easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

seruus

pseudosacrilegious

spectromicroscopical

wingbeat

xslave

fingentis

salvatori

thermohalophilum

shaftfoot

toothsomely

woodspite

killest

obtain

decsqurl

zaanannim

subscripture

unmussed

woolworker


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: subsidisque
cipher variations:
tvctjejtrvf uwdukfkuswg vxevlglvtxh wyfwmhmwuyi xzgxninxvzj
yahyojoywak zbizpkpzxbl acjaqlqaycm bdkbrmrbzdn celcsnscaeo
dfmdtotdbfp egneupuecgq fhofvqvfdhr gipgwrwgeis hjqhxsxhfjt
ikriytyigku jlsjzuzjhlv kmtkavakimw lnulbwbljnx movmcxcmkoy
npwndydnlpz oqxoezeomqa prypfafpnrb qszqgbgqosc rtarhchrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: subsidisque
Cipher: hfyhrwrhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: subsidisque
Cipher: BAAAB BAABB AAAAB BAAAB ABAAA AAABB ABAAA BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: subsidisque
cipher variations:
tvctjejtrvfdjedzkzdxjnnxgnpqpndxvxlixfwfxjldhzkhvcvhpzlrnmrlilrvntlpqlrurlhpjvdsvhahvndr
frufxgxftrzpfwpnmnpzfhztyzdsdzftpjhajtytjlhxuwdukfkuswgekfealaeykooyhoqrqoeywymjygxgykme
ialiwdwiqamsonsmjmswoumqrmsvsmiqkwetwibiwoesgsvgyhygusaqgxqonoqagiauzaeteaguqkibkuzukmiy
vxevlglvtxhflgfbmbfzlppziprsrpfzxznkzhyhzlnfjbmjxexjrbntpotnkntxpvnrsntwtnjrlxfuxjcjxpft
htwhzizhvtbrhyrpoprbhjbvabfufbhvrljclvavlnjzwyfwmhmwuyigmhgcncgamqqajqstsqgayaolaiziamog
kcnkyfykscouqpuolouyqwostouxuoksmygvykdkyqguiuxiajaiwucsizsqpqscikcwbcgvgciwsmkdmwbwmoka
xzgxninxvzjhnihdodhbnrrbkrtutrhbzbpmbjajbnphldolzgzltdpvrqvpmpvzrxptupvyvpltnzhwzlelzrhv
jvyjbkbjxvdtjatrqrtdjldxcdhwhdjxtnlenxcxnplbyahyojoywakiojiepeicossclsuvusicacqnckbkcoqi
mepmahamueqwsrwqnqwasyquvqwzwqmuoaixamfmasiwkwzkclckyweukbusrsuekmeydeixiekyuomfoydyoqmc
zbizpkpzxbljpkjfqfjdpttdmtvwvtjdbdrodlcldprjnfqnbibnvfrxtsxrorxbtzrvwrxaxrnvpbjybngnbtjx
lxaldmdlzxfvlcvtstvflnfzefjyjflzvpngpzezprndacjaqlqaycmkqlkgrgkequuenuwxwukecespemdmeqsk
ogrocjcowgsyutyspsycuaswxsybysowqckzcohocukymybmenemaygwmdwutuwgmogafgkzkgmawqohqafaqsoe
bdkbrmrbzdnlrmlhshlfrvvfovxyxvlfdftqfnenfrtlphspdkdpxhtzvuztqtzdvbtxytzcztpxrdladpipdvlz
nzcnfofnbzhxnexvuvxhnphbghlalhnbxrpirbgbrtpfcelcsnscaeomsnmitimgswwgpwyzywmgegurgofogsum
qitqeleqyiuawvauruaewcuyzuadauqysembeqjqewmaoadogpgocaiyofywvwyioqichimbmiocysqjschcsuqg
dfmdtotdbfpntonjujnhtxxhqxzazxnhfhvshpgphtvnrjurfmfrzjvbxwbvsvbfxdvzavbebvrztfncfrkrfxnb
pbephqhpdbjzpgzxwxzjprjdijncnjpdztrktdidtvrhegneupuecgqoupokvkoiuyyiryabayoigiwtiqhqiuwo
skvsgngsakwcyxcwtwcgyewabwcfcwsaugodgslsgyocqcfqiriqeckaqhayxyakqskejkodokqeausluejeuwsi
fhofvqvfdhrpvqplwlpjvzzjszbcbzpjhjxujrirjvxptlwthohtblxdzydxuxdhzfxbcxdgdxtbvhpehtmthzpd
rdgrjsjrfdlbribzyzblrtlfklpeplrfbvtmvfkfvxtjgipgwrwgeisqwrqmxmqkwaaktacdcaqkikyvksjskwyq
umxuipiucmyeazeyvyeiagycdyeheyucwiqfiunuiaqesehsktksgemcsjcazacmsumglmqfqmsgcwunwglgwyuk
hjqhxsxhfjtrxsrnynrlxbblubdedbrljlzwltktlxzrvnyvjqjvdnzfbafzwzfjbhzdezfifzvdxjrgjvovjbrf
tfitlulthfndtkdbabdntvnhmnrgrnthdxvoxhmhxzvlikriytyigkusytsozosmyccmvcefecsmkmaxmulumyas
wozwkrkweoagcbgaxagkciaefagjgaweykshkwpwkcsgugjumvmuigoeulecbceouwoinoshsouieywpyiniyawm
jlsjzuzjhlvtzutpaptnzddnwdfgfdtnlnbynvmvnzbtxpaxlslxfpbhdchbybhldjbfgbhkhbxfzltilxqxldth
vhkvnwnvjhpfvmfdcdfpvxpjoptitpvjfzxqzjojzbxnkmtkavakimwuavuqbquoaeeoxeghgeuomoczownwoacu
yqbymtmygqciediczcimekcghcilicygamujmyrymeuiwilwoxowkiqgwngedegqwyqkpqujuqwkgayrakpkacyo
lnulbwbljnxvbwvrcrvpbffpyfhihfvpnpdapxoxpbdvzrcznunzhrdjfejdadjnfldhidjmjdzhbnvknzsznfvj
xjmxpypxljrhxohfefhrxzrlqrvkvrxlhbzsblqlbdzpmovmcxcmkoywcxwsdswqcggqzgijigwqoqebqypyqcew
asdaovoaisekgfkebekogmeijeknkeaicowloataogwkyknyqzqymksiypigfgisyasmrswlwsymicatcmrmceaq
npwndydnlpzxdyxtetxrdhhrahjkjhxrprfcrzqzrdfxbtebpwpbjtflhglfcflphnfjkflolfbjdpxmpbubphxl
zlozrarznltjzqjhghjtzbtnstxmxtznjdbudnsndfbroqxoezeomqayezyufuyseiisbiklkiysqsgdsarasegy
cufcqxqckugmihmgdgmqiogklgmpmgckeqynqcvcqiymampasbsaomukarkihikuacuotuynyuaokecveotoegcs
prypfafpnrbzfazvgvztfjjtcjlmljztrthetbsbtfhzdvgdryrdlvhnjinhehnrjphlmhnqnhdlfrzordwdrjzn
bnqbtctbpnvlbsljijlvbdvpuvzozvbplfdwfpupfhdtqszqgbgqoscagbawhwaugkkudkmnmkausuifuctcugia
ewheszsemwiokjoifioskqimnioroiemgsapsexeskaocorcuducqowmctmkjkmwcewqvwapawcqmgexgqvqgieu
rtarhchrptdbhcbxixbvhllvelnonlbvtvjgvdudvhjbfxiftatfnxjplkpjgjptlrjnojpspjfnhtbqtfyftlbp
dpsdvevdrpxndunlklnxdfxrwxbqbxdrnhfyhrwrhjfvsubsidisquecidcyjycwimmwfmopomcwuwkhwevewikc
gyjgubugoykqmlqkhkqumskopkqtqkgoiucrugzgumcqeqtewfwesqyoevomlmoyegysxycrcyesoigzisxsikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: subsidisque
Cipher: fhofvqvfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: subsidisque
Cipher: 3454213442414234145451

Extended Methods:
Method #1

Plaintext: subsidisque
method variations:
xzgxoioxvzkcemctotcaephkrhytyhfkunpwndydnlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s u b s i d i s q u e 
3 5 2 3 4 4 4 3 1 5 5 
4 4 1 4 2 1 2 4 4 4 1 
They are then read out in rows:
3523444315544142124441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: subsidisque
Cipher: xmtovudiftd

Read more ...
Method #3

Plaintext: subsidisque
method variations:
yiltrqmdyyl iltrqmdyyly ltrqmdyylyi
trqmdyylyil rqmdyylyilt qmdyylyiltr
mdyylyiltrq dyylyiltrqm yylyiltrqmd
ylyiltrqmdy lyiltrqmdyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: subsidisque

