceeedrsc suceeedcrs suceeedcsr
suceeedscr suceeedsrc suceeesrdc suceeesrcd suceeesdrc suceeesdcr suceeescdr suceeescrd suceescred suceescrde suceescerd
suceescedr suceescder suceescdre suceesrced suceesrcde suceesrecd suceesredc suceesrdec suceesrdce suceesercd suceeserdc
suceesecrd suceesecdr suceesedcr suceesedrc suceesdrec suceesdrce suceesderc suceesdecr suceesdcer suceesdcre sucesdcree
sucesdcree sucesdcere sucesdceer sucesdceer sucesdcere sucesdrcee sucesdrcee sucesdrece sucesdreec sucesdreec sucesdrece
sucesderce sucesderec sucesdecre sucesdecer sucesdeecr sucesdeerc sucesderec sucesderce sucesdeerc sucesdeecr sucesdecer
sucesdecre sucescdree sucescdree sucescdere sucescdeer sucescdeer sucescdere sucescrdee sucescrdee sucescrede sucescreed
sucescreed sucescrede sucescerde sucescered sucescedre sucesceder sucesceedr sucesceerd sucescered sucescerde sucesceerd
sucesceedr sucesceder sucescedre sucesrcdee sucesrcdee sucesrcede sucesrceed sucesrceed sucesrcede sucesrdcee sucesrdcee
sucesrdece sucesrdeec sucesrdeec sucesrdece sucesredce sucesredec sucesrecde sucesreced sucesreecd sucesreedc sucesredec
sucesredce sucesreedc sucesreecd sucesreced sucesrecde sucesecrde sucesecred sucesecdre sucesecder sucesecedr sucesecerd
sucesercde suceserced suceserdce suceserdec suceseredc suceserecd sucesedrce sucesedrec sucesedcre sucesedcer sucesedecr
sucesederc suceseerdc suceseercd suceseedrc suceseedcr suceseecdr suceseecrd sucesecred sucesecrde sucesecerd sucesecedr
sucesecder sucesecdre suceserced sucesercde suceserecd suceseredc suceserdec suceserdce suceseercd suceseerdc suceseecrd
suceseecdr suceseedcr suceseedrc sucesedrec sucesedrce sucesederc sucesedecr sucesedcer sucesedcre sucredeces sucredecse
sucredeecs sucredeesc sucredesec sucredesce sucredcees sucredcese sucredcees sucredcese sucredcsee sucredcsee sucredeces
sucredecse sucredeecs sucredeesc sucredesec sucredesce sucredscee sucredscee sucredsece sucredseec sucredseec sucredsece
sucreedces sucreedcse sucreedecs sucreedesc sucreedsec sucreedsce sucreecdes sucreecdse sucreeceds sucreecesd sucreecsed
sucreecsde sucreeecds sucreeecsd sucreeedcs sucreeedsc sucreeesdc sucreeescd sucreesced sucreescde sucreesecd sucreesedc
sucreesdec sucreesdce sucrecedes sucrecedse sucreceeds sucreceesd sucrecesed sucrecesde sucrecdees sucrecdese sucrecdees
sucrecdese sucrecdsee sucrecdsee sucrecedes sucrecedse sucreceeds sucreceesd sucrecesed sucrecesde sucrecsdee sucrecsdee
sucrecsede sucrecseed sucrecseed sucrecsede sucreeecds sucreeecsd sucreeedcs sucreeedsc sucreeesdc sucreeescd sucreeceds
sucreecesd sucreecdes sucreecdse sucreecsde sucreecsed sucreedces sucreedcse sucreedecs sucreedesc sucreedsec sucreedsce
sucreescde sucreesced sucreesdce sucreesdec sucreesedc sucreesecd sucreseced sucresecde sucreseecd sucreseedc sucresedec
sucresedce sucresceed sucrescede sucresceed sucrescede sucrescdee sucrescdee sucreseced sucresecde sucreseecd sucreseedc
sucresedec sucresedce sucresdcee sucresdcee sucresdece sucresdeec sucresdeec sucresdece sucrdeeces sucrdeecse sucrdeeecs
sucrdeeesc sucrdeesec sucrdeesce sucrdecees sucrdecese sucrdecees sucrdecese sucrdecsee sucrdecsee sucrdeeces sucrdeecse
