easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

philocubist

kabeljou

compellabitis

renormalize

supawn

premedics

committantque

abscessing

chillumchee

diastataxic

animaduersurumque

publicly

machbenah

rimland

declinaveratis

inexplicableness

embudo

randallite


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: submergereque
cipher variations:
tvcnfshfsfrvf uwdogtigtgswg vxephujhuhtxh wyfqivkiviuyi xzgrjwljwjvzj
yahskxmkxkwak zbitlynlylxbl acjumzomzmycm bdkvnapnanzdn celwobqoboaeo
dfmxpcrpcpbfp egnyqdsqdqcgq fhozretrerdhr gipasfusfseis hjqbtgvtgtfjt
ikrcuhwuhugku jlsdvixvivhlv kmtewjywjwimw lnufxkzxkxjnx movgylaylykoy
npwhzmbzmzlpz oqxiancanamqa pryjbodbobnrb qszkcpecpcosc rtaldqfdqdptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: submergereque
Cipher: hfynvitvivjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: submergereque
Cipher: BAAAB BAABB AAAAB ABABB AABAA BAAAA AABBA AABAA BAAAA AABAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: submergereque
cipher variations:
tvcnfshfsfrvfdjelnatnanxjnnxgjvifvivdxvxlihdqrdqdjldhzkflydlylpzlrnmdtgptgtvntlpqzjwnjwjhpjvdsxrezrerndr
fruvzmlzmztrzpfwthuxhuhzfhztyrpcjpcpftpjhapxkvxkxlhxuwdogtigtgswgekfmobuoboykooyhkwjgwjweywymjierserekme
ialgmzemzmqamsoneuhquhuwoumqrakxokxkiqkwetysfasfsoesgsvwanmanausaqgxuivyiviagiauzsqdkqdqguqkibqylwylymiy
vxephujhuhtxhflgnpcvpcpzlppzilxkhxkxfzxznkjfstfsflnfjbmhnafnanrbntpofvirvivxpvnrsblyplyljrlxfuztgbtgtpft
htwxbonbobvtbrhyvjwzjwjbhjbvatrelrerhvrljcrzmxzmznjzwyfqivkiviuyigmhoqdwqdqamqqajmyliylygayaolkgtugtgmog
kcniobgoboscouqpgwjswjwyqwostcmzqmzmksmygvauhcuhuqguiuxycpocpcwucsizwkxakxkcikcwbusfmsfsiwsmkdsanyanaoka
xzgrjwljwjvzjhniprexrerbnrrbknzmjzmzhbzbpmlhuvhuhnphldojpchpcptdpvrqhxktxkxzrxptudnarnanltnzhwbvidvivrhv
jvyzdqpdqdxvdtjaxlyblyldjldxcvtgntgtjxtnletbozbobplbyahskxmkxkwakiojqsfysfscosscloankanaicacqnmivwivioqi
mepkqdiqdqueqwsriyluylyasyquveobsobomuoaixcwjewjwsiwkwzaerqereyweukbymzcmzmekmeydwuhouhukyuomfucpacpcqmc
zbitlynlylxbljpkrtgztgtdpttdmpbolbobjdbdronjwxjwjprjnfqlrejrervfrxtsjzmvzmzbtzrvwfpctpcpnvpbjydxkfxkxtjx
lxabfsrfsfzxfvlcznadnanflnfzexvipvivlzvpngvdqbdqdrndacjumzomzmycmkqlsuhauhuequuenqcpmcpckecespokxykxkqsk
ogrmsfksfswgsyutkanwanacuaswxgqduqdqowqckzeylgylyukymybcgtsgtgaygwmdaobeobogmogafywjqwjwmawqohwerceresoe
bdkvnapnanzdnlrmtvibvivfrvvfordqndqdlfdftqplyzlylrtlphsntgltgtxhtzvulboxbobdvbtxyhrevrerpxrdlafzmhzmzvlz
nzcdhuthuhbzhxnebpcfpcphnphbgzxkrxkxnbxrpixfsdfsftpfcelwobqoboaeomsnuwjcwjwgswwgpseroeremgegurqmzamzmsum
qitouhmuhuyiuawvmcpycpcewcuyzisfwsfsqysembganianawmaoadeivuivicaiyofcqdgqdqioqichaylsylyocysqjygtegtguqg
dfmxpcrpcpbfpntovxkdxkxhtxxhqtfspfsfnhfhvsrnabnantvnrjupvinvivzjvbxwndqzdqdfxdvzajtgxtgtrztfnchbojbobxnb
pbefjwvjwjdbjzpgdrehrerjprjdibzmtzmzpdztrkzhufhuhvrhegnyqdsqdqcgqoupwyleylyiuyyirugtqgtgoigiwtsobcobouwo
skvqwjowjwakwcyxoeraeregyewabkuhyuhusaugodicpkcpcyocqcfgkxwkxkeckaqhesfisfskqskejcanuanaqeauslaivgiviwsi
fhozretrerdhrpvqxzmfzmzjvzzjsvhurhuhpjhjxutpcdpcpvxptlwrxkpxkxblxdzypfsbfsfhzfxbclvizvivtbvhpejdqldqdzpd
rdghlyxlylfdlbriftgjtgtlrtlfkdbovbobrfbvtmbjwhjwjxtjgipasfusfseisqwryanganakwaaktwivsiviqkikyvuqdeqdqwyq
umxsylqylycmyeazqgtcgtgiagycdmwjawjwucwiqfkermereaqesehimzymzmgemcsjguhkuhumsumglecpwcpcsgcwunckxikxkyuk
hjqbtgvtgtfjtrxszbohboblxbbluxjwtjwjrljlzwvrefrerxzrvnytzmrzmzdnzfbarhudhuhjbhzdenxkbxkxvdxjrglfsnfsfbrf
tfijnaznanhfndtkhvilvivntvnhmfdqxdqdthdxvodlyjlylzvlikrcuhwuhugkusytacpicpcmyccmvykxukxksmkmaxwsfgsfsyas
wozuansanaeoagcbsiveivikciaefoylcylyweykshmgtogtgcsgugjkobaoboigoeuliwjmwjwouwoingeryereuieywpemzkmzmawm
jlsdvixvivhlvtzubdqjdqdnzddnwzlyvlyltnlnbyxtghtgtzbtxpavbotbobfpbhdctjwfjwjldjbfgpzmdzmzxfzltinhuphuhdth
vhklpcbpcpjhpfvmjxknxkxpvxpjohfszfsfvjfzxqfnalnanbxnkmtewjywjwimwuavcerkereoaeeoxamzwmzmuomoczyuhiuhuacu
yqbwcpucpcgqciedukxgkxkmekcghqaneanaygamujoivqivieuiwilmqdcqdqkiqgwnkyloylyqwyqkpigtagtgwkgayrgobmobocyo
lnufxkzxkxjnxvbwdfslfsfpbffpybnaxnanvpnpdazvijvivbdvzrcxdqvdqdhrdjfevlyhlylnfldhirbofbobzhbnvkpjwrjwjfvj
xjmnredrerljrhxolzmpzmzrxzrlqjhubhuhxlhbzshpcnpcpdzpmovgylaylykoywcxegtmgtgqcggqzcobyobowqoqebawjkwjwcew
asdyerwereisekgfwmzimzmogmeijscpgcpcaicowlqkxskxkgwkyknosfesfsmksiypmanqanasyasmrkivciviymicatiqdoqdqeaq
npwhzmbzmzlpzxdyfhunhuhrdhhradpczpcpxrprfcbxklxkxdfxbtezfsxfsfjtflhgxnajnanphnfjktdqhdqdbjdpxmrlytlylhxl
zloptgftgtnltjzqnborbobtzbtnsljwdjwjznjdbujreprerfbroqxiancanamqayezgivoiviseiisbeqdaqdqysqsgdcylmylyegy
cufagtygtgkugmihyobkoboqiogklueriereckeqynsmzumzmiymampquhguhuomukarocpscpcuacuotmkxekxkaokecvksfqsfsgcs
pryjbodbobnrbzfahjwpjwjtfjjtcfrebrerztrthedzmnzmzfhzdvgbhuzhuhlvhnjizpclpcprjphlmvfsjfsfdlfrzotnavnanjzn
bnqrvihvivpnvlbspdqtdqdvbdvpunlyflylbplfdwltgrtgthdtqszkcpecpcoscagbikxqkxkugkkudgsfcsfsausuifeanoanagia
ewhcivaivimwiokjaqdmqdqskqimnwgtkgtgemgsapuobwobokaocorswjiwjwqowmctqeruerewcewqvomzgmzmcqmgexmuhsuhuieu
rtaldqfdqdptdbhcjlyrlylvhllvehtgdtgtbvtvjgfbopbobhjbfxidjwbjwjnxjplkbrenrertlrjnoxhulhuhfnhtbqvpcxpcplbp
dpstxkjxkxrpxndurfsvfsfxdfxrwpnahnandrnhfynvitvivjfvsubmergerequecidkmzsmzmwimmwfiuheuhucwuwkhgcpqcpcikc
gyjekxckxkoykqmlcsfosfsumskopyivmivigoiucrwqdyqdqmcqeqtuylkylysqyoevsgtwgtgyegysxqobioboesoigzowjuwjwkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: submergereque
Cipher: fhozretrerdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: submergereque
Cipher: 34542123512422512451145451

Extended Methods:
Method #1

Plaintext: submergereque
method variations:
xzgrkwmkwkvzkcemwpbrpbpaephkrbugwugufkunpwgzmbzmzlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s u b m e r g e r e q u e 
3 5 2 2 5 2 2 5 2 5 1 5 5 
4 4 1 3 1 4 2 1 4 1 4 4 1 
They are then read out in rows:
35225225251554413142141441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: submergereque
Cipher: xgkwwvudciqqd