first 5040 cipher variations(39615626 total)
subsidisque subsidisqeu subsidisuqe subsidisueq subsidiseuq subsidisequ subsidiqsue subsidiqseu subsidiquse subsidiques
subsidiqeus subsidiqesu subsidiuqse subsidiuqes subsidiusqe subsidiuseq subsidiuesq subsidiueqs subsidiequs subsidieqsu
subsidieuqs subsidieusq subsidiesuq subsidiesqu subsidsique subsidsiqeu subsidsiuqe subsidsiueq subsidsieuq subsidsiequ
subsidsqiue subsidsqieu subsidsquie subsidsquei subsidsqeui subsidsqeiu subsidsuqie subsidsuqei subsidsuiqe subsidsuieq
subsidsueiq subsidsueqi subsidsequi subsidseqiu subsidseuqi subsidseuiq subsidseiuq subsidseiqu subsidqsiue subsidqsieu
subsidqsuie subsidqsuei subsidqseui subsidqseiu subsidqisue subsidqiseu subsidqiuse subsidqiues subsidqieus subsidqiesu
subsidquise subsidquies subsidqusie subsidqusei subsidquesi subsidqueis subsidqeius subsidqeisu subsidqeuis subsidqeusi
subsidqesui subsidqesiu subsidusqie subsidusqei subsidusiqe subsidusieq subsiduseiq subsiduseqi subsiduqsie subsiduqsei
subsiduqise subsiduqies subsiduqeis subsiduqesi subsiduiqse subsiduiqes subsiduisqe subsiduiseq subsiduiesq subsiduieqs
subsidueqis subsidueqsi subsidueiqs subsidueisq subsiduesiq subsiduesqi subsidesqui subsidesqiu subsidesuqi subsidesuiq
subsidesiuq subsidesiqu subsideqsui subsideqsiu subsidequsi subsidequis subsideqius subsideqisu subsideuqsi subsideuqis
subsideusqi subsideusiq subsideuisq subsideuiqs subsideiqus subsideiqsu subsideiuqs subsideiusq subsideisuq subsideisqu
subsiidsque subsiidsqeu subsiidsuqe subsiidsueq subsiidseuq subsiidsequ subsiidqsue subsiidqseu subsiidquse subsiidques
subsiidqeus subsiidqesu subsiiduqse subsiiduqes subsiidusqe subsiiduseq subsiiduesq subsiidueqs subsiidequs subsiideqsu
subsiideuqs subsiideusq subsiidesuq subsiidesqu subsiisdque subsiisdqeu subsiisduqe subsiisdueq subsiisdeuq subsiisdequ
subsiisqdue subsiisqdeu subsiisqude subsiisqued subsiisqeud subsiisqedu subsiisuqde subsiisuqed subsiisudqe subsiisudeq
subsiisuedq subsiisueqd subsiisequd subsiiseqdu subsiiseuqd subsiiseudq subsiiseduq subsiisedqu subsiiqsdue subsiiqsdeu
subsiiqsude subsiiqsued subsiiqseud subsiiqsedu subsiiqdsue subsiiqdseu subsiiqduse subsiiqdues subsiiqdeus subsiiqdesu
subsiiqudse subsiiqudes subsiiqusde subsiiqused subsiiquesd subsiiqueds subsiiqedus subsiiqedsu subsiiqeuds subsiiqeusd
subsiiqesud subsiiqesdu subsiiusqde subsiiusqed subsiiusdqe subsiiusdeq subsiiusedq subsiiuseqd subsiiuqsde subsiiuqsed
subsiiuqdse subsiiuqdes subsiiuqeds subsiiuqesd subsiiudqse subsiiudqes subsiiudsqe subsiiudseq subsiiudesq subsiiudeqs
subsiiueqds subsiiueqsd subsiiuedqs subsiiuedsq subsiiuesdq subsiiuesqd subsiiesqud subsiiesqdu subsiiesuqd subsiiesudq
subsiiesduq subsiiesdqu subsiieqsud subsiieqsdu subsiiequsd subsiiequds subsiieqdus subsiieqdsu subsiieuqsd subsiieuqds
subsiieusqd subsiieusdq subsiieudsq subsiieudqs subsiiedqus subsiiedqsu subsiieduqs subsiiedusq subsiiedsuq subsiiedsqu
subsisidque subsisidqeu subsisiduqe subsisidueq subsisideuq subsisidequ subsisiqdue subsisiqdeu subsisiqude subsisiqued
subsisiqeud subsisiqedu subsisiuqde subsisiuqed subsisiudqe subsisiudeq subsisiuedq subsisiueqd subsisiequd subsisieqdu
subsisieuqd subsisieudq subsisieduq subsisiedqu subsisdique subsisdiqeu subsisdiuqe subsisdiueq subsisdieuq subsisdiequ
subsisdqiue subsisdqieu subsisdquie subsisdquei subsisdqeui subsisdqeiu subsisduqie subsisduqei subsisduiqe subsisduieq
subsisdueiq subsisdueqi subsisdequi subsisdeqiu subsisdeuqi subsisdeuiq subsisdeiuq subsisdeiqu subsisqdiue subsisqdieu
subsisqduie subsisqduei subsisqdeui subsisqdeiu subsisqidue subsisqideu subsisqiude subsisqiued subsisqieud subsisqiedu
subsisquide subsisquied subsisqudie subsisqudei subsisquedi subsisqueid subsisqeiud subsisqeidu subsisqeuid subsisqeudi
subsisqedui subsisqediu subsisudqie subsisudqei subsisudiqe subsisudieq subsisudeiq subsisudeqi subsisuqdie subsisuqdei
subsisuqide subsisuqied subsisuqeid subsisuqedi subsisuiqde subsisuiqed subsisuidqe subsisuideq subsisuiedq subsisuieqd
subsisueqid subsisueqdi subsisueiqd subsisueidq subsisuediq subsisuedqi subsisedqui subsisedqiu subsiseduqi subsiseduiq
subsisediuq subsisediqu subsiseqdui subsiseqdiu subsisequdi subsisequid subsiseqiud subsiseqidu subsiseuqdi subsiseuqid
subsiseudqi subsiseudiq subsiseuidq subsiseuiqd subsiseiqud subsiseiqdu subsiseiuqd subsiseiudq subsiseiduq subsiseidqu
subsiqisdue subsiqisdeu subsiqisude subsiqisued subsiqiseud subsiqisedu subsiqidsue subsiqidseu subsiqiduse subsiqidues
subsiqideus subsiqidesu subsiqiudse subsiqiudes subsiqiusde subsiqiused subsiqiuesd subsiqiueds subsiqiedus subsiqiedsu
subsiqieuds subsiqieusd subsiqiesud subsiqiesdu subsiqsidue subsiqsideu subsiqsiude subsiqsiued subsiqsieud subsiqsiedu
subsiqsdiue subsiqsdieu subsiqsduie subsiqsduei subsiqsdeui subsiqsdeiu subsiqsudie subsiqsudei subsiqsuide subsiqsuied
subsiqsueid subsiqsuedi subsiqsedui subsiqsediu subsiqseudi subsiqseuid subsiqseiud subsiqseidu subsiqdsiue subsiqdsieu
subsiqdsuie subsiqdsuei subsiqdseui subsiqdseiu subsiqdisue subsiqdiseu subsiqdiuse subsiqdiues subsiqdieus subsiqdiesu
subsiqduise subsiqduies subsiqdusie subsiqdusei subsiqduesi subsiqdueis subsiqdeius subsiqdeisu subsiqdeuis subsiqdeusi
subsiqdesui subsiqdesiu subsiqusdie subsiqusdei subsiquside subsiqusied subsiquseid subsiqusedi subsiqudsie subsiqudsei
subsiqudise subsiqudies subsiqudeis subsiqudesi subsiquidse subsiquides subsiquisde subsiquised subsiquiesd subsiquieds
subsiquedis subsiquedsi subsiqueids subsiqueisd subsiquesid subsiquesdi subsiqesdui subsiqesdiu subsiqesudi subsiqesuid
subsiqesiud subsiqesidu subsiqedsui subsiqedsiu subsiqedusi subsiqeduis subsiqedius subsiqedisu subsiqeudsi subsiqeudis
subsiqeusdi subsiqeusid subsiqeuisd subsiqeuids subsiqeidus subsiqeidsu subsiqeiuds subsiqeiusd subsiqeisud subsiqeisdu
subsiuisqde subsiuisqed subsiuisdqe subsiuisdeq subsiuisedq subsiuiseqd subsiuiqsde subsiuiqsed subsiuiqdse subsiuiqdes
subsiuiqeds subsiuiqesd subsiuidqse subsiuidqes subsiuidsqe subsiuidseq subsiuidesq subsiuideqs subsiuieqds subsiuieqsd
subsiuiedqs subsiuiedsq subsiuiesdq subsiuiesqd subsiusiqde subsiusiqed subsiusidqe subsiusideq subsiusiedq subsiusieqd
subsiusqide subsiusqied subsiusqdie subsiusqdei subsiusqedi subsiusqeid subsiusdqie subsiusdqei subsiusdiqe subsiusdieq
subsiusdeiq subsiusdeqi subsiuseqdi subsiuseqid subsiusedqi subsiusediq subsiuseidq subsiuseiqd subsiuqside subsiuqsied
subsiuqsdie subsiuqsdei subsiuqsedi subsiuqseid subsiuqisde subsiuqised subsiuqidse subsiuqides subsiuqieds subsiuqiesd
subsiuqdise subsiuqdies subsiuqdsie subsiuqdsei subsiuqdesi subsiuqdeis subsiuqeids subsiuqeisd subsiuqedis subsiuqedsi
subsiuqesdi subsiuqesid subsiudsqie subsiudsqei subsiudsiqe subsiudsieq subsiudseiq subsiudseqi subsiudqsie subsiudqsei
subsiudqise subsiudqies subsiudqeis subsiudqesi subsiudiqse subsiudiqes subsiudisqe subsiudiseq subsiudiesq subsiudieqs
subsiudeqis subsiudeqsi subsiudeiqs subsiudeisq subsiudesiq subsiudesqi subsiuesqdi subsiuesqid subsiuesdqi subsiuesdiq
subsiuesidq subsiuesiqd subsiueqsdi subsiueqsid subsiueqdsi subsiueqdis subsiueqids subsiueqisd subsiuedqsi subsiuedqis
subsiuedsqi subsiuedsiq subsiuedisq subsiuediqs subsiueiqds subsiueiqsd subsiueidqs subsiueidsq subsiueisdq subsiueisqd
subsieisqud subsieisqdu subsieisuqd subsieisudq subsieisduq subsieisdqu subsieiqsud subsieiqsdu subsieiqusd subsieiquds
subsieiqdus subsieiqdsu subsieiuqsd subsieiuqds subsieiusqd subsieiusdq subsieiudsq subsieiudqs subsieidqus subsieidqsu
subsieiduqs subsieidusq subsieidsuq subsieidsqu subsiesiqud subsiesiqdu subsiesiuqd subsiesiudq subsiesiduq subsiesidqu
subsiesqiud subsiesqidu subsiesquid subsiesqudi subsiesqdui subsiesqdiu subsiesuqid subsiesuqdi subsiesuiqd subsiesuidq
subsiesudiq subsiesudqi subsiesdqui subsiesdqiu subsiesduqi subsiesduiq subsiesdiuq subsiesdiqu subsieqsiud subsieqsidu
subsieqsuid subsieqsudi subsieqsdui subsieqsdiu subsieqisud subsieqisdu subsieqiusd subsieqiuds subsieqidus subsieqidsu
subsiequisd subsiequids subsiequsid subsiequsdi subsiequdsi subsiequdis subsieqdius subsieqdisu subsieqduis subsieqdusi
subsieqdsui subsieqdsiu subsieusqid subsieusqdi subsieusiqd subsieusidq subsieusdiq subsieusdqi subsieuqsid subsieuqsdi
subsieuqisd subsieuqids subsieuqdis subsieuqdsi subsieuiqsd subsieuiqds subsieuisqd subsieuisdq subsieuidsq subsieuidqs
subsieudqis subsieudqsi subsieudiqs subsieudisq subsieudsiq subsieudsqi subsiedsqui subsiedsqiu subsiedsuqi subsiedsuiq
subsiedsiuq subsiedsiqu subsiedqsui subsiedqsiu subsiedqusi subsiedquis subsiedqius subsiedqisu subsieduqsi subsieduqis
subsiedusqi subsiedusiq subsieduisq subsieduiqs subsiediqus subsiediqsu subsiediuqs subsiediusq subsiedisuq subsiedisqu