sucrdeeecs sucrdeeesc sucrdeesec sucrdeesce sucrdescee sucrdescee sucrdesece sucrdeseec sucrdeseec sucrdesece sucrdeeces
sucrdeecse sucrdeeecs sucrdeeesc sucrdeesec sucrdeesce sucrdecees sucrdecese sucrdecees sucrdecese sucrdecsee sucrdecsee
sucrdeeces sucrdeecse sucrdeeecs sucrdeeesc sucrdeesec sucrdeesce sucrdescee sucrdescee sucrdesece sucrdeseec sucrdeseec
sucrdesece sucrdceees sucrdceese sucrdceees sucrdceese sucrdcesee sucrdcesee sucrdceees sucrdceese sucrdceees sucrdceese
sucrdcesee sucrdcesee sucrdceees sucrdceese sucrdceees sucrdceese sucrdcesee sucrdcesee sucrdcseee sucrdcseee sucrdcseee
sucrdcseee sucrdcseee sucrdcseee sucrdeeces sucrdeecse sucrdeeecs sucrdeeesc sucrdeesec sucrdeesce sucrdecees sucrdecese
sucrdecees sucrdecese sucrdecsee sucrdecsee sucrdeeces sucrdeecse sucrdeeecs sucrdeeesc sucrdeesec sucrdeesce sucrdescee
sucrdescee sucrdesece sucrdeseec sucrdeseec sucrdesece sucrdsecee sucrdsecee sucrdseece sucrdseeec sucrdseeec sucrdseece
sucrdsceee sucrdsceee sucrdsceee sucrdsceee sucrdsceee sucrdsceee sucrdsecee sucrdsecee sucrdseece sucrdseeec sucrdseeec
sucrdseece sucrdsecee sucrdsecee sucrdseece sucrdseeec sucrdseeec sucrdseece sucredeces sucredecse sucredeecs sucredeesc
sucredesec sucredesce sucredcees sucredcese sucredcees sucredcese sucredcsee sucredcsee sucredeces sucredecse sucredeecs
sucredeesc sucredesec sucredesce sucredscee sucredscee sucredsece sucredseec sucredseec sucredsece sucreedces sucreedcse
sucreedecs sucreedesc sucreedsec sucreedsce sucreecdes sucreecdse sucreeceds sucreecesd sucreecsed sucreecsde sucreeecds
sucreeecsd sucreeedcs sucreeedsc sucreeesdc sucreeescd sucreesced sucreescde sucreesecd sucreesedc sucreesdec sucreesdce
sucrecedes sucrecedse sucreceeds sucreceesd sucrecesed sucrecesde sucrecdees sucrecdese sucrecdees sucrecdese sucrecdsee
sucrecdsee sucrecedes sucrecedse sucreceeds sucreceesd sucrecesed sucrecesde sucrecsdee sucrecsdee sucrecsede sucrecseed
sucrecseed sucrecsede sucreeecds sucreeecsd sucreeedcs sucreeedsc sucreeesdc sucreeescd sucreeceds sucreecesd sucreecdes
sucreecdse sucreecsde sucreecsed sucreedces sucreedcse sucreedecs sucreedesc sucreedsec sucreedsce sucreescde sucreesced
sucreesdce sucreesdec sucreesedc sucreesecd sucreseced sucresecde sucreseecd sucreseedc sucresedec sucresedce sucresceed
sucrescede sucresceed sucrescede sucrescdee sucrescdee sucreseced sucresecde sucreseecd sucreseedc sucresedec sucresedce
sucresdcee sucresdcee sucresdece sucresdeec sucresdeec sucresdece sucrcdeees sucrcdeese sucrcdeees sucrcdeese sucrcdesee
sucrcdesee sucrcdeees sucrcdeese sucrcdeees sucrcdeese sucrcdesee sucrcdesee sucrcdeees sucrcdeese sucrcdeees sucrcdeese
sucrcdesee sucrcdesee sucrcdseee sucrcdseee sucrcdseee sucrcdseee sucrcdseee sucrcdseee sucrcedees sucrcedese sucrcedees
sucrcedese sucrcedsee sucrcedsee sucrceedes sucrceedse sucrceeeds sucrceeesd sucrceesed sucrceesde sucrceeeds sucrceeesd
sucrceedes sucrceedse sucrceesde sucrceesed sucrceseed sucrcesede sucrceseed sucrcesede sucrcesdee sucrcesdee sucrceedes
sucrceedse sucrceeeds sucrceeesd sucrceesed sucrceesde sucrcedees sucrcedese sucrcedees sucrcedese sucrcedsee sucrcedsee