Read more ...
Method #3

Plaintext: submergereque
method variations:
yifxfiwfyayyl ifxfiwfyayyly fxfiwfyayylyi
xfiwfyayylyif fiwfyayylyifx iwfyayylyifxf
wfyayylyifxfi fyayylyifxfiw yayylyifxfiwf
ayylyifxfiwfy yylyifxfiwfya ylyifxfiwfyay
lyifxfiwfyayy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: submergereque

first 5040 cipher variations(6187239489 total)
submergereque submergereqeu submergereuqe submergereueq submergereeuq submergereequ submergerqeue submergerqeeu submergerquee
submergerquee submergerqeue submergerqeeu submergeruqee submergeruqee submergerueqe submergerueeq submergerueeq submergerueqe
submergereque submergereqeu submergereuqe submergereueq submergereeuq submergereequ submergeerque submergeerqeu submergeeruqe
submergeerueq submergeereuq submergeerequ submergeeqrue submergeeqreu submergeequre submergeequer submergeeqeur submergeeqeru
submergeeuqre submergeeuqer submergeeurqe submergeeureq submergeeuerq submergeeueqr submergeeequr submergeeeqru submergeeeuqr
submergeeeurq submergeeeruq submergeeerqu submergeqerue submergeqereu submergeqeure submergeqeuer submergeqeeur submergeqeeru
submergeqreue submergeqreeu submergeqruee submergeqruee submergeqreue submergeqreeu submergequree submergequree submergequere
submergequeer submergequeer submergequere submergeqerue submergeqereu submergeqeure submergeqeuer submergeqeeur submergeqeeru
submergeueqre submergeueqer submergeuerqe submergeuereq submergeueerq submergeueeqr submergeuqere submergeuqeer submergeuqree
submergeuqree submergeuqere submergeuqeer submergeurqee submergeurqee submergeureqe submergeureeq submergeureeq submergeureqe
submergeueqre submergeueqer submergeuerqe submergeuereq submergeueerq submergeueeqr submergeeequr submergeeeqru submergeeeuqr
submergeeeurq submergeeeruq submergeeerqu submergeeqeur submergeeqeru submergeequer submergeequre submergeeqrue submergeeqreu
submergeeuqer submergeeuqre submergeeueqr submergeeuerq submergeeureq submergeeurqe submergeerque submergeerqeu submergeeruqe
submergeerueq submergeereuq submergeerequ submergreeque submergreeqeu submergreeuqe submergreeueq submergreeeuq submergreeequ
submergreqeue submergreqeeu submergrequee submergrequee submergreqeue submergreqeeu submergreuqee submergreuqee submergreueqe
submergreueeq submergreueeq submergreueqe submergreeque submergreeqeu submergreeuqe submergreeueq submergreeeuq submergreeequ
submergreeque submergreeqeu submergreeuqe submergreeueq submergreeeuq submergreeequ submergreqeue submergreqeeu submergrequee
submergrequee submergreqeue submergreqeeu submergreuqee submergreuqee submergreueqe submergreueeq submergreueeq submergreueqe
submergreeque submergreeqeu submergreeuqe submergreeueq submergreeeuq submergreeequ submergrqeeue submergrqeeeu submergrqeuee
submergrqeuee submergrqeeue submergrqeeeu submergrqeeue submergrqeeeu submergrqeuee submergrqeuee submergrqeeue submergrqeeeu
submergrqueee submergrqueee submergrqueee submergrqueee submergrqueee submergrqueee submergrqeeue submergrqeeeu submergrqeuee
submergrqeuee submergrqeeue submergrqeeeu submergrueqee submergrueqee submergrueeqe submergrueeeq submergrueeeq submergrueeqe
submergruqeee submergruqeee submergruqeee submergruqeee submergruqeee submergruqeee submergrueqee submergrueqee submergrueeqe
submergrueeeq submergrueeeq submergrueeqe submergrueqee submergrueqee submergrueeqe submergrueeeq submergrueeeq submergrueeqe
submergreeque submergreeqeu submergreeuqe submergreeueq submergreeeuq submergreeequ submergreqeue submergreqeeu submergrequee
submergrequee submergreqeue submergreqeeu submergreuqee submergreuqee submergreueqe submergreueeq submergreueeq submergreueqe
submergreeque submergreeqeu submergreeuqe submergreeueq submergreeeuq submergreeequ submergereque submergereqeu submergereuqe
submergereueq submergereeuq submergereequ submergerqeue submergerqeeu submergerquee submergerquee submergerqeue submergerqeeu
submergeruqee submergeruqee submergerueqe submergerueeq submergerueeq submergerueqe submergereque submergereqeu submergereuqe
submergereueq submergereeuq submergereequ submergeerque submergeerqeu submergeeruqe submergeerueq submergeereuq submergeerequ
submergeeqrue submergeeqreu submergeequre submergeequer submergeeqeur submergeeqeru submergeeuqre submergeeuqer submergeeurqe
submergeeureq submergeeuerq submergeeueqr submergeeequr submergeeeqru submergeeeuqr submergeeeurq submergeeeruq submergeeerqu
submergeqerue submergeqereu submergeqeure submergeqeuer submergeqeeur submergeqeeru submergeqreue submergeqreeu submergeqruee
submergeqruee submergeqreue submergeqreeu submergequree submergequree submergequere submergequeer submergequeer submergequere
submergeqerue submergeqereu submergeqeure submergeqeuer submergeqeeur submergeqeeru submergeueqre submergeueqer submergeuerqe
submergeuereq submergeueerq submergeueeqr submergeuqere submergeuqeer submergeuqree submergeuqree submergeuqere submergeuqeer
submergeurqee submergeurqee submergeureqe submergeureeq submergeureeq submergeureqe submergeueqre submergeueqer submergeuerqe
submergeuereq submergeueerq submergeueeqr submergeeequr submergeeeqru submergeeeuqr submergeeeurq submergeeeruq submergeeerqu
submergeeqeur submergeeqeru submergeequer submergeequre submergeeqrue submergeeqreu submergeeuqer submergeeuqre submergeeueqr
submergeeuerq submergeeureq submergeeurqe submergeerque submergeerqeu submergeeruqe submergeerueq submergeereuq submergeerequ
submergqreeue submergqreeeu submergqreuee submergqreuee submergqreeue submergqreeeu submergqreeue submergqreeeu submergqreuee
submergqreuee submergqreeue submergqreeeu submergqrueee submergqrueee submergqrueee submergqrueee submergqrueee submergqrueee
submergqreeue submergqreeeu submergqreuee submergqreuee submergqreeue submergqreeeu submergqereue submergqereeu submergqeruee
submergqeruee submergqereue submergqereeu submergqeerue submergqeereu submergqeeure submergqeeuer submergqeeeur submergqeeeru
submergqeuere submergqeueer submergqeuree submergqeuree submergqeuere submergqeueer submergqeeeur submergqeeeru submergqeeuer
submergqeeure submergqeerue submergqeereu submergqeerue submergqeereu submergqeeure submergqeeuer submergqeeeur submergqeeeru
submergqereue submergqereeu submergqeruee submergqeruee submergqereue submergqereeu submergqeuree submergqeuree submergqeuere
submergqeueer submergqeueer submergqeuere submergqeerue submergqeereu submergqeeure submergqeeuer submergqeeeur submergqeeeru
submergqueere submergqueeer submergqueree submergqueree submergqueere submergqueeer submergqueere submergqueeer submergqueree
submergqueree submergqueere submergqueeer submergqureee submergqureee submergqureee submergqureee submergqureee submergqureee
submergqueere submergqueeer submergqueree submergqueree submergqueere submergqueeer submergqeeeur submergqeeeru submergqeeuer
submergqeeure submergqeerue submergqeereu submergqeeeur submergqeeeru submergqeeuer submergqeeure submergqeerue submergqeereu
submergqeueer submergqeuere submergqeueer submergqeuere submergqeuree submergqeuree submergqereue submergqereeu submergqeruee
submergqeruee submergqereue submergqereeu submergureqee submergureqee submergureeqe submergureeeq submergureeeq submergureeqe
submergurqeee submergurqeee submergurqeee submergurqeee submergurqeee submergurqeee submergureqee submergureqee submergureeqe
submergureeeq submergureeeq submergureeqe submergureqee submergureqee submergureeqe submergureeeq submergureeeq submergureeqe
submerguerqee submerguerqee submerguereqe submerguereeq submerguereeq submerguereqe submergueqree submergueqree submergueqere
submergueqeer submergueqeer submergueqere submergueeqre submergueeqer submergueerqe submergueereq submergueeerq submergueeeqr
submergueeqer submergueeqre submergueeeqr submergueeerq submergueereq submergueerqe submerguqeree submerguqeree submerguqeere
submerguqeeer submerguqeeer submerguqeere submerguqreee submerguqreee submerguqreee submerguqreee submerguqreee submerguqreee
submerguqeree submerguqeree submerguqeere submerguqeeer submerguqeeer submerguqeere submerguqeree submerguqeree submerguqeere
submerguqeeer submerguqeeer submerguqeere submergueeqre submergueeqer submergueerqe submergueereq submergueeerq submergueeeqr
submergueqere submergueqeer submergueqree submergueqree submergueqere submergueqeer submerguerqee submerguerqee submerguereqe
submerguereeq submerguereeq submerguereqe submergueeqre submergueeqer submergueerqe submergueereq submergueeerq submergueeeqr
submergueeqer submergueeqre submergueeeqr submergueeerq submergueereq submergueerqe submergueqeer submergueqere submergueqeer
submergueqere submergueqree submergueqree submergueeqer submergueeqre submergueeeqr submergueeerq submergueereq submergueerqe
submerguerqee submerguerqee submerguereqe submerguereeq submerguereeq submerguereqe submergereque submergereqeu submergereuqe