subsdiisque subsdiisqeu subsdiisuqe subsdiisueq subsdiiseuq subsdiisequ subsdiiqsue subsdiiqseu subsdiiquse subsdiiques
subsdiiqeus subsdiiqesu subsdiiuqse subsdiiuqes subsdiiusqe subsdiiuseq subsdiiuesq subsdiiueqs subsdiiequs subsdiieqsu
subsdiieuqs subsdiieusq subsdiiesuq subsdiiesqu subsdisique subsdisiqeu subsdisiuqe subsdisiueq subsdisieuq subsdisiequ
subsdisqiue subsdisqieu subsdisquie subsdisquei subsdisqeui subsdisqeiu subsdisuqie subsdisuqei subsdisuiqe subsdisuieq
subsdisueiq subsdisueqi subsdisequi subsdiseqiu subsdiseuqi subsdiseuiq subsdiseiuq subsdiseiqu subsdiqsiue subsdiqsieu
subsdiqsuie subsdiqsuei subsdiqseui subsdiqseiu subsdiqisue subsdiqiseu subsdiqiuse subsdiqiues subsdiqieus subsdiqiesu
subsdiquise subsdiquies subsdiqusie subsdiqusei subsdiquesi subsdiqueis subsdiqeius subsdiqeisu subsdiqeuis subsdiqeusi
subsdiqesui subsdiqesiu subsdiusqie subsdiusqei subsdiusiqe subsdiusieq subsdiuseiq subsdiuseqi subsdiuqsie subsdiuqsei
subsdiuqise subsdiuqies subsdiuqeis subsdiuqesi subsdiuiqse subsdiuiqes subsdiuisqe subsdiuiseq subsdiuiesq subsdiuieqs
subsdiueqis subsdiueqsi subsdiueiqs subsdiueisq subsdiuesiq subsdiuesqi subsdiesqui subsdiesqiu subsdiesuqi subsdiesuiq
subsdiesiuq subsdiesiqu subsdieqsui subsdieqsiu subsdiequsi subsdiequis subsdieqius subsdieqisu subsdieuqsi subsdieuqis
subsdieusqi subsdieusiq subsdieuisq subsdieuiqs subsdieiqus subsdieiqsu subsdieiuqs subsdieiusq subsdieisuq subsdieisqu
subsdiisque subsdiisqeu subsdiisuqe subsdiisueq subsdiiseuq subsdiisequ subsdiiqsue subsdiiqseu subsdiiquse subsdiiques
subsdiiqeus subsdiiqesu subsdiiuqse subsdiiuqes subsdiiusqe subsdiiuseq subsdiiuesq subsdiiueqs subsdiiequs subsdiieqsu
subsdiieuqs subsdiieusq subsdiiesuq subsdiiesqu subsdisique subsdisiqeu subsdisiuqe subsdisiueq subsdisieuq subsdisiequ
subsdisqiue subsdisqieu subsdisquie subsdisquei subsdisqeui subsdisqeiu subsdisuqie subsdisuqei subsdisuiqe subsdisuieq
subsdisueiq subsdisueqi subsdisequi subsdiseqiu subsdiseuqi subsdiseuiq subsdiseiuq subsdiseiqu subsdiqsiue subsdiqsieu
subsdiqsuie subsdiqsuei subsdiqseui subsdiqseiu subsdiqisue subsdiqiseu subsdiqiuse subsdiqiues subsdiqieus subsdiqiesu
subsdiquise subsdiquies subsdiqusie subsdiqusei subsdiquesi subsdiqueis subsdiqeius subsdiqeisu subsdiqeuis subsdiqeusi
subsdiqesui subsdiqesiu subsdiusqie subsdiusqei subsdiusiqe subsdiusieq subsdiuseiq subsdiuseqi subsdiuqsie subsdiuqsei
subsdiuqise subsdiuqies subsdiuqeis subsdiuqesi subsdiuiqse subsdiuiqes subsdiuisqe subsdiuiseq subsdiuiesq subsdiuieqs
subsdiueqis subsdiueqsi subsdiueiqs subsdiueisq subsdiuesiq subsdiuesqi subsdiesqui subsdiesqiu subsdiesuqi subsdiesuiq
subsdiesiuq subsdiesiqu subsdieqsui subsdieqsiu subsdiequsi subsdiequis subsdieqius subsdieqisu subsdieuqsi subsdieuqis
subsdieusqi subsdieusiq subsdieuisq subsdieuiqs subsdieiqus subsdieiqsu subsdieiuqs subsdieiusq subsdieisuq subsdieisqu
subsdsiique subsdsiiqeu subsdsiiuqe subsdsiiueq subsdsiieuq subsdsiiequ subsdsiqiue subsdsiqieu subsdsiquie subsdsiquei
subsdsiqeui subsdsiqeiu subsdsiuqie subsdsiuqei subsdsiuiqe subsdsiuieq subsdsiueiq subsdsiueqi subsdsiequi subsdsieqiu
subsdsieuqi subsdsieuiq subsdsieiuq subsdsieiqu subsdsiique subsdsiiqeu subsdsiiuqe subsdsiiueq subsdsiieuq subsdsiiequ
subsdsiqiue subsdsiqieu subsdsiquie subsdsiquei subsdsiqeui subsdsiqeiu subsdsiuqie subsdsiuqei subsdsiuiqe subsdsiuieq
subsdsiueiq subsdsiueqi subsdsiequi subsdsieqiu subsdsieuqi subsdsieuiq subsdsieiuq subsdsieiqu subsdsqiiue subsdsqiieu
subsdsqiuie subsdsqiuei subsdsqieui subsdsqieiu subsdsqiiue subsdsqiieu subsdsqiuie subsdsqiuei subsdsqieui subsdsqieiu
subsdsquiie subsdsquiei subsdsquiie subsdsquiei subsdsqueii subsdsqueii subsdsqeiui subsdsqeiiu subsdsqeuii subsdsqeuii
subsdsqeiui subsdsqeiiu subsdsuiqie subsdsuiqei subsdsuiiqe subsdsuiieq subsdsuieiq subsdsuieqi subsdsuqiie subsdsuqiei
subsdsuqiie subsdsuqiei subsdsuqeii subsdsuqeii subsdsuiqie subsdsuiqei subsdsuiiqe subsdsuiieq subsdsuieiq subsdsuieqi
subsdsueqii subsdsueqii subsdsueiqi subsdsueiiq subsdsueiiq subsdsueiqi subsdseiqui subsdseiqiu subsdseiuqi subsdseiuiq
subsdseiiuq subsdseiiqu subsdseqiui subsdseqiiu subsdsequii subsdsequii subsdseqiui subsdseqiiu subsdseuqii subsdseuqii
subsdseuiqi subsdseuiiq subsdseuiiq subsdseuiqi subsdseiqui subsdseiqiu subsdseiuqi subsdseiuiq subsdseiiuq subsdseiiqu
subsdqisiue subsdqisieu subsdqisuie subsdqisuei subsdqiseui subsdqiseiu subsdqiisue subsdqiiseu subsdqiiuse subsdqiiues
subsdqiieus subsdqiiesu subsdqiuise subsdqiuies subsdqiusie subsdqiusei subsdqiuesi subsdqiueis subsdqieius subsdqieisu
subsdqieuis subsdqieusi subsdqiesui subsdqiesiu subsdqsiiue subsdqsiieu subsdqsiuie subsdqsiuei subsdqsieui subsdqsieiu
subsdqsiiue subsdqsiieu subsdqsiuie subsdqsiuei subsdqsieui subsdqsieiu subsdqsuiie subsdqsuiei subsdqsuiie subsdqsuiei
subsdqsueii subsdqsueii subsdqseiui subsdqseiiu subsdqseuii subsdqseuii subsdqseiui subsdqseiiu subsdqisiue subsdqisieu
subsdqisuie subsdqisuei subsdqiseui subsdqiseiu subsdqiisue subsdqiiseu subsdqiiuse subsdqiiues subsdqiieus subsdqiiesu
subsdqiuise subsdqiuies subsdqiusie subsdqiusei subsdqiuesi subsdqiueis subsdqieius subsdqieisu subsdqieuis subsdqieusi
subsdqiesui subsdqiesiu subsdqusiie subsdqusiei subsdqusiie subsdqusiei subsdquseii subsdquseii subsdquisie subsdquisei
subsdquiise subsdquiies subsdquieis subsdquiesi subsdquiise subsdquiies subsdquisie subsdquisei subsdquiesi subsdquieis
subsdqueiis subsdqueisi subsdqueiis subsdqueisi subsdquesii subsdquesii subsdqesiui subsdqesiiu subsdqesuii subsdqesuii
subsdqesiui subsdqesiiu subsdqeisui subsdqeisiu subsdqeiusi subsdqeiuis subsdqeiius subsdqeiisu subsdqeuisi subsdqeuiis
subsdqeusii subsdqeusii subsdqeuisi subsdqeuiis subsdqeiius subsdqeiisu subsdqeiuis subsdqeiusi subsdqeisui subsdqeisiu
subsduisqie subsduisqei subsduisiqe subsduisieq subsduiseiq subsduiseqi subsduiqsie subsduiqsei subsduiqise subsduiqies
subsduiqeis subsduiqesi subsduiiqse subsduiiqes subsduiisqe subsduiiseq subsduiiesq subsduiieqs subsduieqis subsduieqsi
subsduieiqs subsduieisq subsduiesiq subsduiesqi subsdusiqie subsdusiqei subsdusiiqe subsdusiieq subsdusieiq subsdusieqi
subsdusqiie subsdusqiei subsdusqiie subsdusqiei subsdusqeii subsdusqeii subsdusiqie subsdusiqei subsdusiiqe subsdusiieq
subsdusieiq subsdusieqi subsduseqii subsduseqii subsduseiqi subsduseiiq subsduseiiq subsduseiqi subsduqsiie subsduqsiei
subsduqsiie subsduqsiei subsduqseii subsduqseii subsduqisie subsduqisei subsduqiise subsduqiies subsduqieis subsduqiesi
subsduqiise subsduqiies subsduqisie subsduqisei subsduqiesi subsduqieis subsduqeiis subsduqeisi subsduqeiis subsduqeisi
subsduqesii subsduqesii subsduisqie subsduisqei subsduisiqe subsduisieq subsduiseiq subsduiseqi subsduiqsie subsduiqsei
subsduiqise subsduiqies subsduiqeis subsduiqesi subsduiiqse subsduiiqes subsduiisqe subsduiiseq subsduiiesq subsduiieqs
subsduieqis subsduieqsi subsduieiqs subsduieisq subsduiesiq subsduiesqi subsduesqii subsduesqii subsduesiqi subsduesiiq
subsduesiiq subsduesiqi subsdueqsii subsdueqsii subsdueqisi subsdueqiis subsdueqiis subsdueqisi subsdueiqsi subsdueiqis
subsdueisqi subsdueisiq subsdueiisq subsdueiiqs subsdueiqis subsdueiqsi subsdueiiqs subsdueiisq subsdueisiq subsdueisqi
subsdeisqui subsdeisqiu subsdeisuqi subsdeisuiq subsdeisiuq subsdeisiqu subsdeiqsui subsdeiqsiu subsdeiqusi subsdeiquis
subsdeiqius subsdeiqisu subsdeiuqsi subsdeiuqis subsdeiusqi subsdeiusiq subsdeiuisq subsdeiuiqs subsdeiiqus subsdeiiqsu
subsdeiiuqs subsdeiiusq subsdeiisuq subsdeiisqu subsdesiqui subsdesiqiu subsdesiuqi subsdesiuiq subsdesiiuq subsdesiiqu
subsdesqiui subsdesqiiu subsdesquii subsdesquii subsdesqiui subsdesqiiu subsdesuqii subsdesuqii subsdesuiqi subsdesuiiq
subsdesuiiq subsdesuiqi subsdesiqui subsdesiqiu subsdesiuqi subsdesiuiq subsdesiiuq subsdesiiqu subsdeqsiui subsdeqsiiu
subsdeqsuii subsdeqsuii subsdeqsiui subsdeqsiiu subsdeqisui subsdeqisiu subsdeqiusi subsdeqiuis subsdeqiius subsdeqiisu
subsdequisi subsdequiis subsdequsii subsdequsii subsdequisi subsdequiis subsdeqiius subsdeqiisu subsdeqiuis subsdeqiusi
subsdeqisui subsdeqisiu subsdeusqii subsdeusqii subsdeusiqi subsdeusiiq subsdeusiiq subsdeusiqi subsdeuqsii subsdeuqsii
subsdeuqisi subsdeuqiis subsdeuqiis subsdeuqisi subsdeuiqsi subsdeuiqis subsdeuisqi subsdeuisiq subsdeuiisq subsdeuiiqs
subsdeuiqis subsdeuiqsi subsdeuiiqs subsdeuiisq subsdeuisiq subsdeuisqi subsdeisqui subsdeisqiu subsdeisuqi subsdeisuiq
subsdeisiuq subsdeisiqu subsdeiqsui subsdeiqsiu subsdeiqusi subsdeiquis subsdeiqius subsdeiqisu subsdeiuqsi subsdeiuqis
subsdeiusqi subsdeiusiq subsdeiuisq subsdeiuiqs subsdeiiqus subsdeiiqsu subsdeiiuqs subsdeiiusq subsdeiisuq subsdeiisqu