sucrceedes sucrceedse sucrceeeds sucrceeesd sucrceesed sucrceesde sucrcesdee sucrcesdee sucrcesede sucrceseed sucrceseed
sucrcesede sucrceeeds sucrceeesd sucrceedes sucrceedse sucrceesde sucrceesed sucrceeeds sucrceeesd sucrceedes sucrceedse
sucrceesde sucrceesed sucrcedees sucrcedese sucrcedees sucrcedese sucrcedsee sucrcedsee sucrcesede sucrceseed sucrcesdee
sucrcesdee sucrcesede sucrceseed sucrcseeed sucrcseede sucrcseeed sucrcseede sucrcsedee sucrcsedee sucrcseeed sucrcseede
sucrcseeed sucrcseede sucrcsedee sucrcsedee sucrcseeed sucrcseede sucrcseeed sucrcseede sucrcsedee sucrcsedee sucrcsdeee
sucrcsdeee sucrcsdeee sucrcsdeee sucrcsdeee sucrcsdeee sucredeces sucredecse sucredeecs sucredeesc sucredesec sucredesce
sucredcees sucredcese sucredcees sucredcese sucredcsee sucredcsee sucredeces sucredecse sucredeecs sucredeesc sucredesec
sucredesce sucredscee sucredscee sucredsece sucredseec sucredseec sucredsece sucreedces sucreedcse sucreedecs sucreedesc
sucreedsec sucreedsce sucreecdes sucreecdse sucreeceds sucreecesd sucreecsed sucreecsde sucreeecds sucreeecsd sucreeedcs
sucreeedsc sucreeesdc sucreeescd sucreesced sucreescde sucreesecd sucreesedc sucreesdec sucreesdce sucrecedes sucrecedse
sucreceeds sucreceesd sucrecesed sucrecesde sucrecdees sucrecdese sucrecdees sucrecdese sucrecdsee sucrecdsee sucrecedes
sucrecedse sucreceeds sucreceesd sucrecesed sucrecesde sucrecsdee sucrecsdee sucrecsede sucrecseed sucrecseed sucrecsede
sucreeecds sucreeecsd sucreeedcs sucreeedsc sucreeesdc sucreeescd sucreeceds sucreecesd sucreecdes sucreecdse sucreecsde
sucreecsed sucreedces sucreedcse sucreedecs sucreedesc sucreedsec sucreedsce sucreescde sucreesced sucreesdce sucreesdec
sucreesedc sucreesecd sucreseced sucresecde sucreseecd sucreseedc sucresedec sucresedce sucresceed sucrescede sucresceed
sucrescede sucrescdee sucrescdee sucreseced sucresecde sucreseecd sucreseedc sucresedec sucresedce sucresdcee sucresdcee
sucresdece sucresdeec sucresdeec sucresdece sucrsdecee sucrsdecee sucrsdeece sucrsdeeec sucrsdeeec sucrsdeece sucrsdceee
sucrsdceee sucrsdceee sucrsdceee sucrsdceee sucrsdceee sucrsdecee sucrsdecee sucrsdeece sucrsdeeec sucrsdeeec sucrsdeece
sucrsdecee sucrsdecee sucrsdeece sucrsdeeec sucrsdeeec sucrsdeece sucrsedcee sucrsedcee sucrsedece sucrsedeec sucrsedeec
sucrsedece sucrsecdee sucrsecdee sucrsecede sucrseceed sucrseceed sucrsecede sucrseecde sucrseeced sucrseedce sucrseedec
sucrseeedc sucrseeecd sucrseeced sucrseecde sucrseeecd sucrseeedc sucrseedec sucrseedce sucrscedee sucrscedee sucrsceede
sucrsceeed sucrsceeed sucrsceede sucrscdeee sucrscdeee sucrscdeee sucrscdeee sucrscdeee sucrscdeee sucrscedee sucrscedee
sucrsceede sucrsceeed sucrsceeed sucrsceede sucrscedee sucrscedee sucrsceede sucrsceeed sucrsceeed sucrsceede sucrseecde
sucrseeced sucrseedce sucrseedec sucrseeedc sucrseeecd sucrsecede sucrseceed sucrsecdee sucrsecdee sucrsecede sucrseceed
sucrsedcee sucrsedcee sucrsedece sucrsedeec sucrsedeec sucrsedece sucrseecde sucrseeced sucrseedce sucrseedec sucrseeedc
sucrseeecd sucrseeced sucrseecde sucrseeecd sucrseeedc sucrseedec sucrseedce sucrseceed sucrsecede sucrseceed sucrsecede
sucrsecdee sucrsecdee sucrseeced sucrseecde sucrseeecd sucrseeedc sucrseedec sucrseedce sucrsedcee sucrsedcee sucrsedece