submergereueq submergereeuq submergereequ submergerqeue submergerqeeu submergerquee submergerquee submergerqeue submergerqeeu
submergeruqee submergeruqee submergerueqe submergerueeq submergerueeq submergerueqe submergereque submergereqeu submergereuqe
submergereueq submergereeuq submergereequ submergeerque submergeerqeu submergeeruqe submergeerueq submergeereuq submergeerequ
submergeeqrue submergeeqreu submergeequre submergeequer submergeeqeur submergeeqeru submergeeuqre submergeeuqer submergeeurqe
submergeeureq submergeeuerq submergeeueqr submergeeequr submergeeeqru submergeeeuqr submergeeeurq submergeeeruq submergeeerqu
submergeqerue submergeqereu submergeqeure submergeqeuer submergeqeeur submergeqeeru submergeqreue submergeqreeu submergeqruee
submergeqruee submergeqreue submergeqreeu submergequree submergequree submergequere submergequeer submergequeer submergequere
submergeqerue submergeqereu submergeqeure submergeqeuer submergeqeeur submergeqeeru submergeueqre submergeueqer submergeuerqe
submergeuereq submergeueerq submergeueeqr submergeuqere submergeuqeer submergeuqree submergeuqree submergeuqere submergeuqeer
submergeurqee submergeurqee submergeureqe submergeureeq submergeureeq submergeureqe submergeueqre submergeueqer submergeuerqe
submergeuereq submergeueerq submergeueeqr submergeeequr submergeeeqru submergeeeuqr submergeeeurq submergeeeruq submergeeerqu
submergeeqeur submergeeqeru submergeequer submergeequre submergeeqrue submergeeqreu submergeeuqer submergeeuqre submergeeueqr
submergeeuerq submergeeureq submergeeurqe submergeerque submergeerqeu submergeeruqe submergeerueq submergeereuq submergeerequ
submeregreque submeregreqeu submeregreuqe submeregreueq submeregreeuq submeregreequ submeregrqeue submeregrqeeu submeregrquee
submeregrquee submeregrqeue submeregrqeeu submeregruqee submeregruqee submeregrueqe submeregrueeq submeregrueeq submeregrueqe
submeregreque submeregreqeu submeregreuqe submeregreueq submeregreeuq submeregreequ submeregerque submeregerqeu submeregeruqe
submeregerueq submeregereuq submeregerequ submeregeqrue submeregeqreu submeregequre submeregequer submeregeqeur submeregeqeru
submeregeuqre submeregeuqer submeregeurqe submeregeureq submeregeuerq submeregeueqr submeregeequr submeregeeqru submeregeeuqr
submeregeeurq submeregeeruq submeregeerqu submeregqerue submeregqereu submeregqeure submeregqeuer submeregqeeur submeregqeeru
submeregqreue submeregqreeu submeregqruee submeregqruee submeregqreue submeregqreeu submeregquree submeregquree submeregquere
submeregqueer submeregqueer submeregquere submeregqerue submeregqereu submeregqeure submeregqeuer submeregqeeur submeregqeeru
submeregueqre submeregueqer submereguerqe submereguereq submeregueerq submeregueeqr submereguqere submereguqeer submereguqree
submereguqree submereguqere submereguqeer submeregurqee submeregurqee submeregureqe submeregureeq submeregureeq submeregureqe
submeregueqre submeregueqer submereguerqe submereguereq submeregueerq submeregueeqr submeregeequr submeregeeqru submeregeeuqr
submeregeeurq submeregeeruq submeregeerqu submeregeqeur submeregeqeru submeregequer submeregequre submeregeqrue submeregeqreu
submeregeuqer submeregeuqre submeregeueqr submeregeuerq submeregeureq submeregeurqe submeregerque submeregerqeu submeregeruqe
submeregerueq submeregereuq submeregerequ submerergeque submerergeqeu submerergeuqe submerergeueq submerergeeuq submerergeequ
submerergqeue submerergqeeu submerergquee submerergquee submerergqeue submerergqeeu submererguqee submererguqee submerergueqe
submerergueeq submerergueeq submerergueqe submerergeque submerergeqeu submerergeuqe submerergeueq submerergeeuq submerergeequ
submereregque submereregqeu submerereguqe submereregueq submereregeuq submereregequ submerereqgue submerereqgeu submererequge
submererequeg submerereqeug submerereqegu submerereuqge submerereuqeg submerereugqe submerereugeq submerereuegq submerereueqg
submerereequg submerereeqgu submerereeuqg submerereeugq submerereeguq submerereegqu submererqegue submererqegeu submererqeuge
submererqeueg submererqeeug submererqeegu submererqgeue submererqgeeu submererqguee submererqguee submererqgeue submererqgeeu
submererqugee submererqugee submererquege submererqueeg submererqueeg submererquege submererqegue submererqegeu submererqeuge
submererqeueg submererqeeug submererqeegu submererueqge submererueqeg submereruegqe submereruegeq submererueegq submererueeqg
submereruqege submereruqeeg submereruqgee submereruqgee submereruqege submereruqeeg submererugqee submererugqee submererugeqe
submererugeeq submererugeeq submererugeqe submererueqge submererueqeg submereruegqe submereruegeq submererueegq submererueeqg
submerereequg submerereeqgu submerereeuqg submerereeugq submerereeguq submerereegqu submerereqeug submerereqegu submererequeg
submererequge submerereqgue submerereqgeu submerereuqeg submerereuqge submerereueqg submerereuegq submerereugeq submerereugqe
submereregque submereregqeu submerereguqe submereregueq submereregeuq submereregequ submereergque submereergqeu submereerguqe
submereergueq submereergeuq submereergequ submereerqgue submereerqgeu submereerquge submereerqueg submereerqeug submereerqegu
submereeruqge submereeruqeg submereerugqe submereerugeq submereeruegq submereerueqg submereerequg submereereqgu submereereuqg
submereereugq submereereguq submereeregqu submereegrque submereegrqeu submereegruqe submereegrueq submereegreuq submereegrequ
submereegqrue submereegqreu submereegqure submereegquer submereegqeur submereegqeru submereeguqre submereeguqer submereegurqe
submereegureq submereeguerq submereegueqr submereegequr submereegeqru submereegeuqr submereegeurq submereegeruq submereegerqu
submereeqgrue submereeqgreu submereeqgure submereeqguer submereeqgeur submereeqgeru submereeqrgue submereeqrgeu submereeqruge
submereeqrueg submereeqreug submereeqregu submereequrge submereequreg submereequgre submereequger submereequegr submereequerg
submereeqerug submereeqergu submereeqeurg submereeqeugr submereeqegur submereeqegru submereeugqre submereeugqer submereeugrqe
submereeugreq submereeugerq submereeugeqr submereeuqgre submereeuqger submereeuqrge submereeuqreg submereeuqerg submereeuqegr
submereeurqge submereeurqeg submereeurgqe submereeurgeq submereeuregq submereeureqg submereeueqrg submereeueqgr submereeuerqg
submereeuergq submereeuegrq submereeuegqr submereeegqur submereeegqru submereeeguqr submereeegurq submereeegruq submereeegrqu
submereeeqgur submereeeqgru submereeequgr submereeequrg submereeeqrug submereeeqrgu submereeeuqgr submereeeuqrg submereeeugqr
submereeeugrq submereeeurgq submereeeurqg submereeerqug submereeerqgu submereeeruqg submereeerugq submereeerguq submereeergqu
submereqregue submereqregeu submereqreuge submereqreueg submereqreeug submereqreegu submereqrgeue submereqrgeeu submereqrguee
submereqrguee submereqrgeue submereqrgeeu submereqrugee submereqrugee submereqruege submereqrueeg submereqrueeg submereqruege
submereqregue submereqregeu submereqreuge submereqreueg submereqreeug submereqreegu submereqergue submereqergeu submereqeruge
submereqerueg submereqereug submereqeregu submereqegrue submereqegreu submereqegure submereqeguer submereqegeur submereqegeru
submereqeugre submereqeuger submereqeurge submereqeureg submereqeuerg submereqeuegr submereqeegur submereqeegru submereqeeugr
submereqeeurg submereqeerug submereqeergu submereqgerue submereqgereu submereqgeure submereqgeuer submereqgeeur submereqgeeru
submereqgreue submereqgreeu submereqgruee submereqgruee submereqgreue submereqgreeu submereqguree submereqguree submereqguere
submereqgueer submereqgueer submereqguere submereqgerue submereqgereu submereqgeure submereqgeuer submereqgeeur submereqgeeru
submerequegre submerequeger submerequerge submerequereg submerequeerg submerequeegr submerequgere submerequgeer submerequgree
submerequgree submerequgere submerequgeer submerequrgee submerequrgee submerequrege submerequreeg submerequreeg submerequrege
submerequegre submerequeger submerequerge submerequereg submerequeerg submerequeegr submereqeegur submereqeegru submereqeeugr
submereqeeurg submereqeerug submereqeergu submereqegeur submereqegeru submereqeguer submereqegure submereqegrue submereqegreu
submereqeuger submereqeugre submereqeuegr submereqeuerg submereqeureg submereqeurge submereqergue submereqergeu submereqeruge
submereqerueg submereqereug submereqeregu submereureqge submereureqeg submereuregqe submereuregeq submereureegq submereureeqg
submereurqege submereurqeeg submereurqgee submereurqgee submereurqege submereurqeeg submereurgqee submereurgqee submereurgeqe
submereurgeeq submereurgeeq submereurgeqe submereureqge submereureqeg submereuregqe submereuregeq submereureegq submereureeqg