subsidisque subsidisqeu subsidisuqe subsidisueq subsidiseuq subsidisequ subsidiqsue subsidiqseu subsidiquse subsidiques
subsidiqeus subsidiqesu subsidiuqse subsidiuqes subsidiusqe subsidiuseq subsidiuesq subsidiueqs subsidiequs subsidieqsu
subsidieuqs subsidieusq subsidiesuq subsidiesqu subsidsique subsidsiqeu subsidsiuqe subsidsiueq subsidsieuq subsidsiequ
subsidsqiue subsidsqieu subsidsquie subsidsquei subsidsqeui subsidsqeiu subsidsuqie subsidsuqei subsidsuiqe subsidsuieq
subsidsueiq subsidsueqi subsidsequi subsidseqiu subsidseuqi subsidseuiq subsidseiuq subsidseiqu subsidqsiue subsidqsieu
subsidqsuie subsidqsuei subsidqseui subsidqseiu subsidqisue subsidqiseu subsidqiuse subsidqiues subsidqieus subsidqiesu
subsidquise subsidquies subsidqusie subsidqusei subsidquesi subsidqueis subsidqeius subsidqeisu subsidqeuis subsidqeusi
subsidqesui subsidqesiu subsidusqie subsidusqei subsidusiqe subsidusieq subsiduseiq subsiduseqi subsiduqsie subsiduqsei
subsiduqise subsiduqies subsiduqeis subsiduqesi subsiduiqse subsiduiqes subsiduisqe subsiduiseq subsiduiesq subsiduieqs
subsidueqis subsidueqsi subsidueiqs subsidueisq subsiduesiq subsiduesqi subsidesqui subsidesqiu subsidesuqi subsidesuiq
subsidesiuq subsidesiqu subsideqsui subsideqsiu subsidequsi subsidequis subsideqius subsideqisu subsideuqsi subsideuqis
subsideusqi subsideusiq subsideuisq subsideuiqs subsideiqus subsideiqsu subsideiuqs subsideiusq subsideisuq subsideisqu
subsiidsque subsiidsqeu subsiidsuqe subsiidsueq subsiidseuq subsiidsequ subsiidqsue subsiidqseu subsiidquse subsiidques
subsiidqeus subsiidqesu subsiiduqse subsiiduqes subsiidusqe subsiiduseq subsiiduesq subsiidueqs subsiidequs subsiideqsu
subsiideuqs subsiideusq subsiidesuq subsiidesqu subsiisdque subsiisdqeu subsiisduqe subsiisdueq subsiisdeuq subsiisdequ
subsiisqdue subsiisqdeu subsiisqude subsiisqued subsiisqeud subsiisqedu subsiisuqde subsiisuqed subsiisudqe subsiisudeq
subsiisuedq subsiisueqd subsiisequd subsiiseqdu subsiiseuqd subsiiseudq subsiiseduq subsiisedqu subsiiqsdue subsiiqsdeu
subsiiqsude subsiiqsued subsiiqseud subsiiqsedu subsiiqdsue subsiiqdseu subsiiqduse subsiiqdues subsiiqdeus subsiiqdesu
subsiiqudse subsiiqudes subsiiqusde subsiiqused subsiiquesd subsiiqueds subsiiqedus subsiiqedsu subsiiqeuds subsiiqeusd
subsiiqesud subsiiqesdu subsiiusqde subsiiusqed subsiiusdqe subsiiusdeq subsiiusedq subsiiuseqd subsiiuqsde subsiiuqsed
subsiiuqdse subsiiuqdes subsiiuqeds subsiiuqesd subsiiudqse subsiiudqes subsiiudsqe subsiiudseq subsiiudesq subsiiudeqs
subsiiueqds subsiiueqsd subsiiuedqs subsiiuedsq subsiiuesdq subsiiuesqd subsiiesqud subsiiesqdu subsiiesuqd subsiiesudq
subsiiesduq subsiiesdqu subsiieqsud subsiieqsdu subsiiequsd subsiiequds subsiieqdus subsiieqdsu subsiieuqsd subsiieuqds
subsiieusqd subsiieusdq subsiieudsq subsiieudqs subsiiedqus subsiiedqsu subsiieduqs subsiiedusq subsiiedsuq subsiiedsqu
subsisidque subsisidqeu subsisiduqe subsisidueq subsisideuq subsisidequ subsisiqdue subsisiqdeu subsisiqude subsisiqued
subsisiqeud subsisiqedu subsisiuqde subsisiuqed subsisiudqe subsisiudeq subsisiuedq subsisiueqd subsisiequd subsisieqdu
subsisieuqd subsisieudq subsisieduq subsisiedqu subsisdique subsisdiqeu subsisdiuqe subsisdiueq subsisdieuq subsisdiequ
subsisdqiue subsisdqieu subsisdquie subsisdquei subsisdqeui subsisdqeiu subsisduqie subsisduqei subsisduiqe subsisduieq
subsisdueiq subsisdueqi subsisdequi subsisdeqiu subsisdeuqi subsisdeuiq subsisdeiuq subsisdeiqu subsisqdiue subsisqdieu
subsisqduie subsisqduei subsisqdeui subsisqdeiu subsisqidue subsisqideu subsisqiude subsisqiued subsisqieud subsisqiedu
subsisquide subsisquied subsisqudie subsisqudei subsisquedi subsisqueid subsisqeiud subsisqeidu subsisqeuid subsisqeudi
subsisqedui subsisqediu subsisudqie subsisudqei subsisudiqe subsisudieq subsisudeiq subsisudeqi subsisuqdie subsisuqdei
subsisuqide subsisuqied subsisuqeid subsisuqedi subsisuiqde subsisuiqed subsisuidqe subsisuideq subsisuiedq subsisuieqd
subsisueqid subsisueqdi subsisueiqd subsisueidq subsisuediq subsisuedqi subsisedqui subsisedqiu subsiseduqi subsiseduiq
subsisediuq subsisediqu subsiseqdui subsiseqdiu subsisequdi subsisequid subsiseqiud subsiseqidu subsiseuqdi subsiseuqid
subsiseudqi subsiseudiq subsiseuidq subsiseuiqd subsiseiqud subsiseiqdu subsiseiuqd subsiseiudq subsiseiduq subsiseidqu
subsiqisdue subsiqisdeu subsiqisude subsiqisued subsiqiseud subsiqisedu subsiqidsue subsiqidseu subsiqiduse subsiqidues
subsiqideus subsiqidesu subsiqiudse subsiqiudes subsiqiusde subsiqiused subsiqiuesd subsiqiueds subsiqiedus subsiqiedsu
subsiqieuds subsiqieusd subsiqiesud subsiqiesdu subsiqsidue subsiqsideu subsiqsiude subsiqsiued subsiqsieud subsiqsiedu
subsiqsdiue subsiqsdieu subsiqsduie subsiqsduei subsiqsdeui subsiqsdeiu subsiqsudie subsiqsudei subsiqsuide subsiqsuied
subsiqsueid subsiqsuedi subsiqsedui subsiqsediu subsiqseudi subsiqseuid subsiqseiud subsiqseidu subsiqdsiue subsiqdsieu
subsiqdsuie subsiqdsuei subsiqdseui subsiqdseiu subsiqdisue subsiqdiseu subsiqdiuse subsiqdiues subsiqdieus subsiqdiesu
subsiqduise subsiqduies subsiqdusie subsiqdusei subsiqduesi subsiqdueis subsiqdeius subsiqdeisu subsiqdeuis subsiqdeusi
subsiqdesui subsiqdesiu subsiqusdie subsiqusdei subsiquside subsiqusied subsiquseid subsiqusedi subsiqudsie subsiqudsei
subsiqudise subsiqudies subsiqudeis subsiqudesi subsiquidse subsiquides subsiquisde subsiquised subsiquiesd subsiquieds
subsiquedis subsiquedsi subsiqueids subsiqueisd subsiquesid subsiquesdi subsiqesdui subsiqesdiu subsiqesudi subsiqesuid
subsiqesiud subsiqesidu subsiqedsui subsiqedsiu subsiqedusi subsiqeduis subsiqedius subsiqedisu subsiqeudsi subsiqeudis
subsiqeusdi subsiqeusid subsiqeuisd subsiqeuids subsiqeidus subsiqeidsu subsiqeiuds subsiqeiusd subsiqeisud subsiqeisdu
subsiuisqde subsiuisqed subsiuisdqe subsiuisdeq subsiuisedq subsiuiseqd subsiuiqsde subsiuiqsed subsiuiqdse subsiuiqdes
subsiuiqeds subsiuiqesd subsiuidqse subsiuidqes subsiuidsqe subsiuidseq subsiuidesq subsiuideqs subsiuieqds subsiuieqsd
subsiuiedqs subsiuiedsq subsiuiesdq subsiuiesqd subsiusiqde subsiusiqed subsiusidqe subsiusideq subsiusiedq subsiusieqd
subsiusqide subsiusqied subsiusqdie subsiusqdei subsiusqedi subsiusqeid subsiusdqie subsiusdqei subsiusdiqe subsiusdieq
subsiusdeiq subsiusdeqi subsiuseqdi subsiuseqid subsiusedqi subsiusediq subsiuseidq subsiuseiqd subsiuqside subsiuqsied
subsiuqsdie subsiuqsdei subsiuqsedi subsiuqseid subsiuqisde subsiuqised subsiuqidse subsiuqides subsiuqieds subsiuqiesd
subsiuqdise subsiuqdies subsiuqdsie subsiuqdsei subsiuqdesi subsiuqdeis subsiuqeids subsiuqeisd subsiuqedis subsiuqedsi
subsiuqesdi subsiuqesid subsiudsqie subsiudsqei subsiudsiqe subsiudsieq subsiudseiq subsiudseqi subsiudqsie subsiudqsei
subsiudqise subsiudqies subsiudqeis subsiudqesi subsiudiqse subsiudiqes subsiudisqe subsiudiseq subsiudiesq subsiudieqs
subsiudeqis subsiudeqsi subsiudeiqs subsiudeisq subsiudesiq subsiudesqi subsiuesqdi subsiuesqid subsiuesdqi subsiuesdiq
subsiuesidq subsiuesiqd subsiueqsdi subsiueqsid subsiueqdsi subsiueqdis subsiueqids subsiueqisd subsiuedqsi subsiuedqis
subsiuedsqi subsiuedsiq subsiuedisq subsiuediqs subsiueiqds subsiueiqsd subsiueidqs subsiueidsq subsiueisdq subsiueisqd
subsieisqud subsieisqdu subsieisuqd subsieisudq subsieisduq subsieisdqu subsieiqsud subsieiqsdu subsieiqusd subsieiquds
subsieiqdus subsieiqdsu subsieiuqsd subsieiuqds subsieiusqd subsieiusdq subsieiudsq subsieiudqs subsieidqus subsieidqsu
subsieiduqs subsieidusq subsieidsuq subsieidsqu subsiesiqud subsiesiqdu subsiesiuqd subsiesiudq subsiesiduq subsiesidqu
subsiesqiud subsiesqidu subsiesquid subsiesqudi subsiesqdui subsiesqdiu subsiesuqid subsiesuqdi subsiesuiqd subsiesuidq
subsiesudiq subsiesudqi subsiesdqui subsiesdqiu subsiesduqi subsiesduiq subsiesdiuq subsiesdiqu subsieqsiud subsieqsidu
subsieqsuid subsieqsudi subsieqsdui subsieqsdiu subsieqisud subsieqisdu subsieqiusd subsieqiuds subsieqidus subsieqidsu
subsiequisd subsiequids subsiequsid subsiequsdi subsiequdsi subsiequdis subsieqdius subsieqdisu subsieqduis subsieqdusi
subsieqdsui subsieqdsiu subsieusqid subsieusqdi subsieusiqd subsieusidq subsieusdiq subsieusdqi subsieuqsid subsieuqsdi
subsieuqisd subsieuqids subsieuqdis subsieuqdsi subsieuiqsd subsieuiqds subsieuisqd subsieuisdq subsieuidsq subsieuidqs
subsieudqis subsieudqsi subsieudiqs subsieudisq subsieudsiq subsieudsqi subsiedsqui subsiedsqiu subsiedsuqi subsiedsuiq
subsiedsiuq subsiedsiqu subsiedqsui subsiedqsiu subsiedqusi subsiedquis subsiedqius subsiedqisu subsieduqsi subsieduqis
subsiedusqi subsiedusiq subsieduisq subsieduiqs subsiediqus subsiediqsu subsiediuqs subsiediusq subsiedisuq subsiedisqu