sucrsedeec sucrsedeec sucrsedece suceedercs suceedersc suceedecrs suceedecsr suceedescr suceedesrc suceedrecs suceedresc
suceedrces suceedrcse suceedrsce suceedrsec suceedcres suceedcrse suceedcers suceedcesr suceedcser suceedcsre suceedsrce
suceedsrec suceedscre suceedscer suceedsecr suceedserc suceeedrcs suceeedrsc suceeedcrs suceeedcsr suceeedscr suceeedsrc
suceeerdcs suceeerdsc suceeercds suceeercsd suceeerscd suceeersdc suceeecrds suceeecrsd suceeecdrs suceeecdsr suceeecsdr
suceeecsrd suceeesrcd suceeesrdc suceeescrd suceeescdr suceeesdcr suceeesdrc suceeredcs suceeredsc suceerecds suceerecsd
suceerescd suceeresdc suceerdecs suceerdesc suceerdces suceerdcse suceerdsce suceerdsec suceercdes suceercdse suceerceds
suceercesd suceercsed suceercsde suceersdce suceersdec suceerscde suceersced suceersecd suceersedc suceecerds suceecersd
suceecedrs suceecedsr suceecesdr suceecesrd suceecreds suceecresd suceecrdes suceecrdse suceecrsde suceecrsed suceecdres
suceecdrse suceecders suceecdesr suceecdser suceecdsre suceecsrde suceecsred suceecsdre suceecsder suceecsedr suceecserd
suceesercd suceeserdc suceesecrd suceesecdr suceesedcr suceesedrc suceesrecd suceesredc suceesrced suceesrcde suceesrdce
suceesrdec suceescred suceescrde suceescerd suceescedr suceescder suceescdre suceesdrce suceesdrec suceesdcre suceesdcer
suceesdecr suceesderc sucedeercs sucedeersc sucedeecrs sucedeecsr sucedeescr sucedeesrc sucederecs sucederesc sucederces
sucedercse sucedersce sucedersec sucedecres sucedecrse sucedecers sucedecesr sucedecser sucedecsre sucedesrce sucedesrec
sucedescre sucedescer sucedesecr sucedeserc sucedeercs sucedeersc sucedeecrs sucedeecsr sucedeescr sucedeesrc sucederecs
sucederesc sucederces sucedercse sucedersce sucedersec sucedecres sucedecrse sucedecers sucedecesr sucedecser sucedecsre
sucedesrce sucedesrec sucedescre sucedescer sucedesecr sucedeserc sucedreecs sucedreesc sucedreces sucedrecse sucedresce
sucedresec sucedreecs sucedreesc sucedreces sucedrecse sucedresce sucedresec sucedrcees sucedrcese sucedrcees sucedrcese
sucedrcsee sucedrcsee sucedrsece sucedrseec sucedrscee sucedrscee sucedrsece sucedrseec sucedceres sucedcerse sucedceers
sucedceesr sucedceser sucedcesre sucedcrees sucedcrese sucedcrees sucedcrese sucedcrsee sucedcrsee sucedceres sucedcerse
sucedceers sucedceesr sucedceser sucedcesre sucedcsree sucedcsree sucedcsere sucedcseer sucedcseer sucedcsere sucedserce
sucedserec sucedsecre sucedsecer sucedseecr sucedseerc sucedsrece sucedsreec sucedsrcee sucedsrcee sucedsrece sucedsreec
sucedscree sucedscree sucedscere sucedsceer sucedsceer sucedscere sucedserce sucedserec sucedsecre sucedsecer sucedseecr
sucedseerc suceedercs suceedersc suceedecrs suceedecsr suceedescr suceedesrc suceedrecs suceedresc suceedrces suceedrcse
suceedrsce suceedrsec suceedcres suceedcrse suceedcers suceedcesr suceedcser suceedcsre suceedsrce suceedsrec suceedscre
suceedscer suceedsecr suceedserc suceeedrcs suceeedrsc suceeedcrs suceeedcsr suceeedscr suceeedsrc suceeerdcs suceeerdsc
suceeercds suceeercsd suceeerscd suceeersdc suceeecrds suceeecrsd suceeecdrs suceeecdsr suceeecsdr suceeecsrd suceeesrcd