submereuerqge submereuerqeg submereuergqe submereuergeq submereueregq submereuereqg submereueqrge submereueqreg submereueqgre
submereueqger submereueqegr submereueqerg submereuegqre submereuegqer submereuegrqe submereuegreq submereuegerq submereuegeqr
submereueeqgr submereueeqrg submereueegqr submereueegrq submereueergq submereueerqg submereuqerge submereuqereg submereuqegre
submereuqeger submereuqeegr submereuqeerg submereuqrege submereuqreeg submereuqrgee submereuqrgee submereuqrege submereuqreeg
submereuqgree submereuqgree submereuqgere submereuqgeer submereuqgeer submereuqgere submereuqerge submereuqereg submereuqegre
submereuqeger submereuqeegr submereuqeerg submereugeqre submereugeqer submereugerqe submereugereq submereugeerq submereugeeqr
submereugqere submereugqeer submereugqree submereugqree submereugqere submereugqeer submereugrqee submereugrqee submereugreqe
submereugreeq submereugreeq submereugreqe submereugeqre submereugeqer submereugerqe submereugereq submereugeerq submereugeeqr
submereueeqgr submereueeqrg submereueegqr submereueegrq submereueergq submereueerqg submereueqegr submereueqerg submereueqger
submereueqgre submereueqrge submereueqreg submereuegqer submereuegqre submereuegeqr submereuegerq submereuegreq submereuegrqe
submereuerqge submereuerqeg submereuergqe submereuergeq submereueregq submereuereqg submereerequg submereereqgu submereereuqg
submereereugq submereereguq submereeregqu submereerqeug submereerqegu submereerqueg submereerquge submereerqgue submereerqgeu
submereeruqeg submereeruqge submereerueqg submereeruegq submereerugeq submereerugqe submereergque submereergqeu submereerguqe
submereergueq submereergeuq submereergequ submereeerqug submereeerqgu submereeeruqg submereeerugq submereeerguq submereeergqu
submereeeqrug submereeeqrgu submereeequrg submereeequgr submereeeqgur submereeeqgru submereeeuqrg submereeeuqgr submereeeurqg
submereeeurgq submereeeugrq submereeeugqr submereeegqur submereeegqru submereeeguqr submereeegurq submereeegruq submereeegrqu
submereeqerug submereeqergu submereeqeurg submereeqeugr submereeqegur submereeqegru submereeqreug submereeqregu submereeqrueg
submereeqruge submereeqrgue submereeqrgeu submereequreg submereequrge submereequerg submereequegr submereequger submereequgre
submereeqgrue submereeqgreu submereeqgure submereeqguer submereeqgeur submereeqgeru submereeueqrg submereeueqgr submereeuerqg
submereeuergq submereeuegrq submereeuegqr submereeuqerg submereeuqegr submereeuqreg submereeuqrge submereeuqgre submereeuqger
submereeurqeg submereeurqge submereeureqg submereeuregq submereeurgeq submereeurgqe submereeugqre submereeugqer submereeugrqe
submereeugreq submereeugerq submereeugeqr submereegequr submereegeqru submereegeuqr submereegeurq submereegeruq submereegerqu
submereegqeur submereegqeru submereegquer submereegqure submereegqrue submereegqreu submereeguqer submereeguqre submereegueqr
submereeguerq submereegureq submereegurqe submereegrque submereegrqeu submereegruqe submereegrueq submereegreuq submereegrequ
submerregeque submerregeqeu submerregeuqe submerregeueq submerregeeuq submerregeequ submerregqeue submerregqeeu submerregquee
submerregquee submerregqeue submerregqeeu submerreguqee submerreguqee submerregueqe submerregueeq submerregueeq submerregueqe
submerregeque submerregeqeu submerregeuqe submerregeueq submerregeeuq submerregeequ submerreegque submerreegqeu submerreeguqe
submerreegueq submerreegeuq submerreegequ submerreeqgue submerreeqgeu submerreequge submerreequeg submerreeqeug submerreeqegu
submerreeuqge submerreeuqeg submerreeugqe submerreeugeq submerreeuegq submerreeueqg submerreeequg submerreeeqgu submerreeeuqg
submerreeeugq submerreeeguq submerreeegqu submerreqegue submerreqegeu submerreqeuge submerreqeueg submerreqeeug submerreqeegu
submerreqgeue submerreqgeeu submerreqguee submerreqguee submerreqgeue submerreqgeeu submerrequgee submerrequgee submerrequege
submerrequeeg submerrequeeg submerrequege submerreqegue submerreqegeu submerreqeuge submerreqeueg submerreqeeug submerreqeegu
submerreueqge submerreueqeg submerreuegqe submerreuegeq submerreueegq submerreueeqg submerreuqege submerreuqeeg submerreuqgee
submerreuqgee submerreuqege submerreuqeeg submerreugqee submerreugqee submerreugeqe submerreugeeq submerreugeeq submerreugeqe
submerreueqge submerreueqeg submerreuegqe submerreuegeq submerreueegq submerreueeqg submerreeequg submerreeeqgu submerreeeuqg
submerreeeugq submerreeeguq submerreeegqu submerreeqeug submerreeqegu submerreequeg submerreequge submerreeqgue submerreeqgeu
submerreeuqeg submerreeuqge submerreeueqg submerreeuegq submerreeugeq submerreeugqe submerreegque submerreegqeu submerreeguqe
submerreegueq submerreegeuq submerreegequ submerrgeeque submerrgeeqeu submerrgeeuqe submerrgeeueq submerrgeeeuq submerrgeeequ
submerrgeqeue submerrgeqeeu submerrgequee submerrgequee submerrgeqeue submerrgeqeeu submerrgeuqee submerrgeuqee submerrgeueqe
submerrgeueeq submerrgeueeq submerrgeueqe submerrgeeque submerrgeeqeu submerrgeeuqe submerrgeeueq submerrgeeeuq submerrgeeequ
submerrgeeque submerrgeeqeu submerrgeeuqe submerrgeeueq submerrgeeeuq submerrgeeequ submerrgeqeue submerrgeqeeu submerrgequee
submerrgequee submerrgeqeue submerrgeqeeu submerrgeuqee submerrgeuqee submerrgeueqe submerrgeueeq submerrgeueeq submerrgeueqe
submerrgeeque submerrgeeqeu submerrgeeuqe submerrgeeueq submerrgeeeuq submerrgeeequ submerrgqeeue submerrgqeeeu submerrgqeuee
submerrgqeuee submerrgqeeue submerrgqeeeu submerrgqeeue submerrgqeeeu submerrgqeuee submerrgqeuee submerrgqeeue submerrgqeeeu
submerrgqueee submerrgqueee submerrgqueee submerrgqueee submerrgqueee submerrgqueee submerrgqeeue submerrgqeeeu submerrgqeuee
submerrgqeuee submerrgqeeue submerrgqeeeu submerrgueqee submerrgueqee submerrgueeqe submerrgueeeq submerrgueeeq submerrgueeqe
submerrguqeee submerrguqeee submerrguqeee submerrguqeee submerrguqeee submerrguqeee submerrgueqee submerrgueqee submerrgueeqe
submerrgueeeq submerrgueeeq submerrgueeqe submerrgueqee submerrgueqee submerrgueeqe submerrgueeeq submerrgueeeq submerrgueeqe
submerrgeeque submerrgeeqeu submerrgeeuqe submerrgeeueq submerrgeeeuq submerrgeeequ submerrgeqeue submerrgeqeeu submerrgequee
submerrgequee submerrgeqeue submerrgeqeeu submerrgeuqee submerrgeuqee submerrgeueqe submerrgeueeq submerrgeueeq submerrgeueqe
submerrgeeque submerrgeeqeu submerrgeeuqe submerrgeeueq submerrgeeeuq submerrgeeequ submerregeque submerregeqeu submerregeuqe
submerregeueq submerregeeuq submerregeequ submerregqeue submerregqeeu submerregquee submerregquee submerregqeue submerregqeeu
submerreguqee submerreguqee submerregueqe submerregueeq submerregueeq submerregueqe submerregeque submerregeqeu submerregeuqe
submerregeueq submerregeeuq submerregeequ submerreegque submerreegqeu submerreeguqe submerreegueq submerreegeuq submerreegequ
submerreeqgue submerreeqgeu submerreequge submerreequeg submerreeqeug submerreeqegu submerreeuqge submerreeuqeg submerreeugqe
submerreeugeq submerreeuegq submerreeueqg submerreeequg submerreeeqgu submerreeeuqg submerreeeugq submerreeeguq submerreeegqu
submerreqegue submerreqegeu submerreqeuge submerreqeueg submerreqeeug submerreqeegu submerreqgeue submerreqgeeu submerreqguee
submerreqguee submerreqgeue submerreqgeeu submerrequgee submerrequgee submerrequege submerrequeeg submerrequeeg submerrequege
submerreqegue submerreqegeu submerreqeuge submerreqeueg submerreqeeug submerreqeegu submerreueqge submerreueqeg submerreuegqe
submerreuegeq submerreueegq submerreueeqg submerreuqege submerreuqeeg submerreuqgee submerreuqgee submerreuqege submerreuqeeg
submerreugqee submerreugqee submerreugeqe submerreugeeq submerreugeeq submerreugeqe submerreueqge submerreueqeg submerreuegqe
submerreuegeq submerreueegq submerreueeqg submerreeequg submerreeeqgu submerreeeuqg submerreeeugq submerreeeguq submerreeegqu
submerreeqeug submerreeqegu submerreequeg submerreequge submerreeqgue submerreeqgeu submerreeuqeg submerreeuqge submerreeueqg
submerreeuegq submerreeugeq submerreeugqe submerreegque submerreegqeu submerreeguqe submerreegueq submerreegeuq submerreegequ
submerrqgeeue submerrqgeeeu submerrqgeuee submerrqgeuee submerrqgeeue submerrqgeeeu submerrqgeeue submerrqgeeeu submerrqgeuee
submerrqgeuee submerrqgeeue submerrqgeeeu submerrqgueee submerrqgueee submerrqgueee submerrqgueee submerrqgueee submerrqgueee
submerrqgeeue submerrqgeeeu submerrqgeuee submerrqgeuee submerrqgeeue submerrqgeeeu submerrqegeue submerrqegeeu submerrqeguee
submerrqeguee submerrqegeue submerrqegeeu submerrqeegue submerrqeegeu submerrqeeuge submerrqeeueg submerrqeeeug submerrqeeegu
submerrqeuege submerrqeueeg submerrqeugee submerrqeugee submerrqeuege submerrqeueeg submerrqeeeug submerrqeeegu submerrqeeueg
submerrqeeuge submerrqeegue submerrqeegeu submerrqeegue submerrqeegeu submerrqeeuge submerrqeeueg submerrqeeeug submerrqeeegu