subssdiique subssdiiqeu subssdiiuqe subssdiiueq subssdiieuq subssdiiequ subssdiqiue subssdiqieu subssdiquie subssdiquei
subssdiqeui subssdiqeiu subssdiuqie subssdiuqei subssdiuiqe subssdiuieq subssdiueiq subssdiueqi subssdiequi subssdieqiu
subssdieuqi subssdieuiq subssdieiuq subssdieiqu subssdiique subssdiiqeu subssdiiuqe subssdiiueq subssdiieuq subssdiiequ
subssdiqiue subssdiqieu subssdiquie subssdiquei subssdiqeui subssdiqeiu subssdiuqie subssdiuqei subssdiuiqe subssdiuieq
subssdiueiq subssdiueqi subssdiequi subssdieqiu subssdieuqi subssdieuiq subssdieiuq subssdieiqu subssdqiiue subssdqiieu
subssdqiuie subssdqiuei subssdqieui subssdqieiu subssdqiiue subssdqiieu subssdqiuie subssdqiuei subssdqieui subssdqieiu
subssdquiie subssdquiei subssdquiie subssdquiei subssdqueii subssdqueii subssdqeiui subssdqeiiu subssdqeuii subssdqeuii
subssdqeiui subssdqeiiu subssduiqie subssduiqei subssduiiqe subssduiieq subssduieiq subssduieqi subssduqiie subssduqiei
subssduqiie subssduqiei subssduqeii subssduqeii subssduiqie subssduiqei subssduiiqe subssduiieq subssduieiq subssduieqi
subssdueqii subssdueqii subssdueiqi subssdueiiq subssdueiiq subssdueiqi subssdeiqui subssdeiqiu subssdeiuqi subssdeiuiq
subssdeiiuq subssdeiiqu subssdeqiui subssdeqiiu subssdequii subssdequii subssdeqiui subssdeqiiu subssdeuqii subssdeuqii
subssdeuiqi subssdeuiiq subssdeuiiq subssdeuiqi subssdeiqui subssdeiqiu subssdeiuqi subssdeiuiq subssdeiiuq subssdeiiqu
subssidique subssidiqeu subssidiuqe subssidiueq subssidieuq subssidiequ subssidqiue subssidqieu subssidquie subssidquei
subssidqeui subssidqeiu subssiduqie subssiduqei subssiduiqe subssiduieq subssidueiq subssidueqi subssidequi subssideqiu
subssideuqi subssideuiq subssideiuq subssideiqu subssiidque subssiidqeu subssiiduqe subssiidueq subssiideuq subssiidequ
subssiiqdue subssiiqdeu subssiiqude subssiiqued subssiiqeud subssiiqedu subssiiuqde subssiiuqed subssiiudqe subssiiudeq
subssiiuedq subssiiueqd subssiiequd subssiieqdu subssiieuqd subssiieudq subssiieduq subssiiedqu subssiqidue subssiqideu
subssiqiude subssiqiued subssiqieud subssiqiedu subssiqdiue subssiqdieu subssiqduie subssiqduei subssiqdeui subssiqdeiu
subssiqudie subssiqudei subssiquide subssiquied subssiqueid subssiquedi subssiqedui subssiqediu subssiqeudi subssiqeuid
subssiqeiud subssiqeidu subssiuiqde subssiuiqed subssiuidqe subssiuideq subssiuiedq subssiuieqd subssiuqide subssiuqied
subssiuqdie subssiuqdei subssiuqedi subssiuqeid subssiudqie subssiudqei subssiudiqe subssiudieq subssiudeiq subssiudeqi
subssiueqdi subssiueqid subssiuedqi subssiuediq subssiueidq subssiueiqd subssieiqud subssieiqdu subssieiuqd subssieiudq
subssieiduq subssieidqu subssieqiud subssieqidu subssiequid subssiequdi subssieqdui subssieqdiu subssieuqid subssieuqdi
subssieuiqd subssieuidq subssieudiq subssieudqi subssiedqui subssiedqiu subssieduqi subssieduiq subssiediuq subssiediqu
subssiidque subssiidqeu subssiiduqe subssiidueq subssiideuq subssiidequ subssiiqdue subssiiqdeu subssiiqude subssiiqued
subssiiqeud subssiiqedu subssiiuqde subssiiuqed subssiiudqe subssiiudeq subssiiuedq subssiiueqd subssiiequd subssiieqdu
subssiieuqd subssiieudq subssiieduq subssiiedqu subssidique subssidiqeu subssidiuqe subssidiueq subssidieuq subssidiequ
subssidqiue subssidqieu subssidquie subssidquei subssidqeui subssidqeiu subssiduqie subssiduqei subssiduiqe subssiduieq
subssidueiq subssidueqi subssidequi subssideqiu subssideuqi subssideuiq subssideiuq subssideiqu subssiqdiue subssiqdieu
subssiqduie subssiqduei subssiqdeui subssiqdeiu subssiqidue subssiqideu subssiqiude subssiqiued subssiqieud subssiqiedu
subssiquide subssiquied subssiqudie subssiqudei subssiquedi subssiqueid subssiqeiud subssiqeidu subssiqeuid subssiqeudi
subssiqedui subssiqediu subssiudqie subssiudqei subssiudiqe subssiudieq subssiudeiq subssiudeqi subssiuqdie subssiuqdei
subssiuqide subssiuqied subssiuqeid subssiuqedi subssiuiqde subssiuiqed subssiuidqe subssiuideq subssiuiedq subssiuieqd
subssiueqid subssiueqdi subssiueiqd subssiueidq subssiuediq subssiuedqi subssiedqui subssiedqiu subssieduqi subssieduiq
subssiediuq subssiediqu subssieqdui subssieqdiu subssiequdi subssiequid subssieqiud subssieqidu subssieuqdi subssieuqid
subssieudqi subssieudiq subssieuidq subssieuiqd subssieiqud subssieiqdu subssieiuqd subssieiudq subssieiduq subssieidqu
subssqiidue subssqiideu subssqiiude subssqiiued subssqiieud subssqiiedu subssqidiue subssqidieu subssqiduie subssqiduei
subssqideui subssqideiu subssqiudie subssqiudei subssqiuide subssqiuied subssqiueid subssqiuedi subssqiedui subssqiediu
subssqieudi subssqieuid subssqieiud subssqieidu subssqiidue subssqiideu subssqiiude subssqiiued subssqiieud subssqiiedu
subssqidiue subssqidieu subssqiduie subssqiduei subssqideui subssqideiu subssqiudie subssqiudei subssqiuide subssqiuied
subssqiueid subssqiuedi subssqiedui subssqiediu subssqieudi subssqieuid subssqieiud subssqieidu subssqdiiue subssqdiieu
subssqdiuie subssqdiuei subssqdieui subssqdieiu subssqdiiue subssqdiieu subssqdiuie subssqdiuei subssqdieui subssqdieiu
subssqduiie subssqduiei subssqduiie subssqduiei subssqdueii subssqdueii subssqdeiui subssqdeiiu subssqdeuii subssqdeuii
subssqdeiui subssqdeiiu subssquidie subssquidei subssquiide subssquiied subssquieid subssquiedi subssqudiie subssqudiei
subssqudiie subssqudiei subssqudeii subssqudeii subssquidie subssquidei subssquiide subssquiied subssquieid subssquiedi
subssquedii subssquedii subssqueidi subssqueiid subssqueiid subssqueidi subssqeidui subssqeidiu subssqeiudi subssqeiuid
subssqeiiud subssqeiidu subssqediui subssqediiu subssqeduii subssqeduii subssqediui subssqediiu subssqeudii subssqeudii
subssqeuidi subssqeuiid subssqeuiid subssqeuidi subssqeidui subssqeidiu subssqeiudi subssqeiuid subssqeiiud subssqeiidu
subssuiiqde subssuiiqed subssuiidqe subssuiideq subssuiiedq subssuiieqd subssuiqide subssuiqied subssuiqdie subssuiqdei
subssuiqedi subssuiqeid subssuidqie subssuidqei subssuidiqe subssuidieq subssuideiq subssuideqi subssuieqdi subssuieqid
subssuiedqi subssuiediq subssuieidq subssuieiqd subssuiiqde subssuiiqed subssuiidqe subssuiideq subssuiiedq subssuiieqd
subssuiqide subssuiqied subssuiqdie subssuiqdei subssuiqedi subssuiqeid subssuidqie subssuidqei subssuidiqe subssuidieq
subssuideiq subssuideqi subssuieqdi subssuieqid subssuiedqi subssuiediq subssuieidq subssuieiqd subssuqiide subssuqiied
subssuqidie subssuqidei subssuqiedi subssuqieid subssuqiide subssuqiied subssuqidie subssuqidei subssuqiedi subssuqieid
subssuqdiie subssuqdiei subssuqdiie subssuqdiei subssuqdeii subssuqdeii subssuqeidi subssuqeiid subssuqedii subssuqedii
subssuqeidi subssuqeiid subssudiqie subssudiqei subssudiiqe subssudiieq subssudieiq subssudieqi subssudqiie subssudqiei
subssudqiie subssudqiei subssudqeii subssudqeii subssudiqie subssudiqei subssudiiqe subssudiieq subssudieiq subssudieqi
subssudeqii subssudeqii subssudeiqi subssudeiiq subssudeiiq subssudeiqi subssueiqdi subssueiqid subssueidqi subssueidiq
subssueiidq subssueiiqd subssueqidi subssueqiid subssueqdii subssueqdii subssueqidi subssueqiid subssuedqii subssuedqii
subssuediqi subssuediiq subssuediiq subssuediqi subssueiqdi subssueiqid subssueidqi subssueidiq subssueiidq subssueiiqd
subsseiiqud subsseiiqdu subsseiiuqd subsseiiudq subsseiiduq subsseiidqu subsseiqiud subsseiqidu subsseiquid subsseiqudi
subsseiqdui subsseiqdiu subsseiuqid subsseiuqdi subsseiuiqd subsseiuidq subsseiudiq subsseiudqi subsseidqui subsseidqiu
subsseiduqi subsseiduiq subsseidiuq subsseidiqu subsseiiqud subsseiiqdu subsseiiuqd subsseiiudq subsseiiduq subsseiidqu
subsseiqiud subsseiqidu subsseiquid subsseiqudi subsseiqdui subsseiqdiu subsseiuqid subsseiuqdi subsseiuiqd subsseiuidq
subsseiudiq subsseiudqi subsseidqui subsseidqiu subsseiduqi subsseiduiq subsseidiuq subsseidiqu subsseqiiud subsseqiidu
subsseqiuid subsseqiudi subsseqidui subsseqidiu subsseqiiud subsseqiidu subsseqiuid subsseqiudi subsseqidui subsseqidiu
subssequiid subssequidi subssequiid subssequidi subssequdii subssequdii subsseqdiui subsseqdiiu subsseqduii subsseqduii
subsseqdiui subsseqdiiu subsseuiqid subsseuiqdi subsseuiiqd subsseuiidq subsseuidiq subsseuidqi subsseuqiid subsseuqidi
subsseuqiid subsseuqidi subsseuqdii subsseuqdii subsseuiqid subsseuiqdi subsseuiiqd subsseuiidq subsseuidiq subsseuidqi
subsseudqii subsseudqii subsseudiqi subsseudiiq subsseudiiq subsseudiqi subssediqui subssediqiu subssediuqi subssediuiq
subssediiuq subssediiqu subssedqiui subssedqiiu subssedquii subssedquii subssedqiui subssedqiiu subsseduqii subsseduqii
subsseduiqi subsseduiiq subsseduiiq subsseduiqi subssediqui subssediqiu subssediuqi subssediuiq subssediiuq subssediiqu