suceeesrdc suceeescrd suceeescdr suceeesdcr suceeesdrc suceeredcs suceeredsc suceerecds suceerecsd suceerescd suceeresdc
suceerdecs suceerdesc suceerdces suceerdcse suceerdsce suceerdsec suceercdes suceercdse suceerceds suceercesd suceercsed
suceercsde suceersdce suceersdec suceerscde suceersced suceersecd suceersedc suceecerds suceecersd suceecedrs suceecedsr
suceecesdr suceecesrd suceecreds suceecresd suceecrdes suceecrdse suceecrsde suceecrsed suceecdres suceecdrse suceecders
suceecdesr suceecdser suceecdsre suceecsrde suceecsred suceecsdre suceecsder suceecsedr suceecserd suceesercd suceeserdc
suceesecrd suceesecdr suceesedcr suceesedrc suceesrecd suceesredc suceesrced suceesrcde suceesrdce suceesrdec suceescred
suceescrde suceescerd suceescedr suceescder suceescdre suceesdrce suceesdrec suceesdcre suceesdcer suceesdecr suceesderc
sucerdeecs sucerdeesc sucerdeces sucerdecse sucerdesce sucerdesec sucerdeecs sucerdeesc sucerdeces sucerdecse sucerdesce
sucerdesec sucerdcees sucerdcese sucerdcees sucerdcese sucerdcsee sucerdcsee sucerdsece sucerdseec sucerdscee sucerdscee
sucerdsece sucerdseec suceredecs suceredesc suceredces suceredcse suceredsce suceredsec sucereedcs sucereedsc sucereecds
sucereecsd sucereescd sucereesdc sucereceds sucerecesd sucerecdes sucerecdse sucerecsde sucerecsed suceresecd suceresedc
suceresced sucerescde suceresdce suceresdec sucereedcs sucereedsc sucereecds sucereecsd sucereescd sucereesdc suceredecs
suceredesc suceredces suceredcse suceredsce suceredsec sucerecdes sucerecdse sucereceds sucerecesd sucerecsed sucerecsde
suceresdce suceresdec sucerescde suceresced suceresecd suceresedc sucerceeds sucerceesd sucercedes sucercedse sucercesde
sucercesed sucerceeds sucerceesd sucercedes sucercedse sucercesde sucercesed sucercdees sucercdese sucercdees sucercdese
sucercdsee sucercdsee sucercsede sucercseed sucercsdee sucercsdee sucercsede sucercseed sucerseecd sucerseedc sucerseced
sucersecde sucersedce sucersedec sucerseecd sucerseedc sucerseced sucersecde sucersedce sucersedec sucersceed sucerscede
sucersceed sucerscede sucerscdee sucerscdee sucersdece sucersdeec sucersdcee sucersdcee sucersdece sucersdeec sucecderes
sucecderse sucecdeers sucecdeesr sucecdeser sucecdesre sucecdrees sucecdrese sucecdrees sucecdrese sucecdrsee sucecdrsee
sucecderes sucecderse sucecdeers sucecdeesr sucecdeser sucecdesre sucecdsree sucecdsree sucecdsere sucecdseer sucecdseer
sucecdsere sucecedres sucecedrse suceceders sucecedesr sucecedser sucecedsre sucecerdes sucecerdse sucecereds suceceresd
sucecersed sucecersde suceceerds suceceersd suceceedrs suceceedsr suceceesdr suceceesrd sucecesred sucecesrde suceceserd
sucecesedr sucecesder sucecesdre sucecredes sucecredse sucecreeds sucecreesd sucecresed sucecresde sucecrdees sucecrdese
sucecrdees sucecrdese sucecrdsee sucecrdsee sucecredes sucecredse sucecreeds sucecreesd sucecresed sucecresde sucecrsdee
sucecrsdee sucecrsede sucecrseed sucecrseed sucecrsede suceceerds suceceersd suceceedrs suceceedsr suceceesdr suceceesrd
sucecereds suceceresd sucecerdes sucecerdse sucecersde sucecersed sucecedres sucecedrse suceceders sucecedesr sucecedser
sucecedsre sucecesrde sucecesred sucecesdre sucecesder sucecesedr suceceserd sucecsered sucecserde sucecseerd sucecseedr