submerrqegeue submerrqegeeu submerrqeguee submerrqeguee submerrqegeue submerrqegeeu submerrqeugee submerrqeugee submerrqeuege
submerrqeueeg submerrqeueeg submerrqeuege submerrqeegue submerrqeegeu submerrqeeuge submerrqeeueg submerrqeeeug submerrqeeegu
submerrqueege submerrqueeeg submerrquegee submerrquegee submerrqueege submerrqueeeg submerrqueege submerrqueeeg submerrquegee
submerrquegee submerrqueege submerrqueeeg submerrqugeee submerrqugeee submerrqugeee submerrqugeee submerrqugeee submerrqugeee
submerrqueege submerrqueeeg submerrquegee submerrquegee submerrqueege submerrqueeeg submerrqeeeug submerrqeeegu submerrqeeueg
submerrqeeuge submerrqeegue submerrqeegeu submerrqeeeug submerrqeeegu submerrqeeueg submerrqeeuge submerrqeegue submerrqeegeu
submerrqeueeg submerrqeuege submerrqeueeg submerrqeuege submerrqeugee submerrqeugee submerrqegeue submerrqegeeu submerrqeguee
submerrqeguee submerrqegeue submerrqegeeu submerrugeqee submerrugeqee submerrugeeqe submerrugeeeq submerrugeeeq submerrugeeqe
submerrugqeee submerrugqeee submerrugqeee submerrugqeee submerrugqeee submerrugqeee submerrugeqee submerrugeqee submerrugeeqe
submerrugeeeq submerrugeeeq submerrugeeqe submerrugeqee submerrugeqee submerrugeeqe submerrugeeeq submerrugeeeq submerrugeeqe
submerruegqee submerruegqee submerruegeqe submerruegeeq submerruegeeq submerruegeqe submerrueqgee submerrueqgee submerrueqege
submerrueqeeg submerrueqeeg submerrueqege submerrueeqge submerrueeqeg submerrueegqe submerrueegeq submerrueeegq submerrueeeqg
submerrueeqeg submerrueeqge submerrueeeqg submerrueeegq submerrueegeq submerrueegqe submerruqegee submerruqegee submerruqeege
submerruqeeeg submerruqeeeg submerruqeege submerruqgeee submerruqgeee submerruqgeee submerruqgeee submerruqgeee submerruqgeee
submerruqegee submerruqegee submerruqeege submerruqeeeg submerruqeeeg submerruqeege submerruqegee submerruqegee submerruqeege
submerruqeeeg submerruqeeeg submerruqeege submerrueeqge submerrueeqeg submerrueegqe submerrueegeq submerrueeegq submerrueeeqg
submerrueqege submerrueqeeg submerrueqgee submerrueqgee submerrueqege submerrueqeeg submerruegqee submerruegqee submerruegeqe
submerruegeeq submerruegeeq submerruegeqe submerrueeqge submerrueeqeg submerrueegqe submerrueegeq submerrueeegq submerrueeeqg
submerrueeqeg submerrueeqge submerrueeeqg submerrueeegq submerrueegeq submerrueegqe submerrueqeeg submerrueqege submerrueqeeg
submerrueqege submerrueqgee submerrueqgee submerrueeqeg submerrueeqge submerrueeeqg submerrueeegq submerrueegeq submerrueegqe
submerruegqee submerruegqee submerruegeqe submerruegeeq submerruegeeq submerruegeqe submerregeque submerregeqeu submerregeuqe
submerregeueq submerregeeuq submerregeequ submerregqeue submerregqeeu submerregquee submerregquee submerregqeue submerregqeeu
submerreguqee submerreguqee submerregueqe submerregueeq submerregueeq submerregueqe submerregeque submerregeqeu submerregeuqe
submerregeueq submerregeeuq submerregeequ submerreegque submerreegqeu submerreeguqe submerreegueq submerreegeuq submerreegequ
submerreeqgue submerreeqgeu submerreequge submerreequeg submerreeqeug submerreeqegu submerreeuqge submerreeuqeg submerreeugqe
submerreeugeq submerreeuegq submerreeueqg submerreeequg submerreeeqgu submerreeeuqg submerreeeugq submerreeeguq submerreeegqu
submerreqegue submerreqegeu submerreqeuge submerreqeueg submerreqeeug submerreqeegu submerreqgeue submerreqgeeu submerreqguee
submerreqguee submerreqgeue submerreqgeeu submerrequgee submerrequgee submerrequege submerrequeeg submerrequeeg submerrequege
submerreqegue submerreqegeu submerreqeuge submerreqeueg submerreqeeug submerreqeegu submerreueqge submerreueqeg submerreuegqe
submerreuegeq submerreueegq submerreueeqg submerreuqege submerreuqeeg submerreuqgee submerreuqgee submerreuqege submerreuqeeg
submerreugqee submerreugqee submerreugeqe submerreugeeq submerreugeeq submerreugeqe submerreueqge submerreueqeg submerreuegqe
submerreuegeq submerreueegq submerreueeqg submerreeequg submerreeeqgu submerreeeuqg submerreeeugq submerreeeguq submerreeegqu
submerreeqeug submerreeqegu submerreequeg submerreequge submerreeqgue submerreeqgeu submerreeuqeg submerreeuqge submerreeueqg
submerreeuegq submerreeugeq submerreeugqe submerreegque submerreegqeu submerreeguqe submerreegueq submerreegeuq submerreegequ
submereergque submereergqeu submereerguqe submereergueq submereergeuq submereergequ submereerqgue submereerqgeu submereerquge
submereerqueg submereerqeug submereerqegu submereeruqge submereeruqeg submereerugqe submereerugeq submereeruegq submereerueqg
submereerequg submereereqgu submereereuqg submereereugq submereereguq submereeregqu submereegrque submereegrqeu submereegruqe
submereegrueq submereegreuq submereegrequ submereegqrue submereegqreu submereegqure submereegquer submereegqeur submereegqeru
submereeguqre submereeguqer submereegurqe submereegureq submereeguerq submereegueqr submereegequr submereegeqru submereegeuqr
submereegeurq submereegeruq submereegerqu submereeqgrue submereeqgreu submereeqgure submereeqguer submereeqgeur submereeqgeru
submereeqrgue submereeqrgeu submereeqruge submereeqrueg submereeqreug submereeqregu submereequrge submereequreg submereequgre
submereequger submereequegr submereequerg submereeqerug submereeqergu submereeqeurg submereeqeugr submereeqegur submereeqegru
submereeugqre submereeugqer submereeugrqe submereeugreq submereeugerq submereeugeqr submereeuqgre submereeuqger submereeuqrge
submereeuqreg submereeuqerg submereeuqegr submereeurqge submereeurqeg submereeurgqe submereeurgeq submereeuregq submereeureqg
submereeueqrg submereeueqgr submereeuerqg submereeuergq submereeuegrq submereeuegqr submereeegqur submereeegqru submereeeguqr
submereeegurq submereeegruq submereeegrqu submereeeqgur submereeeqgru submereeequgr submereeequrg submereeeqrug submereeeqrgu
submereeeuqgr submereeeuqrg submereeeugqr submereeeugrq submereeeurgq submereeeurqg submereeerqug submereeerqgu submereeeruqg
submereeerugq submereeerguq submereeergqu submereregque submereregqeu submerereguqe submereregueq submereregeuq submereregequ
submerereqgue submerereqgeu submererequge submererequeg submerereqeug submerereqegu submerereuqge submerereuqeg submerereugqe
submerereugeq submerereuegq submerereueqg submerereequg submerereeqgu submerereeuqg submerereeugq submerereeguq submerereegqu
submerergeque submerergeqeu submerergeuqe submerergeueq submerergeeuq submerergeequ submerergqeue submerergqeeu submerergquee
submerergquee submerergqeue submerergqeeu submererguqee submererguqee submerergueqe submerergueeq submerergueeq submerergueqe
submerergeque submerergeqeu submerergeuqe submerergeueq submerergeeuq submerergeequ submererqgeue submererqgeeu submererqguee
submererqguee submererqgeue submererqgeeu submererqegue submererqegeu submererqeuge submererqeueg submererqeeug submererqeegu
submererquege submererqueeg submererqugee submererqugee submererquege submererqueeg submererqeeug submererqeegu submererqeueg
submererqeuge submererqegue submererqegeu submererugqee submererugqee submererugeqe submererugeeq submererugeeq submererugeqe
submereruqgee submereruqgee submereruqege submereruqeeg submereruqeeg submereruqege submererueqge submererueqeg submereruegqe
submereruegeq submererueegq submererueeqg submererueqeg submererueqge submererueeqg submererueegq submereruegeq submereruegqe
submereregque submereregqeu submerereguqe submereregueq submereregeuq submereregequ submerereqgue submerereqgeu submererequge
submererequeg submerereqeug submerereqegu submerereuqge submerereuqeg submerereugqe submerereugeq submerereuegq submerereueqg
submerereequg submerereeqgu submerereeuqg submerereeugq submerereeguq submerereegqu submeregreque submeregreqeu submeregreuqe
submeregreueq submeregreeuq submeregreequ submeregrqeue submeregrqeeu submeregrquee submeregrquee submeregrqeue submeregrqeeu
submeregruqee submeregruqee submeregrueqe submeregrueeq submeregrueeq submeregrueqe submeregreque submeregreqeu submeregreuqe
submeregreueq submeregreeuq submeregreequ submeregerque submeregerqeu submeregeruqe submeregerueq submeregereuq submeregerequ
submeregeqrue submeregeqreu submeregequre submeregequer submeregeqeur submeregeqeru submeregeuqre submeregeuqer submeregeurqe
submeregeureq submeregeuerq submeregeueqr submeregeequr submeregeeqru submeregeeuqr submeregeeurq submeregeeruq submeregeerqu
submeregqerue submeregqereu submeregqeure submeregqeuer submeregqeeur submeregqeeru submeregqreue submeregqreeu submeregqruee
submeregqruee submeregqreue submeregqreeu submeregquree submeregquree submeregquere submeregqueer submeregqueer submeregquere
submeregqerue submeregqereu submeregqeure submeregqeuer submeregqeeur submeregqeeru submeregueqre submeregueqer submereguerqe