subsqdisiue subsqdisieu subsqdisuie subsqdisuei subsqdiseui subsqdiseiu subsqdiisue subsqdiiseu subsqdiiuse subsqdiiues
subsqdiieus subsqdiiesu subsqdiuise subsqdiuies subsqdiusie subsqdiusei subsqdiuesi subsqdiueis subsqdieius subsqdieisu
subsqdieuis subsqdieusi subsqdiesui subsqdiesiu subsqdsiiue subsqdsiieu subsqdsiuie subsqdsiuei subsqdsieui subsqdsieiu
subsqdsiiue subsqdsiieu subsqdsiuie subsqdsiuei subsqdsieui subsqdsieiu subsqdsuiie subsqdsuiei subsqdsuiie subsqdsuiei
subsqdsueii subsqdsueii subsqdseiui subsqdseiiu subsqdseuii subsqdseuii subsqdseiui subsqdseiiu subsqdisiue subsqdisieu
subsqdisuie subsqdisuei subsqdiseui subsqdiseiu subsqdiisue subsqdiiseu subsqdiiuse subsqdiiues subsqdiieus subsqdiiesu
subsqdiuise subsqdiuies subsqdiusie subsqdiusei subsqdiuesi subsqdiueis subsqdieius subsqdieisu subsqdieuis subsqdieusi
subsqdiesui subsqdiesiu subsqdusiie subsqdusiei subsqdusiie subsqdusiei subsqduseii subsqduseii subsqduisie subsqduisei
subsqduiise subsqduiies subsqduieis subsqduiesi subsqduiise subsqduiies subsqduisie subsqduisei subsqduiesi subsqduieis
subsqdueiis subsqdueisi subsqdueiis subsqdueisi subsqduesii subsqduesii subsqdesiui subsqdesiiu subsqdesuii subsqdesuii
subsqdesiui subsqdesiiu subsqdeisui subsqdeisiu subsqdeiusi subsqdeiuis subsqdeiius subsqdeiisu subsqdeuisi subsqdeuiis
subsqdeusii subsqdeusii subsqdeuisi subsqdeuiis subsqdeiius subsqdeiisu subsqdeiuis subsqdeiusi subsqdeisui subsqdeisiu
subsqidsiue subsqidsieu subsqidsuie subsqidsuei subsqidseui subsqidseiu subsqidisue subsqidiseu subsqidiuse subsqidiues
subsqidieus subsqidiesu subsqiduise subsqiduies subsqidusie subsqidusei subsqiduesi subsqidueis subsqideius subsqideisu
subsqideuis subsqideusi subsqidesui subsqidesiu subsqisdiue subsqisdieu subsqisduie subsqisduei subsqisdeui subsqisdeiu
subsqisidue subsqisideu subsqisiude subsqisiued subsqisieud subsqisiedu subsqisuide subsqisuied subsqisudie subsqisudei
subsqisuedi subsqisueid subsqiseiud subsqiseidu subsqiseuid subsqiseudi subsqisedui subsqisediu subsqiisdue subsqiisdeu
subsqiisude subsqiisued subsqiiseud subsqiisedu subsqiidsue subsqiidseu subsqiiduse subsqiidues subsqiideus subsqiidesu
subsqiiudse subsqiiudes subsqiiusde subsqiiused subsqiiuesd subsqiiueds subsqiiedus subsqiiedsu subsqiieuds subsqiieusd
subsqiiesud subsqiiesdu subsqiuside subsqiusied subsqiusdie subsqiusdei subsqiusedi subsqiuseid subsqiuisde subsqiuised
subsqiuidse subsqiuides subsqiuieds subsqiuiesd subsqiudise subsqiudies subsqiudsie subsqiudsei subsqiudesi subsqiudeis
subsqiueids subsqiueisd subsqiuedis subsqiuedsi subsqiuesdi subsqiuesid subsqiesiud subsqiesidu subsqiesuid subsqiesudi
subsqiesdui subsqiesdiu subsqieisud subsqieisdu subsqieiusd subsqieiuds subsqieidus subsqieidsu subsqieuisd subsqieuids
subsqieusid subsqieusdi subsqieudsi subsqieudis subsqiedius subsqiedisu subsqieduis subsqiedusi subsqiedsui subsqiedsiu
subsqsidiue subsqsidieu subsqsiduie subsqsiduei subsqsideui subsqsideiu subsqsiidue subsqsiideu subsqsiiude subsqsiiued
subsqsiieud subsqsiiedu subsqsiuide subsqsiuied subsqsiudie subsqsiudei subsqsiuedi subsqsiueid subsqsieiud subsqsieidu
subsqsieuid subsqsieudi subsqsiedui subsqsiediu subsqsdiiue subsqsdiieu subsqsdiuie subsqsdiuei subsqsdieui subsqsdieiu
subsqsdiiue subsqsdiieu subsqsdiuie subsqsdiuei subsqsdieui subsqsdieiu subsqsduiie subsqsduiei subsqsduiie subsqsduiei
subsqsdueii subsqsdueii subsqsdeiui subsqsdeiiu subsqsdeuii subsqsdeuii subsqsdeiui subsqsdeiiu subsqsidiue subsqsidieu
subsqsiduie subsqsiduei subsqsideui subsqsideiu subsqsiidue subsqsiideu subsqsiiude subsqsiiued subsqsiieud subsqsiiedu
subsqsiuide subsqsiuied subsqsiudie subsqsiudei subsqsiuedi subsqsiueid subsqsieiud subsqsieidu subsqsieuid subsqsieudi
subsqsiedui subsqsiediu subsqsudiie subsqsudiei subsqsudiie subsqsudiei subsqsudeii subsqsudeii subsqsuidie subsqsuidei
subsqsuiide subsqsuiied subsqsuieid subsqsuiedi subsqsuiide subsqsuiied subsqsuidie subsqsuidei subsqsuiedi subsqsuieid
subsqsueiid subsqsueidi subsqsueiid subsqsueidi subsqsuedii subsqsuedii subsqsediui subsqsediiu subsqseduii subsqseduii
subsqsediui subsqsediiu subsqseidui subsqseidiu subsqseiudi subsqseiuid subsqseiiud subsqseiidu subsqseuidi subsqseuiid
subsqseudii subsqseudii subsqseuidi subsqseuiid subsqseiiud subsqseiidu subsqseiuid subsqseiudi subsqseidui subsqseidiu
subsqiisdue subsqiisdeu subsqiisude subsqiisued subsqiiseud subsqiisedu subsqiidsue subsqiidseu subsqiiduse subsqiidues
subsqiideus subsqiidesu subsqiiudse subsqiiudes subsqiiusde subsqiiused subsqiiuesd subsqiiueds subsqiiedus subsqiiedsu
subsqiieuds subsqiieusd subsqiiesud subsqiiesdu subsqisidue subsqisideu subsqisiude subsqisiued subsqisieud subsqisiedu
subsqisdiue subsqisdieu subsqisduie subsqisduei subsqisdeui subsqisdeiu subsqisudie subsqisudei subsqisuide subsqisuied
subsqisueid subsqisuedi subsqisedui subsqisediu subsqiseudi subsqiseuid subsqiseiud subsqiseidu subsqidsiue subsqidsieu
subsqidsuie subsqidsuei subsqidseui subsqidseiu subsqidisue subsqidiseu subsqidiuse subsqidiues subsqidieus subsqidiesu
subsqiduise subsqiduies subsqidusie subsqidusei subsqiduesi subsqidueis subsqideius subsqideisu subsqideuis subsqideusi
subsqidesui subsqidesiu subsqiusdie subsqiusdei subsqiuside subsqiusied subsqiuseid subsqiusedi subsqiudsie subsqiudsei
subsqiudise subsqiudies subsqiudeis subsqiudesi subsqiuidse subsqiuides subsqiuisde subsqiuised subsqiuiesd subsqiuieds
subsqiuedis subsqiuedsi subsqiueids subsqiueisd subsqiuesid subsqiuesdi subsqiesdui subsqiesdiu subsqiesudi subsqiesuid
subsqiesiud subsqiesidu subsqiedsui subsqiedsiu subsqiedusi subsqieduis subsqiedius subsqiedisu subsqieudsi subsqieudis
subsqieusdi subsqieusid subsqieuisd subsqieuids subsqieidus subsqieidsu subsqieiuds subsqieiusd subsqieisud subsqieisdu
subsquiside subsquisied subsquisdie subsquisdei subsquisedi subsquiseid subsquiisde subsquiised subsquiidse subsquiides
subsquiieds subsquiiesd subsquidise subsquidies subsquidsie subsquidsei subsquidesi subsquideis subsquieids subsquieisd
subsquiedis subsquiedsi subsquiesdi subsquiesid subsqusiide subsqusiied subsqusidie subsqusidei subsqusiedi subsqusieid
subsqusiide subsqusiied subsqusidie subsqusidei subsqusiedi subsqusieid subsqusdiie subsqusdiei subsqusdiie subsqusdiei
subsqusdeii subsqusdeii subsquseidi subsquseiid subsqusedii subsqusedii subsquseidi subsquseiid subsquiside subsquisied
subsquisdie subsquisdei subsquisedi subsquiseid subsquiisde subsquiised subsquiidse subsquiides subsquiieds subsquiiesd
subsquidise subsquidies subsquidsie subsquidsei subsquidesi subsquideis subsquieids subsquieisd subsquiedis subsquiedsi
subsquiesdi subsquiesid subsqudsiie subsqudsiei subsqudsiie subsqudsiei subsqudseii subsqudseii subsqudisie subsqudisei
subsqudiise subsqudiies subsqudieis subsqudiesi subsqudiise subsqudiies subsqudisie subsqudisei subsqudiesi subsqudieis
subsqudeiis subsqudeisi subsqudeiis subsqudeisi subsqudesii subsqudesii subsquesidi subsquesiid subsquesdii subsquesdii
subsquesidi subsquesiid subsqueisdi subsqueisid subsqueidsi subsqueidis subsqueiids subsqueiisd subsquedisi subsquediis
subsquedsii subsquedsii subsquedisi subsquediis subsqueiids subsqueiisd subsqueidis subsqueidsi subsqueisdi subsqueisid
subsqeisiud subsqeisidu subsqeisuid subsqeisudi subsqeisdui subsqeisdiu subsqeiisud subsqeiisdu subsqeiiusd subsqeiiuds
subsqeiidus subsqeiidsu subsqeiuisd subsqeiuids subsqeiusid subsqeiusdi subsqeiudsi subsqeiudis subsqeidius subsqeidisu
subsqeiduis subsqeidusi subsqeidsui subsqeidsiu subsqesiiud subsqesiidu subsqesiuid subsqesiudi subsqesidui subsqesidiu
subsqesiiud subsqesiidu subsqesiuid subsqesiudi subsqesidui subsqesidiu subsqesuiid subsqesuidi subsqesuiid subsqesuidi
subsqesudii subsqesudii subsqesdiui subsqesdiiu subsqesduii subsqesduii subsqesdiui subsqesdiiu subsqeisiud subsqeisidu
subsqeisuid subsqeisudi subsqeisdui subsqeisdiu subsqeiisud subsqeiisdu subsqeiiusd subsqeiiuds subsqeiidus subsqeiidsu
subsqeiuisd subsqeiuids subsqeiusid subsqeiusdi subsqeiudsi subsqeiudis subsqeidius subsqeidisu subsqeiduis subsqeidusi
subsqeidsui subsqeidsiu subsqeusiid subsqeusidi subsqeusiid subsqeusidi subsqeusdii subsqeusdii subsqeuisid subsqeuisdi
subsqeuiisd subsqeuiids subsqeuidis subsqeuidsi subsqeuiisd subsqeuiids subsqeuisid subsqeuisdi subsqeuidsi subsqeuidis
subsqeudiis subsqeudisi subsqeudiis subsqeudisi subsqeudsii subsqeudsii subsqedsiui subsqedsiiu subsqedsuii subsqedsuii
subsqedsiui subsqedsiiu subsqedisui subsqedisiu subsqediusi subsqediuis subsqediius subsqediisu subsqeduisi subsqeduiis
subsqedusii subsqedusii subsqeduisi subsqeduiis subsqediius subsqediisu subsqediuis subsqediusi subsqedisui subsqedisiu