sucecseder sucecsedre sucecsreed sucecsrede sucecsreed sucecsrede sucecsrdee sucecsrdee sucecsered sucecserde sucecseerd
sucecseedr sucecseder sucecsedre sucecsdree sucecsdree sucecsdere sucecsdeer sucecsdeer sucecsdere sucesderce sucesderec
sucesdecre sucesdecer sucesdeecr sucesdeerc sucesdrece sucesdreec sucesdrcee sucesdrcee sucesdrece sucesdreec sucesdcree
sucesdcree sucesdcere sucesdceer sucesdceer sucesdcere sucesderce sucesderec sucesdecre sucesdecer sucesdeecr sucesdeerc
sucesedrce sucesedrec sucesedcre sucesedcer sucesedecr sucesederc suceserdce suceserdec sucesercde suceserced suceserecd
suceseredc sucesecrde sucesecred sucesecdre sucesecder sucesecedr sucesecerd suceseercd suceseerdc suceseecrd suceseecdr
suceseedcr suceseedrc sucesredce sucesredec sucesrecde sucesreced sucesreecd sucesreedc sucesrdece sucesrdeec sucesrdcee
sucesrdcee sucesrdece sucesrdeec sucesrcdee sucesrcdee sucesrcede sucesrceed sucesrceed sucesrcede sucesredce sucesredec
sucesrecde sucesreced sucesreecd sucesreedc sucescerde sucescered sucescedre sucesceder sucesceedr sucesceerd sucescrede
sucescreed sucescrdee sucescrdee sucescrede sucescreed sucescdree sucescdree sucescdere sucescdeer sucescdeer sucescdere
sucescerde sucescered sucescedre sucesceder sucesceedr sucesceerd suceseercd suceseerdc suceseecrd suceseecdr suceseedcr
suceseedrc suceserecd suceseredc suceserced sucesercde suceserdce suceserdec sucesecred sucesecrde sucesecerd sucesecedr
sucesecder sucesecdre sucesedrce sucesedrec sucesedcre sucesedcer sucesedecr sucesederc sucsederec sucsederce sucsedeerc
sucsedeecr sucsedecer sucsedecre sucsedreec sucsedrece sucsedreec sucsedrece sucsedrcee sucsedrcee sucsederec sucsederce
sucsedeerc sucsedeecr sucsedecer sucsedecre sucsedcree sucsedcree sucsedcere sucsedceer sucsedceer sucsedcere sucseedrec
sucseedrce sucseederc sucseedecr sucseedcer sucseedcre sucseerdec sucseerdce sucseeredc sucseerecd sucseerced sucseercde
sucseeerdc sucseeercd sucseeedrc sucseeedcr sucseeecdr sucseeecrd sucseecred sucseecrde sucseecerd sucseecedr sucseecder
sucseecdre sucseredec sucseredce sucsereedc sucsereecd sucsereced sucserecde sucserdeec sucserdece sucserdeec sucserdece
sucserdcee sucserdcee sucseredec sucseredce sucsereedc sucsereecd sucsereced sucserecde sucsercdee sucsercdee sucsercede
sucserceed sucserceed sucsercede sucseeerdc sucseeercd sucseeedrc sucseeedcr sucseeecdr sucseeecrd sucseeredc sucseerecd
sucseerdec sucseerdce sucseercde sucseerced sucseedrec sucseedrce sucseederc sucseedecr sucseedcer sucseedcre sucseecrde
sucseecred sucseecdre sucseecder sucseecedr sucseecerd sucsecered sucsecerde sucseceerd sucseceedr sucseceder sucsecedre
sucsecreed sucsecrede sucsecreed sucsecrede sucsecrdee sucsecrdee sucsecered sucsecerde sucseceerd sucseceedr sucseceder
sucsecedre sucsecdree sucsecdree sucsecdere sucsecdeer sucsecdeer sucsecdere sucsdeerec sucsdeerce sucsdeeerc sucsdeeecr
sucsdeecer sucsdeecre sucsdereec sucsderece sucsdereec sucsderece sucsdercee sucsdercee sucsdeerec sucsdeerce sucsdeeerc
sucsdeeecr sucsdeecer sucsdeecre sucsdecree sucsdecree sucsdecere sucsdeceer sucsdeceer sucsdecere sucsdeerec sucsdeerce