submereguereq submeregueerq submeregueeqr submereguqere submereguqeer submereguqree submereguqree submereguqere submereguqeer
submeregurqee submeregurqee submeregureqe submeregureeq submeregureeq submeregureqe submeregueqre submeregueqer submereguerqe
submereguereq submeregueerq submeregueeqr submeregeequr submeregeeqru submeregeeuqr submeregeeurq submeregeeruq submeregeerqu
submeregeqeur submeregeqeru submeregequer submeregequre submeregeqrue submeregeqreu submeregeuqer submeregeuqre submeregeueqr
submeregeuerq submeregeureq submeregeurqe submeregerque submeregerqeu submeregeruqe submeregerueq submeregereuq submeregerequ
submereqrgeue submereqrgeeu submereqrguee submereqrguee submereqrgeue submereqrgeeu submereqregue submereqregeu submereqreuge
submereqreueg submereqreeug submereqreegu submereqruege submereqrueeg submereqrugee submereqrugee submereqruege submereqrueeg
submereqreeug submereqreegu submereqreueg submereqreuge submereqregue submereqregeu submereqgreue submereqgreeu submereqgruee
submereqgruee submereqgreue submereqgreeu submereqgerue submereqgereu submereqgeure submereqgeuer submereqgeeur submereqgeeru
submereqguere submereqgueer submereqguree submereqguree submereqguere submereqgueer submereqgeeur submereqgeeru submereqgeuer
submereqgeure submereqgerue submereqgereu submereqegrue submereqegreu submereqegure submereqeguer submereqegeur submereqegeru
submereqergue submereqergeu submereqeruge submereqerueg submereqereug submereqeregu submereqeurge submereqeureg submereqeugre
submereqeuger submereqeuegr submereqeuerg submereqeerug submereqeergu submereqeeurg submereqeeugr submereqeegur submereqeegru
submerequgere submerequgeer submerequgree submerequgree submerequgere submerequgeer submerequegre submerequeger submerequerge
submerequereg submerequeerg submerequeegr submerequrege submerequreeg submerequrgee submerequrgee submerequrege submerequreeg
submerequeerg submerequeegr submerequereg submerequerge submerequegre submerequeger submereqegeur submereqegeru submereqeguer
submereqegure submereqegrue submereqegreu submereqeegur submereqeegru submereqeeugr submereqeeurg submereqeerug submereqeergu
submereqeuegr submereqeuerg submereqeuger submereqeugre submereqeurge submereqeureg submereqereug submereqeregu submereqerueg
submereqeruge submereqergue submereqergeu submereurgqee submereurgqee submereurgeqe submereurgeeq submereurgeeq submereurgeqe
submereurqgee submereurqgee submereurqege submereurqeeg submereurqeeg submereurqege submereureqge submereureqeg submereuregqe
submereuregeq submereureegq submereureeqg submereureqeg submereureqge submereureeqg submereureegq submereuregeq submereuregqe
submereugrqee submereugrqee submereugreqe submereugreeq submereugreeq submereugreqe submereugqree submereugqree submereugqere
submereugqeer submereugqeer submereugqere submereugeqre submereugeqer submereugerqe submereugereq submereugeerq submereugeeqr
submereugeqer submereugeqre submereugeeqr submereugeerq submereugereq submereugerqe submereuqgree submereuqgree submereuqgere
submereuqgeer submereuqgeer submereuqgere submereuqrgee submereuqrgee submereuqrege submereuqreeg submereuqreeg submereuqrege
submereuqerge submereuqereg submereuqegre submereuqeger submereuqeegr submereuqeerg submereuqereg submereuqerge submereuqeerg
submereuqeegr submereuqeger submereuqegre submereuegqre submereuegqer submereuegrqe submereuegreq submereuegerq submereuegeqr
submereueqgre submereueqger submereueqrge submereueqreg submereueqerg submereueqegr submereuerqge submereuerqeg submereuergqe
submereuergeq submereueregq submereuereqg submereueeqrg submereueeqgr submereueerqg submereueergq submereueegrq submereueegqr
submereuegqer submereuegqre submereuegeqr submereuegerq submereuegreq submereuegrqe submereueqger submereueqgre submereueqegr
submereueqerg submereueqreg submereueqrge submereueeqgr submereueeqrg submereueegqr submereueegrq submereueergq submereueerqg
submereuerqeg submereuerqge submereuereqg submereueregq submereuergeq submereuergqe submereergque submereergqeu submereerguqe
submereergueq submereergeuq submereergequ submereerqgue submereerqgeu submereerquge submereerqueg submereerqeug submereerqegu
submereeruqge submereeruqeg submereerugqe submereerugeq submereeruegq submereerueqg submereerequg submereereqgu submereereuqg
submereereugq submereereguq submereeregqu submereegrque submereegrqeu submereegruqe submereegrueq submereegreuq submereegrequ
submereegqrue submereegqreu submereegqure submereegquer submereegqeur submereegqeru submereeguqre submereeguqer submereegurqe
submereegureq submereeguerq submereegueqr submereegequr submereegeqru submereegeuqr submereegeurq submereegeruq submereegerqu
submereeqgrue submereeqgreu submereeqgure submereeqguer submereeqgeur submereeqgeru submereeqrgue submereeqrgeu submereeqruge
submereeqrueg submereeqreug submereeqregu submereequrge submereequreg submereequgre submereequger submereequegr submereequerg
submereeqerug submereeqergu submereeqeurg submereeqeugr submereeqegur submereeqegru submereeugqre submereeugqer submereeugrqe
submereeugreq submereeugerq submereeugeqr submereeuqgre submereeuqger submereeuqrge submereeuqreg submereeuqerg submereeuqegr
submereeurqge submereeurqeg submereeurgqe submereeurgeq submereeuregq submereeureqg submereeueqrg submereeueqgr submereeuerqg
submereeuergq submereeuegrq submereeuegqr submereeegqur submereeegqru submereeeguqr submereeegurq submereeegruq submereeegrqu
submereeeqgur submereeeqgru submereeequgr submereeequrg submereeeqrug submereeeqrgu submereeeuqgr submereeeuqrg submereeeugqr
submereeeugrq submereeeurgq submereeeurqg submereeerqug submereeerqgu submereeeruqg submereeerugq submereeerguq submereeergqu
submerqeregue submerqeregeu submerqereuge submerqereueg submerqereeug submerqereegu submerqergeue submerqergeeu submerqerguee
submerqerguee submerqergeue submerqergeeu submerqerugee submerqerugee submerqeruege submerqerueeg submerqerueeg submerqeruege
submerqeregue submerqeregeu submerqereuge submerqereueg submerqereeug submerqereegu submerqeergue submerqeergeu submerqeeruge
submerqeerueg submerqeereug submerqeeregu submerqeegrue submerqeegreu submerqeegure submerqeeguer submerqeegeur submerqeegeru
submerqeeugre submerqeeuger submerqeeurge submerqeeureg submerqeeuerg submerqeeuegr submerqeeegur submerqeeegru submerqeeeugr
submerqeeeurg submerqeeerug submerqeeergu submerqegerue submerqegereu submerqegeure submerqegeuer submerqegeeur submerqegeeru
submerqegreue submerqegreeu submerqegruee submerqegruee submerqegreue submerqegreeu submerqeguree submerqeguree submerqeguere
submerqegueer submerqegueer submerqeguere submerqegerue submerqegereu submerqegeure submerqegeuer submerqegeeur submerqegeeru
submerqeuegre submerqeueger submerqeuerge submerqeuereg submerqeueerg submerqeueegr submerqeugere submerqeugeer submerqeugree
submerqeugree submerqeugere submerqeugeer submerqeurgee submerqeurgee submerqeurege submerqeureeg submerqeureeg submerqeurege
submerqeuegre submerqeueger submerqeuerge submerqeuereg submerqeueerg submerqeueegr submerqeeegur submerqeeegru submerqeeeugr
submerqeeeurg submerqeeerug submerqeeergu submerqeegeur submerqeegeru submerqeeguer submerqeegure submerqeegrue submerqeegreu
submerqeeuger submerqeeugre submerqeeuegr submerqeeuerg submerqeeureg submerqeeurge submerqeergue submerqeergeu submerqeeruge
submerqeerueg submerqeereug submerqeeregu submerqreegue submerqreegeu submerqreeuge submerqreeueg submerqreeeug submerqreeegu
submerqregeue submerqregeeu submerqreguee submerqreguee submerqregeue submerqregeeu submerqreugee submerqreugee submerqreuege
submerqreueeg submerqreueeg submerqreuege submerqreegue submerqreegeu submerqreeuge submerqreeueg submerqreeeug submerqreeegu
submerqreegue submerqreegeu submerqreeuge submerqreeueg submerqreeeug submerqreeegu submerqregeue submerqregeeu submerqreguee
submerqreguee submerqregeue submerqregeeu submerqreugee submerqreugee submerqreuege submerqreueeg submerqreueeg submerqreuege
submerqreegue submerqreegeu submerqreeuge submerqreeueg submerqreeeug submerqreeegu submerqrgeeue submerqrgeeeu submerqrgeuee
submerqrgeuee submerqrgeeue submerqrgeeeu submerqrgeeue submerqrgeeeu submerqrgeuee submerqrgeuee submerqrgeeue submerqrgeeeu
submerqrgueee submerqrgueee submerqrgueee submerqrgueee submerqrgueee submerqrgueee submerqrgeeue submerqrgeeeu submerqrgeuee
submerqrgeuee submerqrgeeue submerqrgeeeu submerqruegee submerqruegee submerqrueege submerqrueeeg submerqrueeeg submerqrueege
submerqrugeee submerqrugeee submerqrugeee submerqrugeee submerqrugeee submerqrugeee submerqruegee submerqruegee submerqrueege
submerqrueeeg submerqrueeeg submerqrueege submerqruegee submerqruegee submerqrueege submerqrueeeg submerqrueeeg submerqrueege
submerqreegue submerqreegeu submerqreeuge submerqreeueg submerqreeeug submerqreeegu submerqregeue submerqregeeu submerqreguee