subsudisqie subsudisqei subsudisiqe subsudisieq subsudiseiq subsudiseqi subsudiqsie subsudiqsei subsudiqise subsudiqies
subsudiqeis subsudiqesi subsudiiqse subsudiiqes subsudiisqe subsudiiseq subsudiiesq subsudiieqs subsudieqis subsudieqsi
subsudieiqs subsudieisq subsudiesiq subsudiesqi subsudsiqie subsudsiqei subsudsiiqe subsudsiieq subsudsieiq subsudsieqi
subsudsqiie subsudsqiei subsudsqiie subsudsqiei subsudsqeii subsudsqeii subsudsiqie subsudsiqei subsudsiiqe subsudsiieq
subsudsieiq subsudsieqi subsudseqii subsudseqii subsudseiqi subsudseiiq subsudseiiq subsudseiqi subsudqsiie subsudqsiei
subsudqsiie subsudqsiei subsudqseii subsudqseii subsudqisie subsudqisei subsudqiise subsudqiies subsudqieis subsudqiesi
subsudqiise subsudqiies subsudqisie subsudqisei subsudqiesi subsudqieis subsudqeiis subsudqeisi subsudqeiis subsudqeisi
subsudqesii subsudqesii subsudisqie subsudisqei subsudisiqe subsudisieq subsudiseiq subsudiseqi subsudiqsie subsudiqsei
subsudiqise subsudiqies subsudiqeis subsudiqesi subsudiiqse subsudiiqes subsudiisqe subsudiiseq subsudiiesq subsudiieqs
subsudieqis subsudieqsi subsudieiqs subsudieisq subsudiesiq subsudiesqi subsudesqii subsudesqii subsudesiqi subsudesiiq
subsudesiiq subsudesiqi subsudeqsii subsudeqsii subsudeqisi subsudeqiis subsudeqiis subsudeqisi subsudeiqsi subsudeiqis
subsudeisqi subsudeisiq subsudeiisq subsudeiiqs subsudeiqis subsudeiqsi subsudeiiqs subsudeiisq subsudeisiq subsudeisqi
subsuidsqie subsuidsqei subsuidsiqe subsuidsieq subsuidseiq subsuidseqi subsuidqsie subsuidqsei subsuidqise subsuidqies
subsuidqeis subsuidqesi subsuidiqse subsuidiqes subsuidisqe subsuidiseq subsuidiesq subsuidieqs subsuideqis subsuideqsi
subsuideiqs subsuideisq subsuidesiq subsuidesqi subsuisdqie subsuisdqei subsuisdiqe subsuisdieq subsuisdeiq subsuisdeqi
subsuisqdie subsuisqdei subsuisqide subsuisqied subsuisqeid subsuisqedi subsuisiqde subsuisiqed subsuisidqe subsuisideq
subsuisiedq subsuisieqd subsuiseqid subsuiseqdi subsuiseiqd subsuiseidq subsuisediq subsuisedqi subsuiqsdie subsuiqsdei
subsuiqside subsuiqsied subsuiqseid subsuiqsedi subsuiqdsie subsuiqdsei subsuiqdise subsuiqdies subsuiqdeis subsuiqdesi
subsuiqidse subsuiqides subsuiqisde subsuiqised subsuiqiesd subsuiqieds subsuiqedis subsuiqedsi subsuiqeids subsuiqeisd
subsuiqesid subsuiqesdi subsuiisqde subsuiisqed subsuiisdqe subsuiisdeq subsuiisedq subsuiiseqd subsuiiqsde subsuiiqsed
subsuiiqdse subsuiiqdes subsuiiqeds subsuiiqesd subsuiidqse subsuiidqes subsuiidsqe subsuiidseq subsuiidesq subsuiideqs
subsuiieqds subsuiieqsd subsuiiedqs subsuiiedsq subsuiiesdq subsuiiesqd subsuiesqid subsuiesqdi subsuiesiqd subsuiesidq
subsuiesdiq subsuiesdqi subsuieqsid subsuieqsdi subsuieqisd subsuieqids subsuieqdis subsuieqdsi subsuieiqsd subsuieiqds
subsuieisqd subsuieisdq subsuieidsq subsuieidqs subsuiedqis subsuiedqsi subsuiediqs subsuiedisq subsuiedsiq subsuiedsqi
subsusidqie subsusidqei subsusidiqe subsusidieq subsusideiq subsusideqi subsusiqdie subsusiqdei subsusiqide subsusiqied
subsusiqeid subsusiqedi subsusiiqde subsusiiqed subsusiidqe subsusiideq subsusiiedq subsusiieqd subsusieqid subsusieqdi
subsusieiqd subsusieidq subsusiediq subsusiedqi subsusdiqie subsusdiqei subsusdiiqe subsusdiieq subsusdieiq subsusdieqi
subsusdqiie subsusdqiei subsusdqiie subsusdqiei subsusdqeii subsusdqeii subsusdiqie subsusdiqei subsusdiiqe subsusdiieq
subsusdieiq subsusdieqi subsusdeqii subsusdeqii subsusdeiqi subsusdeiiq subsusdeiiq subsusdeiqi subsusqdiie subsusqdiei
subsusqdiie subsusqdiei subsusqdeii subsusqdeii subsusqidie subsusqidei subsusqiide subsusqiied subsusqieid subsusqiedi
subsusqiide subsusqiied subsusqidie subsusqidei subsusqiedi subsusqieid subsusqeiid subsusqeidi subsusqeiid subsusqeidi
subsusqedii subsusqedii subsusidqie subsusidqei subsusidiqe subsusidieq subsusideiq subsusideqi subsusiqdie subsusiqdei
subsusiqide subsusiqied subsusiqeid subsusiqedi subsusiiqde subsusiiqed subsusiidqe subsusiideq subsusiiedq subsusiieqd
subsusieqid subsusieqdi subsusieiqd subsusieidq subsusiediq subsusiedqi subsusedqii subsusedqii subsusediqi subsusediiq
subsusediiq subsusediqi subsuseqdii subsuseqdii subsuseqidi subsuseqiid subsuseqiid subsuseqidi subsuseiqdi subsuseiqid
subsuseidqi subsuseidiq subsuseiidq subsuseiiqd subsuseiqid subsuseiqdi subsuseiiqd subsuseiidq subsuseidiq subsuseidqi
subsuqisdie subsuqisdei subsuqiside subsuqisied subsuqiseid subsuqisedi subsuqidsie subsuqidsei subsuqidise subsuqidies
subsuqideis subsuqidesi subsuqiidse subsuqiides subsuqiisde subsuqiised subsuqiiesd subsuqiieds subsuqiedis subsuqiedsi
subsuqieids subsuqieisd subsuqiesid subsuqiesdi subsuqsidie subsuqsidei subsuqsiide subsuqsiied subsuqsieid subsuqsiedi
subsuqsdiie subsuqsdiei subsuqsdiie subsuqsdiei subsuqsdeii subsuqsdeii subsuqsidie subsuqsidei subsuqsiide subsuqsiied
subsuqsieid subsuqsiedi subsuqsedii subsuqsedii subsuqseidi subsuqseiid subsuqseiid subsuqseidi subsuqdsiie subsuqdsiei
subsuqdsiie subsuqdsiei subsuqdseii subsuqdseii subsuqdisie subsuqdisei subsuqdiise subsuqdiies subsuqdieis subsuqdiesi
subsuqdiise subsuqdiies subsuqdisie subsuqdisei subsuqdiesi subsuqdieis subsuqdeiis subsuqdeisi subsuqdeiis subsuqdeisi
subsuqdesii subsuqdesii subsuqisdie subsuqisdei subsuqiside subsuqisied subsuqiseid subsuqisedi subsuqidsie subsuqidsei
subsuqidise subsuqidies subsuqideis subsuqidesi subsuqiidse subsuqiides subsuqiisde subsuqiised subsuqiiesd subsuqiieds
subsuqiedis subsuqiedsi subsuqieids subsuqieisd subsuqiesid subsuqiesdi subsuqesdii subsuqesdii subsuqesidi subsuqesiid
subsuqesiid subsuqesidi subsuqedsii subsuqedsii subsuqedisi subsuqediis subsuqediis subsuqedisi subsuqeidsi subsuqeidis
subsuqeisdi subsuqeisid subsuqeiisd subsuqeiids subsuqeidis subsuqeidsi subsuqeiids subsuqeiisd subsuqeisid subsuqeisdi
subsuiisqde subsuiisqed subsuiisdqe subsuiisdeq subsuiisedq subsuiiseqd subsuiiqsde subsuiiqsed subsuiiqdse subsuiiqdes
subsuiiqeds subsuiiqesd subsuiidqse subsuiidqes subsuiidsqe subsuiidseq subsuiidesq subsuiideqs subsuiieqds subsuiieqsd
subsuiiedqs subsuiiedsq subsuiiesdq subsuiiesqd subsuisiqde subsuisiqed subsuisidqe subsuisideq subsuisiedq subsuisieqd
subsuisqide subsuisqied subsuisqdie subsuisqdei subsuisqedi subsuisqeid subsuisdqie subsuisdqei subsuisdiqe subsuisdieq
subsuisdeiq subsuisdeqi subsuiseqdi subsuiseqid subsuisedqi subsuisediq subsuiseidq subsuiseiqd subsuiqside subsuiqsied
subsuiqsdie subsuiqsdei subsuiqsedi subsuiqseid subsuiqisde subsuiqised subsuiqidse subsuiqides subsuiqieds subsuiqiesd
subsuiqdise subsuiqdies subsuiqdsie subsuiqdsei subsuiqdesi subsuiqdeis subsuiqeids subsuiqeisd subsuiqedis subsuiqedsi
subsuiqesdi subsuiqesid subsuidsqie subsuidsqei subsuidsiqe subsuidsieq subsuidseiq subsuidseqi subsuidqsie subsuidqsei
subsuidqise subsuidqies subsuidqeis subsuidqesi subsuidiqse subsuidiqes subsuidisqe subsuidiseq subsuidiesq subsuidieqs
subsuideqis subsuideqsi subsuideiqs subsuideisq subsuidesiq subsuidesqi subsuiesqdi subsuiesqid subsuiesdqi subsuiesdiq
subsuiesidq subsuiesiqd subsuieqsdi subsuieqsid subsuieqdsi subsuieqdis subsuieqids subsuieqisd subsuiedqsi subsuiedqis
subsuiedsqi subsuiedsiq subsuiedisq subsuiediqs subsuieiqds subsuieiqsd subsuieidqs subsuieidsq subsuieisdq subsuieisqd
subsueisqid subsueisqdi subsueisiqd subsueisidq subsueisdiq subsueisdqi subsueiqsid subsueiqsdi subsueiqisd subsueiqids
subsueiqdis subsueiqdsi subsueiiqsd subsueiiqds subsueiisqd subsueiisdq subsueiidsq subsueiidqs subsueidqis subsueidqsi
subsueidiqs subsueidisq subsueidsiq subsueidsqi subsuesiqid subsuesiqdi subsuesiiqd subsuesiidq subsuesidiq subsuesidqi
subsuesqiid subsuesqidi subsuesqiid subsuesqidi subsuesqdii subsuesqdii subsuesiqid subsuesiqdi subsuesiiqd subsuesiidq
subsuesidiq subsuesidqi subsuesdqii subsuesdqii subsuesdiqi subsuesdiiq subsuesdiiq subsuesdiqi subsueqsiid subsueqsidi
subsueqsiid subsueqsidi subsueqsdii subsueqsdii subsueqisid subsueqisdi subsueqiisd subsueqiids subsueqidis subsueqidsi
subsueqiisd subsueqiids subsueqisid subsueqisdi subsueqidsi subsueqidis subsueqdiis subsueqdisi subsueqdiis subsueqdisi
subsueqdsii subsueqdsii subsueisqid subsueisqdi subsueisiqd subsueisidq subsueisdiq subsueisdqi subsueiqsid subsueiqsdi
subsueiqisd subsueiqids subsueiqdis subsueiqdsi subsueiiqsd subsueiiqds subsueiisqd subsueiisdq subsueiidsq subsueiidqs
subsueidqis subsueidqsi subsueidiqs subsueidisq subsueidsiq subsueidsqi subsuedsqii subsuedsqii subsuedsiqi subsuedsiiq
subsuedsiiq subsuedsiqi subsuedqsii subsuedqsii subsuedqisi subsuedqiis subsuedqiis subsuedqisi subsuediqsi subsuediqis
subsuedisqi subsuedisiq subsuediisq subsuediiqs subsuediqis subsuediqsi subsuediiqs subsuediisq subsuedisiq subsuedisqi