sucsdeeerc sucsdeeecr sucsdeecer sucsdeecre sucsdereec sucsderece sucsdereec sucsderece sucsdercee sucsdercee sucsdeerec
sucsdeerce sucsdeeerc sucsdeeecr sucsdeecer sucsdeecre sucsdecree sucsdecree sucsdecere sucsdeceer sucsdeceer sucsdecere
sucsdreeec sucsdreece sucsdreeec sucsdreece sucsdrecee sucsdrecee sucsdreeec sucsdreece sucsdreeec sucsdreece sucsdrecee
sucsdrecee sucsdreeec sucsdreece sucsdreeec sucsdreece sucsdrecee sucsdrecee sucsdrceee sucsdrceee sucsdrceee sucsdrceee
sucsdrceee sucsdrceee sucsdeerec sucsdeerce sucsdeeerc sucsdeeecr sucsdeecer sucsdeecre sucsdereec sucsderece sucsdereec
sucsderece sucsdercee sucsdercee sucsdeerec sucsdeerce sucsdeeerc sucsdeeecr sucsdeecer sucsdeecre sucsdecree sucsdecree
sucsdecere sucsdeceer sucsdeceer sucsdecere sucsdceree sucsdceree sucsdceere sucsdceeer sucsdceeer sucsdceere sucsdcreee
sucsdcreee sucsdcreee sucsdcreee sucsdcreee sucsdcreee sucsdceree sucsdceree sucsdceere sucsdceeer sucsdceeer sucsdceere
sucsdceree sucsdceree sucsdceere sucsdceeer sucsdceeer sucsdceere sucsederec sucsederce sucsedeerc sucsedeecr sucsedecer
sucsedecre sucsedreec sucsedrece sucsedreec sucsedrece sucsedrcee sucsedrcee sucsederec sucsederce sucsedeerc sucsedeecr
sucsedecer sucsedecre sucsedcree sucsedcree sucsedcere sucsedceer sucsedceer sucsedcere sucseedrec sucseedrce sucseederc
sucseedecr sucseedcer sucseedcre sucseerdec sucseerdce sucseeredc sucseerecd sucseerced sucseercde sucseeerdc sucseeercd
sucseeedrc sucseeedcr sucseeecdr sucseeecrd sucseecred sucseecrde sucseecerd sucseecedr sucseecder sucseecdre sucseredec
sucseredce sucsereedc sucsereecd sucsereced sucserecde sucserdeec sucserdece sucserdeec sucserdece sucserdcee sucserdcee
sucseredec sucseredce sucsereedc sucsereecd sucsereced sucserecde sucsercdee sucsercdee sucsercede sucserceed sucserceed
sucsercede sucseeerdc sucseeercd sucseeedrc sucseeedcr sucseeecdr sucseeecrd sucseeredc sucseerecd sucseerdec sucseerdce
sucseercde sucseerced sucseedrec sucseedrce sucseederc sucseedecr sucseedcer sucseedcre sucseecrde sucseecred sucseecdre
sucseecder sucseecedr sucseecerd sucsecered sucsecerde sucseceerd sucseceedr sucseceder sucsecedre sucsecreed sucsecrede
sucsecreed sucsecrede sucsecrdee sucsecrdee sucsecered sucsecerde sucseceerd sucseceedr sucseceder sucsecedre sucsecdree
sucsecdree sucsecdere sucsecdeer sucsecdeer sucsecdere sucsrdeeec sucsrdeece sucsrdeeec sucsrdeece sucsrdecee sucsrdecee
sucsrdeeec sucsrdeece sucsrdeeec sucsrdeece sucsrdecee sucsrdecee sucsrdeeec sucsrdeece sucsrdeeec sucsrdeece sucsrdecee
sucsrdecee sucsrdceee sucsrdceee sucsrdceee sucsrdceee sucsrdceee sucsrdceee sucsredeec sucsredece sucsredeec sucsredece
sucsredcee sucsredcee sucsreedec sucsreedce sucsreeedc sucsreeecd sucsreeced sucsreecde sucsreeedc sucsreeecd sucsreedec
sucsreedce sucsreecde sucsreeced sucsreceed sucsrecede sucsreceed sucsrecede sucsrecdee sucsrecdee sucsreedec sucsreedce
sucsreeedc sucsreeecd sucsreeced sucsreecde sucsredeec sucsredece sucsredeec sucsredece sucsredcee sucsredcee sucsreedec
sucsreedce sucsreeedc sucsreeecd sucsreeced sucsreecde sucsrecdee sucsrecdee sucsrecede sucsreceed sucsreceed sucsrecede