submerqreguee submerqregeue submerqregeeu submerqreugee submerqreugee submerqreuege submerqreueeg submerqreueeg submerqreuege
submerqreegue submerqreegeu submerqreeuge submerqreeueg submerqreeeug submerqreeegu submerqeregue submerqeregeu submerqereuge
submerqereueg submerqereeug submerqereegu submerqergeue submerqergeeu submerqerguee submerqerguee submerqergeue submerqergeeu
submerqerugee submerqerugee submerqeruege submerqerueeg submerqerueeg submerqeruege submerqeregue submerqeregeu submerqereuge
submerqereueg submerqereeug submerqereegu submerqeergue submerqeergeu submerqeeruge submerqeerueg submerqeereug submerqeeregu
submerqeegrue submerqeegreu submerqeegure submerqeeguer submerqeegeur submerqeegeru submerqeeugre submerqeeuger submerqeeurge
submerqeeureg submerqeeuerg submerqeeuegr submerqeeegur submerqeeegru submerqeeeugr submerqeeeurg submerqeeerug submerqeeergu
submerqegerue submerqegereu submerqegeure submerqegeuer submerqegeeur submerqegeeru submerqegreue submerqegreeu submerqegruee
submerqegruee submerqegreue submerqegreeu submerqeguree submerqeguree submerqeguere submerqegueer submerqegueer submerqeguere
submerqegerue submerqegereu submerqegeure submerqegeuer submerqegeeur submerqegeeru submerqeuegre submerqeueger submerqeuerge
submerqeuereg submerqeueerg submerqeueegr submerqeugere submerqeugeer submerqeugree submerqeugree submerqeugere submerqeugeer
submerqeurgee submerqeurgee submerqeurege submerqeureeg submerqeureeg submerqeurege submerqeuegre submerqeueger submerqeuerge
submerqeuereg submerqeueerg submerqeueegr submerqeeegur submerqeeegru submerqeeeugr submerqeeeurg submerqeeerug submerqeeergu
submerqeegeur submerqeegeru submerqeeguer submerqeegure submerqeegrue submerqeegreu submerqeeuger submerqeeugre submerqeeuegr
submerqeeuerg submerqeeureg submerqeeurge submerqeergue submerqeergeu submerqeeruge submerqeerueg submerqeereug submerqeeregu
submerqgreeue submerqgreeeu submerqgreuee submerqgreuee submerqgreeue submerqgreeeu submerqgreeue submerqgreeeu submerqgreuee
submerqgreuee submerqgreeue submerqgreeeu submerqgrueee submerqgrueee submerqgrueee submerqgrueee submerqgrueee submerqgrueee
submerqgreeue submerqgreeeu submerqgreuee submerqgreuee submerqgreeue submerqgreeeu submerqgereue submerqgereeu submerqgeruee
submerqgeruee submerqgereue submerqgereeu submerqgeerue submerqgeereu submerqgeeure submerqgeeuer submerqgeeeur submerqgeeeru
submerqgeuere submerqgeueer submerqgeuree submerqgeuree submerqgeuere submerqgeueer submerqgeeeur submerqgeeeru submerqgeeuer
submerqgeeure submerqgeerue submerqgeereu submerqgeerue submerqgeereu submerqgeeure submerqgeeuer submerqgeeeur submerqgeeeru
submerqgereue submerqgereeu submerqgeruee submerqgeruee submerqgereue submerqgereeu submerqgeuree submerqgeuree submerqgeuere
submerqgeueer submerqgeueer submerqgeuere submerqgeerue submerqgeereu submerqgeeure submerqgeeuer submerqgeeeur submerqgeeeru
submerqgueere submerqgueeer submerqgueree submerqgueree submerqgueere submerqgueeer submerqgueere submerqgueeer submerqgueree
submerqgueree submerqgueere submerqgueeer submerqgureee submerqgureee submerqgureee submerqgureee submerqgureee submerqgureee
submerqgueere submerqgueeer submerqgueree submerqgueree submerqgueere submerqgueeer submerqgeeeur submerqgeeeru submerqgeeuer
submerqgeeure submerqgeerue submerqgeereu submerqgeeeur submerqgeeeru submerqgeeuer submerqgeeure submerqgeerue submerqgeereu
submerqgeueer submerqgeuere submerqgeueer submerqgeuere submerqgeuree submerqgeuree submerqgereue submerqgereeu submerqgeruee
submerqgeruee submerqgereue submerqgereeu submerquregee submerquregee submerqureege submerqureeeg submerqureeeg submerqureege
submerqurgeee submerqurgeee submerqurgeee submerqurgeee submerqurgeee submerqurgeee submerquregee submerquregee submerqureege
submerqureeeg submerqureeeg submerqureege submerquregee submerquregee submerqureege submerqureeeg submerqureeeg submerqureege
submerquergee submerquergee submerquerege submerquereeg submerquereeg submerquerege submerquegree submerquegree submerquegere
submerquegeer submerquegeer submerquegere submerqueegre submerqueeger submerqueerge submerqueereg submerqueeerg submerqueeegr
submerqueeger submerqueegre submerqueeegr submerqueeerg submerqueereg submerqueerge submerqugeree submerqugeree submerqugeere
submerqugeeer submerqugeeer submerqugeere submerqugreee submerqugreee submerqugreee submerqugreee submerqugreee submerqugreee
submerqugeree submerqugeree submerqugeere submerqugeeer submerqugeeer submerqugeere submerqugeree submerqugeree submerqugeere
submerqugeeer submerqugeeer submerqugeere submerqueegre submerqueeger submerqueerge submerqueereg submerqueeerg submerqueeegr
submerquegere submerquegeer submerquegree submerquegree submerquegere submerquegeer submerquergee submerquergee submerquerege
submerquereeg submerquereeg submerquerege submerqueegre submerqueeger submerqueerge submerqueereg submerqueeerg submerqueeegr
submerqueeger submerqueegre submerqueeegr submerqueeerg submerqueereg submerqueerge submerquegeer submerquegere submerquegeer
submerquegere submerquegree submerquegree submerqueeger submerqueegre submerqueeegr submerqueeerg submerqueereg submerqueerge
submerquergee submerquergee submerquerege submerquereeg submerquereeg submerquerege submerqeregue submerqeregeu submerqereuge
submerqereueg submerqereeug submerqereegu submerqergeue submerqergeeu submerqerguee submerqerguee submerqergeue submerqergeeu
submerqerugee submerqerugee submerqeruege submerqerueeg submerqerueeg submerqeruege submerqeregue submerqeregeu submerqereuge
submerqereueg submerqereeug submerqereegu submerqeergue submerqeergeu submerqeeruge submerqeerueg submerqeereug submerqeeregu
submerqeegrue submerqeegreu submerqeegure submerqeeguer submerqeegeur submerqeegeru submerqeeugre submerqeeuger submerqeeurge
submerqeeureg submerqeeuerg submerqeeuegr submerqeeegur submerqeeegru submerqeeeugr submerqeeeurg submerqeeerug submerqeeergu
submerqegerue submerqegereu submerqegeure submerqegeuer submerqegeeur submerqegeeru submerqegreue submerqegreeu submerqegruee
submerqegruee submerqegreue submerqegreeu submerqeguree submerqeguree submerqeguere submerqegueer submerqegueer submerqeguere
submerqegerue submerqegereu submerqegeure submerqegeuer submerqegeeur submerqegeeru submerqeuegre submerqeueger submerqeuerge
submerqeuereg submerqeueerg submerqeueegr submerqeugere submerqeugeer submerqeugree submerqeugree submerqeugere submerqeugeer
submerqeurgee submerqeurgee submerqeurege submerqeureeg submerqeureeg submerqeurege submerqeuegre submerqeueger submerqeuerge
submerqeuereg submerqeueerg submerqeueegr submerqeeegur submerqeeegru submerqeeeugr submerqeeeurg submerqeeerug submerqeeergu
submerqeegeur submerqeegeru submerqeeguer submerqeegure submerqeegrue submerqeegreu submerqeeuger submerqeeugre submerqeeuegr
submerqeeuerg submerqeeureg submerqeeurge submerqeergue submerqeergeu submerqeeruge submerqeerueg submerqeereug submerqeeregu
submeruereqge submeruereqeg submerueregqe submerueregeq submeruereegq submeruereeqg submeruerqege submeruerqeeg submeruerqgee
submeruerqgee submeruerqege submeruerqeeg submeruergqee submeruergqee submeruergeqe submeruergeeq submeruergeeq submeruergeqe
submeruereqge submeruereqeg submerueregqe submerueregeq submeruereegq submeruereeqg submerueerqge submerueerqeg submerueergqe
submerueergeq submerueeregq submerueereqg submerueeqrge submerueeqreg submerueeqgre submerueeqger submerueeqegr submerueeqerg
submerueegqre submerueegqer submerueegrqe submerueegreq submerueegerq submerueegeqr submerueeeqgr submerueeeqrg submerueeegqr
submerueeegrq submerueeergq submerueeerqg submerueqerge submerueqereg submerueqegre submerueqeger submerueqeegr submerueqeerg
submerueqrege submerueqreeg submerueqrgee submerueqrgee submerueqrege submerueqreeg submerueqgree submerueqgree submerueqgere
submerueqgeer submerueqgeer submerueqgere submerueqerge submerueqereg submerueqegre submerueqeger submerueqeegr submerueqeerg
submeruegeqre submeruegeqer submeruegerqe submeruegereq submeruegeerq submeruegeeqr submeruegqere submeruegqeer submeruegqree
submeruegqree submeruegqere submeruegqeer submeruegrqee submeruegrqee submeruegreqe submeruegreeq submeruegreeq submeruegreqe
submeruegeqre submeruegeqer submeruegerqe submeruegereq submeruegeerq submeruegeeqr submerueeeqgr submerueeeqrg submerueeegqr
submerueeegrq submerueeergq submerueeerqg submerueeqegr submerueeqerg submerueeqger submerueeqgre submerueeqrge submerueeqreg
submerueegqer submerueegqre submerueegeqr submerueegerq submerueegreq submerueegrqe submerueerqge submerueerqeg submerueergqe
submerueergeq submerueeregq submerueereqg submerureeqge submerureeqeg submerureegqe submerureegeq submerureeegq submerureeeqg
submerureqege submerureqeeg submerureqgee submerureqgee submerureqege submerureqeeg submeruregqee submeruregqee submeruregeqe