subsedisqui subsedisqiu subsedisuqi subsedisuiq subsedisiuq subsedisiqu subsediqsui subsediqsiu subsediqusi subsediquis
subsediqius subsediqisu subsediuqsi subsediuqis subsediusqi subsediusiq subsediuisq subsediuiqs subsediiqus subsediiqsu
subsediiuqs subsediiusq subsediisuq subsediisqu subsedsiqui subsedsiqiu subsedsiuqi subsedsiuiq subsedsiiuq subsedsiiqu
subsedsqiui subsedsqiiu subsedsquii subsedsquii subsedsqiui subsedsqiiu subsedsuqii subsedsuqii subsedsuiqi subsedsuiiq
subsedsuiiq subsedsuiqi subsedsiqui subsedsiqiu subsedsiuqi subsedsiuiq subsedsiiuq subsedsiiqu subsedqsiui subsedqsiiu
subsedqsuii subsedqsuii subsedqsiui subsedqsiiu subsedqisui subsedqisiu subsedqiusi subsedqiuis subsedqiius subsedqiisu
subsedquisi subsedquiis subsedqusii subsedqusii subsedquisi subsedquiis subsedqiius subsedqiisu subsedqiuis subsedqiusi
subsedqisui subsedqisiu subsedusqii subsedusqii subsedusiqi subsedusiiq subsedusiiq subsedusiqi subseduqsii subseduqsii
subseduqisi subseduqiis subseduqiis subseduqisi subseduiqsi subseduiqis subseduisqi subseduisiq subseduiisq subseduiiqs
subseduiqis subseduiqsi subseduiiqs subseduiisq subseduisiq subseduisqi subsedisqui subsedisqiu subsedisuqi subsedisuiq
subsedisiuq subsedisiqu subsediqsui subsediqsiu subsediqusi subsediquis subsediqius subsediqisu subsediuqsi subsediuqis
subsediusqi subsediusiq subsediuisq subsediuiqs subsediiqus subsediiqsu subsediiuqs subsediiusq subsediisuq subsediisqu
subseidsqui subseidsqiu subseidsuqi subseidsuiq subseidsiuq subseidsiqu subseidqsui subseidqsiu subseidqusi subseidquis
subseidqius subseidqisu subseiduqsi subseiduqis subseidusqi subseidusiq subseiduisq subseiduiqs subseidiqus subseidiqsu
subseidiuqs subseidiusq subseidisuq subseidisqu subseisdqui subseisdqiu subseisduqi subseisduiq subseisdiuq subseisdiqu
subseisqdui subseisqdiu subseisqudi subseisquid subseisqiud subseisqidu subseisuqdi subseisuqid subseisudqi subseisudiq
subseisuidq subseisuiqd subseisiqud subseisiqdu subseisiuqd subseisiudq subseisiduq subseisidqu subseiqsdui subseiqsdiu
subseiqsudi subseiqsuid subseiqsiud subseiqsidu subseiqdsui subseiqdsiu subseiqdusi subseiqduis subseiqdius subseiqdisu
subseiqudsi subseiqudis subseiqusdi subseiqusid subseiquisd subseiquids subseiqidus subseiqidsu subseiqiuds subseiqiusd
subseiqisud subseiqisdu subseiusqdi subseiusqid subseiusdqi subseiusdiq subseiusidq subseiusiqd subseiuqsdi subseiuqsid
subseiuqdsi subseiuqdis subseiuqids subseiuqisd subseiudqsi subseiudqis subseiudsqi subseiudsiq subseiudisq subseiudiqs
subseiuiqds subseiuiqsd subseiuidqs subseiuidsq subseiuisdq subseiuisqd subseiisqud subseiisqdu subseiisuqd subseiisudq
subseiisduq subseiisdqu subseiiqsud subseiiqsdu subseiiqusd subseiiquds subseiiqdus subseiiqdsu subseiiuqsd subseiiuqds
subseiiusqd subseiiusdq subseiiudsq subseiiudqs subseiidqus subseiidqsu subseiiduqs subseiidusq subseiidsuq subseiidsqu
subsesidqui subsesidqiu subsesiduqi subsesiduiq subsesidiuq subsesidiqu subsesiqdui subsesiqdiu subsesiqudi subsesiquid
subsesiqiud subsesiqidu subsesiuqdi subsesiuqid subsesiudqi subsesiudiq subsesiuidq subsesiuiqd subsesiiqud subsesiiqdu
subsesiiuqd subsesiiudq subsesiiduq subsesiidqu subsesdiqui subsesdiqiu subsesdiuqi subsesdiuiq subsesdiiuq subsesdiiqu
subsesdqiui subsesdqiiu subsesdquii subsesdquii subsesdqiui subsesdqiiu subsesduqii subsesduqii subsesduiqi subsesduiiq
subsesduiiq subsesduiqi subsesdiqui subsesdiqiu subsesdiuqi subsesdiuiq subsesdiiuq subsesdiiqu subsesqdiui subsesqdiiu
subsesqduii subsesqduii subsesqdiui subsesqdiiu subsesqidui subsesqidiu subsesqiudi subsesqiuid subsesqiiud subsesqiidu
subsesquidi subsesquiid subsesqudii subsesqudii subsesquidi subsesquiid subsesqiiud subsesqiidu subsesqiuid subsesqiudi
subsesqidui subsesqidiu subsesudqii subsesudqii subsesudiqi subsesudiiq subsesudiiq subsesudiqi subsesuqdii subsesuqdii
subsesuqidi subsesuqiid subsesuqiid subsesuqidi subsesuiqdi subsesuiqid subsesuidqi subsesuidiq subsesuiidq subsesuiiqd
subsesuiqid subsesuiqdi subsesuiiqd subsesuiidq subsesuidiq subsesuidqi subsesidqui subsesidqiu subsesiduqi subsesiduiq
subsesidiuq subsesidiqu subsesiqdui subsesiqdiu subsesiqudi subsesiquid subsesiqiud subsesiqidu subsesiuqdi subsesiuqid
subsesiudqi subsesiudiq subsesiuidq subsesiuiqd subsesiiqud subsesiiqdu subsesiiuqd subsesiiudq subsesiiduq subsesiidqu
subseqisdui subseqisdiu subseqisudi subseqisuid subseqisiud subseqisidu subseqidsui subseqidsiu subseqidusi subseqiduis
subseqidius subseqidisu subseqiudsi subseqiudis subseqiusdi subseqiusid subseqiuisd subseqiuids subseqiidus subseqiidsu
subseqiiuds subseqiiusd subseqiisud subseqiisdu subseqsidui subseqsidiu subseqsiudi subseqsiuid subseqsiiud subseqsiidu
subseqsdiui subseqsdiiu subseqsduii subseqsduii subseqsdiui subseqsdiiu subseqsudii subseqsudii subseqsuidi subseqsuiid
subseqsuiid subseqsuidi subseqsidui subseqsidiu subseqsiudi subseqsiuid subseqsiiud subseqsiidu subseqdsiui subseqdsiiu
subseqdsuii subseqdsuii subseqdsiui subseqdsiiu subseqdisui subseqdisiu subseqdiusi subseqdiuis subseqdiius subseqdiisu
subseqduisi subseqduiis subseqdusii subseqdusii subseqduisi subseqduiis subseqdiius subseqdiisu subseqdiuis subseqdiusi
subseqdisui subseqdisiu subsequsdii subsequsdii subsequsidi subsequsiid subsequsiid subsequsidi subsequdsii subsequdsii
subsequdisi subsequdiis subsequdiis subsequdisi subsequidsi subsequidis subsequisdi subsequisid subsequiisd subsequiids
subsequidis subsequidsi subsequiids subsequiisd subsequisid subsequisdi subseqisdui subseqisdiu subseqisudi subseqisuid
subseqisiud subseqisidu subseqidsui subseqidsiu subseqidusi subseqiduis subseqidius subseqidisu subseqiudsi subseqiudis
subseqiusdi subseqiusid subseqiuisd subseqiuids subseqiidus subseqiidsu subseqiiuds subseqiiusd subseqiisud subseqiisdu
subseuisqdi subseuisqid subseuisdqi subseuisdiq subseuisidq subseuisiqd subseuiqsdi subseuiqsid subseuiqdsi subseuiqdis
subseuiqids subseuiqisd subseuidqsi subseuidqis subseuidsqi subseuidsiq subseuidisq subseuidiqs subseuiiqds subseuiiqsd
subseuiidqs subseuiidsq subseuiisdq subseuiisqd subseusiqdi subseusiqid subseusidqi subseusidiq subseusiidq subseusiiqd
subseusqidi subseusqiid subseusqdii subseusqdii subseusqidi subseusqiid subseusdqii subseusdqii subseusdiqi subseusdiiq
subseusdiiq subseusdiqi subseusiqdi subseusiqid subseusidqi subseusidiq subseusiidq subseusiiqd subseuqsidi subseuqsiid
subseuqsdii subseuqsdii subseuqsidi subseuqsiid subseuqisdi subseuqisid subseuqidsi subseuqidis subseuqiids subseuqiisd
subseuqdisi subseuqdiis subseuqdsii subseuqdsii subseuqdisi subseuqdiis subseuqiids subseuqiisd subseuqidis subseuqidsi
subseuqisdi subseuqisid subseudsqii subseudsqii subseudsiqi subseudsiiq subseudsiiq subseudsiqi subseudqsii subseudqsii
subseudqisi subseudqiis subseudqiis subseudqisi subseudiqsi subseudiqis subseudisqi subseudisiq subseudiisq subseudiiqs
subseudiqis subseudiqsi subseudiiqs subseudiisq subseudisiq subseudisqi subseuisqdi subseuisqid subseuisdqi subseuisdiq
subseuisidq subseuisiqd subseuiqsdi subseuiqsid subseuiqdsi subseuiqdis subseuiqids subseuiqisd subseuidqsi subseuidqis
subseuidsqi subseuidsiq subseuidisq subseuidiqs subseuiiqds subseuiiqsd subseuiidqs subseuiidsq subseuiisdq subseuiisqd
subseiisqud subseiisqdu subseiisuqd subseiisudq subseiisduq subseiisdqu subseiiqsud subseiiqsdu subseiiqusd subseiiquds
subseiiqdus subseiiqdsu subseiiuqsd subseiiuqds subseiiusqd subseiiusdq subseiiudsq subseiiudqs subseiidqus subseiidqsu
subseiiduqs subseiidusq subseiidsuq subseiidsqu subseisiqud subseisiqdu subseisiuqd subseisiudq subseisiduq subseisidqu
subseisqiud subseisqidu subseisquid subseisqudi subseisqdui subseisqdiu subseisuqid subseisuqdi subseisuiqd subseisuidq
subseisudiq subseisudqi subseisdqui subseisdqiu subseisduqi subseisduiq subseisdiuq subseisdiqu subseiqsiud subseiqsidu
subseiqsuid subseiqsudi subseiqsdui subseiqsdiu subseiqisud subseiqisdu subseiqiusd subseiqiuds subseiqidus subseiqidsu
subseiquisd subseiquids subseiqusid subseiqusdi subseiqudsi subseiqudis subseiqdius subseiqdisu subseiqduis subseiqdusi
subseiqdsui subseiqdsiu subseiusqid subseiusqdi subseiusiqd subseiusidq subseiusdiq subseiusdqi subseiuqsid subseiuqsdi
subseiuqisd subseiuqids subseiuqdis subseiuqdsi subseiuiqsd subseiuiqds subseiuisqd subseiuisdq subseiuidsq subseiuidqs
subseiudqis subseiudqsi subseiudiqs subseiudisq subseiudsiq subseiudsqi subseidsqui subseidsqiu subseidsuqi subseidsuiq
subseidsiuq subseidsiqu subseidqsui subseidqsiu subseidqusi subseidquis subseidqius subseidqisu subseiduqsi subseiduqis
subseidusqi subseidusiq subseiduisq subseiduiqs subseidiqus subseidiqsu subseidiuqs subseidiusq subseidisuq subseidisqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us