sucsreeedc sucsreeecd sucsreedec sucsreedce sucsreecde sucsreeced sucsreeedc sucsreeecd sucsreedec sucsreedce sucsreecde
sucsreeced sucsredeec sucsredece sucsredeec sucsredece sucsredcee sucsredcee sucsrecede sucsreceed sucsrecdee sucsrecdee
sucsrecede sucsreceed sucsrceeed sucsrceede sucsrceeed sucsrceede sucsrcedee sucsrcedee sucsrceeed sucsrceede sucsrceeed
sucsrceede sucsrcedee sucsrcedee sucsrceeed sucsrceede sucsrceeed sucsrceede sucsrcedee sucsrcedee sucsrcdeee sucsrcdeee
sucsrcdeee sucsrcdeee sucsrcdeee sucsrcdeee sucsederec sucsederce sucsedeerc sucsedeecr sucsedecer sucsedecre sucsedreec
sucsedrece sucsedreec sucsedrece sucsedrcee sucsedrcee sucsederec sucsederce sucsedeerc sucsedeecr sucsedecer sucsedecre
sucsedcree sucsedcree sucsedcere sucsedceer sucsedceer sucsedcere sucseedrec sucseedrce sucseederc sucseedecr sucseedcer
sucseedcre sucseerdec sucseerdce sucseeredc sucseerecd sucseerced sucseercde sucseeerdc sucseeercd sucseeedrc sucseeedcr
sucseeecdr sucseeecrd sucseecred sucseecrde sucseecerd sucseecedr sucseecder sucseecdre sucseredec sucseredce sucsereedc
sucsereecd sucsereced sucserecde sucserdeec sucserdece sucserdeec sucserdece sucserdcee sucserdcee sucseredec sucseredce
sucsereedc sucsereecd sucsereced sucserecde sucsercdee sucsercdee sucsercede sucserceed sucserceed sucsercede sucseeerdc
sucseeercd sucseeedrc sucseeedcr sucseeecdr sucseeecrd sucseeredc sucseerecd sucseerdec sucseerdce sucseercde sucseerced
sucseedrec sucseedrce sucseederc sucseedecr sucseedcer sucseedcre sucseecrde sucseecred sucseecdre sucseecder sucseecedr
sucseecerd sucsecered sucsecerde sucseceerd sucseceedr sucseceder sucsecedre sucsecreed sucsecrede sucsecreed sucsecrede
sucsecrdee sucsecrdee sucsecered sucsecerde sucseceerd sucseceedr sucseceder sucsecedre sucsecdree sucsecdree sucsecdere
sucsecdeer sucsecdeer sucsecdere sucscderee sucscderee sucscdeere sucscdeeer sucscdeeer sucscdeere sucscdreee sucscdreee
sucscdreee sucscdreee sucscdreee sucscdreee sucscderee sucscderee sucscdeere sucscdeeer sucscdeeer sucscdeere sucscderee
sucscderee sucscdeere sucscdeeer sucscdeeer sucscdeere sucscedree sucscedree sucscedere sucscedeer sucscedeer sucscedere
sucscerdee sucscerdee sucscerede sucscereed sucscereed sucscerede sucsceerde sucsceered sucsceedre sucsceeder sucsceeedr
sucsceeerd sucsceered sucsceerde sucsceeerd sucsceeedr sucsceeder sucsceedre sucscredee sucscredee sucscreede sucscreeed
sucscreeed sucscreede sucscrdeee sucscrdeee sucscrdeee sucscrdeee sucscrdeee sucscrdeee sucscredee sucscredee sucscreede
sucscreeed sucscreeed sucscreede sucscredee sucscredee sucscreede sucscreeed sucscreeed sucscreede sucsceerde sucsceered
sucsceedre sucsceeder sucsceeedr sucsceeerd sucscerede sucscereed sucscerdee sucscerdee sucscerede sucscereed sucscedree
sucscedree sucscedere sucscedeer sucscedeer sucscedere sucsceerde sucsceered sucsceedre sucsceeder sucsceeedr sucsceeerd
sucsceered sucsceerde sucsceeerd sucsceeedr sucsceeder sucsceedre sucscereed sucscerede sucscereed sucscerede sucscerdee
sucscerdee sucsceered sucsceerde sucsceeerd sucsceeedr sucsceeder sucsceedre sucscedree sucscedree sucscedere sucscedeer
sucscedeer sucscedere

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us