submeruregeeq submeruregeeq submeruregeqe submerureeqge submerureeqeg submerureegqe submerureegeq submerureeegq submerureeeqg
submerureeqge submerureeqeg submerureegqe submerureegeq submerureeegq submerureeeqg submerureqege submerureqeeg submerureqgee
submerureqgee submerureqege submerureqeeg submeruregqee submeruregqee submeruregeqe submeruregeeq submeruregeeq submeruregeqe
submerureeqge submerureeqeg submerureegqe submerureegeq submerureeegq submerureeeqg submerurqeege submerurqeeeg submerurqegee
submerurqegee submerurqeege submerurqeeeg submerurqeege submerurqeeeg submerurqegee submerurqegee submerurqeege submerurqeeeg
submerurqgeee submerurqgeee submerurqgeee submerurqgeee submerurqgeee submerurqgeee submerurqeege submerurqeeeg submerurqegee
submerurqegee submerurqeege submerurqeeeg submerurgeqee submerurgeqee submerurgeeqe submerurgeeeq submerurgeeeq submerurgeeqe
submerurgqeee submerurgqeee submerurgqeee submerurgqeee submerurgqeee submerurgqeee submerurgeqee submerurgeqee submerurgeeqe
submerurgeeeq submerurgeeeq submerurgeeqe submerurgeqee submerurgeqee submerurgeeqe submerurgeeeq submerurgeeeq submerurgeeqe
submerureeqge submerureeqeg submerureegqe submerureegeq submerureeegq submerureeeqg submerureqege submerureqeeg submerureqgee
submerureqgee submerureqege submerureqeeg submeruregqee submeruregqee submeruregeqe submeruregeeq submeruregeeq submeruregeqe
submerureeqge submerureeqeg submerureegqe submerureegeq submerureeegq submerureeeqg submeruereqge submeruereqeg submerueregqe
submerueregeq submeruereegq submeruereeqg submeruerqege submeruerqeeg submeruerqgee submeruerqgee submeruerqege submeruerqeeg
submeruergqee submeruergqee submeruergeqe submeruergeeq submeruergeeq submeruergeqe submeruereqge submeruereqeg submerueregqe
submerueregeq submeruereegq submeruereeqg submerueerqge submerueerqeg submerueergqe submerueergeq submerueeregq submerueereqg
submerueeqrge submerueeqreg submerueeqgre submerueeqger submerueeqegr submerueeqerg submerueegqre submerueegqer submerueegrqe
submerueegreq submerueegerq submerueegeqr submerueeeqgr submerueeeqrg submerueeegqr submerueeegrq submerueeergq submerueeerqg
submerueqerge submerueqereg submerueqegre submerueqeger submerueqeegr submerueqeerg submerueqrege submerueqreeg submerueqrgee
submerueqrgee submerueqrege submerueqreeg submerueqgree submerueqgree submerueqgere submerueqgeer submerueqgeer submerueqgere
submerueqerge submerueqereg submerueqegre submerueqeger submerueqeegr submerueqeerg submeruegeqre submeruegeqer submeruegerqe
submeruegereq submeruegeerq submeruegeeqr submeruegqere submeruegqeer submeruegqree submeruegqree submeruegqere submeruegqeer
submeruegrqee submeruegrqee submeruegreqe submeruegreeq submeruegreeq submeruegreqe submeruegeqre submeruegeqer submeruegerqe
submeruegereq submeruegeerq submeruegeeqr submerueeeqgr submerueeeqrg submerueeegqr submerueeegrq submerueeergq submerueeerqg
submerueeqegr submerueeqerg submerueeqger submerueeqgre submerueeqrge submerueeqreg submerueegqer submerueegqre submerueegeqr
submerueegerq submerueegreq submerueegrqe submerueerqge submerueerqeg submerueergqe submerueergeq submerueeregq submerueereqg
submeruqreege submeruqreeeg submeruqregee submeruqregee submeruqreege submeruqreeeg submeruqreege submeruqreeeg submeruqregee
submeruqregee submeruqreege submeruqreeeg submeruqrgeee submeruqrgeee submeruqrgeee submeruqrgeee submeruqrgeee submeruqrgeee
submeruqreege submeruqreeeg submeruqregee submeruqregee submeruqreege submeruqreeeg submeruqerege submeruqereeg submeruqergee
submeruqergee submeruqerege submeruqereeg submeruqeerge submeruqeereg submeruqeegre submeruqeeger submeruqeeegr submeruqeeerg
submeruqegere submeruqegeer submeruqegree submeruqegree submeruqegere submeruqegeer submeruqeeegr submeruqeeerg submeruqeeger
submeruqeegre submeruqeerge submeruqeereg submeruqeerge submeruqeereg submeruqeegre submeruqeeger submeruqeeegr submeruqeeerg
submeruqerege submeruqereeg submeruqergee submeruqergee submeruqerege submeruqereeg submeruqegree submeruqegree submeruqegere
submeruqegeer submeruqegeer submeruqegere submeruqeerge submeruqeereg submeruqeegre submeruqeeger submeruqeeegr submeruqeeerg
submeruqgeere submeruqgeeer submeruqgeree submeruqgeree submeruqgeere submeruqgeeer submeruqgeere submeruqgeeer submeruqgeree
submeruqgeree submeruqgeere submeruqgeeer submeruqgreee submeruqgreee submeruqgreee submeruqgreee submeruqgreee submeruqgreee
submeruqgeere submeruqgeeer submeruqgeree submeruqgeree submeruqgeere submeruqgeeer submeruqeeegr submeruqeeerg submeruqeeger
submeruqeegre submeruqeerge submeruqeereg submeruqeeegr submeruqeeerg submeruqeeger submeruqeegre submeruqeerge submeruqeereg
submeruqegeer submeruqegere submeruqegeer submeruqegere submeruqegree submeruqegree submeruqerege submeruqereeg submeruqergee
submeruqergee submeruqerege submeruqereeg submerugreqee submerugreqee submerugreeqe submerugreeeq submerugreeeq submerugreeqe
submerugrqeee submerugrqeee submerugrqeee submerugrqeee submerugrqeee submerugrqeee submerugreqee submerugreqee submerugreeqe
submerugreeeq submerugreeeq submerugreeqe submerugreqee submerugreqee submerugreeqe submerugreeeq submerugreeeq submerugreeqe
submerugerqee submerugerqee submerugereqe submerugereeq submerugereeq submerugereqe submerugeqree submerugeqree submerugeqere
submerugeqeer submerugeqeer submerugeqere submerugeeqre submerugeeqer submerugeerqe submerugeereq submerugeeerq submerugeeeqr
submerugeeqer submerugeeqre submerugeeeqr submerugeeerq submerugeereq submerugeerqe submerugqeree submerugqeree submerugqeere
submerugqeeer submerugqeeer submerugqeere submerugqreee submerugqreee submerugqreee submerugqreee submerugqreee submerugqreee
submerugqeree submerugqeree submerugqeere submerugqeeer submerugqeeer submerugqeere submerugqeree submerugqeree submerugqeere
submerugqeeer submerugqeeer submerugqeere submerugeeqre submerugeeqer submerugeerqe submerugeereq submerugeeerq submerugeeeqr
submerugeqere submerugeqeer submerugeqree submerugeqree submerugeqere submerugeqeer submerugerqee submerugerqee submerugereqe
submerugereeq submerugereeq submerugereqe submerugeeqre submerugeeqer submerugeerqe submerugeereq submerugeeerq submerugeeeqr
submerugeeqer submerugeeqre submerugeeeqr submerugeeerq submerugeereq submerugeerqe submerugeqeer submerugeqere submerugeqeer
submerugeqere submerugeqree submerugeqree submerugeeqer submerugeeqre submerugeeeqr submerugeeerq submerugeereq submerugeerqe
submerugerqee submerugerqee submerugereqe submerugereeq submerugereeq submerugereqe submeruereqge submeruereqeg submerueregqe
submerueregeq submeruereegq submeruereeqg submeruerqege submeruerqeeg submeruerqgee submeruerqgee submeruerqege submeruerqeeg
submeruergqee submeruergqee submeruergeqe submeruergeeq submeruergeeq submeruergeqe submeruereqge submeruereqeg submerueregqe
submerueregeq submeruereegq submeruereeqg submerueerqge submerueerqeg submerueergqe submerueergeq submerueeregq submerueereqg
submerueeqrge submerueeqreg submerueeqgre submerueeqger submerueeqegr submerueeqerg submerueegqre submerueegqer submerueegrqe
submerueegreq submerueegerq submerueegeqr submerueeeqgr submerueeeqrg submerueeegqr submerueeegrq submerueeergq submerueeerqg
submerueqerge submerueqereg submerueqegre submerueqeger submerueqeegr submerueqeerg submerueqrege submerueqreeg submerueqrgee
submerueqrgee submerueqrege submerueqreeg submerueqgree submerueqgree submerueqgere submerueqgeer submerueqgeer submerueqgere
submerueqerge submerueqereg submerueqegre submerueqeger submerueqeegr submerueqeerg submeruegeqre submeruegeqer submeruegerqe
submeruegereq submeruegeerq submeruegeeqr submeruegqere submeruegqeer submeruegqree submeruegqree submeruegqere submeruegqeer
submeruegrqee submeruegrqee submeruegreqe submeruegreeq submeruegreeq submeruegreqe submeruegeqre submeruegeqer submeruegerqe
submeruegereq submeruegeerq submeruegeeqr submerueeeqgr submerueeeqrg submerueeegqr submerueeegrq submerueeergq submerueeerqg
submerueeqegr submerueeqerg submerueeqger submerueeqgre submerueeqrge submerueeqreg submerueegqer submerueegqre submerueegeqr
submerueegerq submerueegreq submerueegrqe submerueerqge submerueerqeg submerueergqe submerueergeq submerueeregq submerueereqg
submereerequg submereereqgu submereereuqg submereereugq submereereguq submereeregqu submereerqeug submereerqegu submereerqueg
submereerquge submereerqgue submereerqgeu submereeruqeg submereeruqge submereerueqg submereeruegq submereerugeq submereerugqe
submereergque submereergqeu submereerguqe submereergueq submereergeuq submereergequ submereeerqug submereeerqgu submereeeruqg
submereeerugq submereeerguq submereeergqu submereeeqrug submereeeqrgu submereeequrg submereeequgr submereeeqgur submereeeqgru
submereeeuqrg submereeeuqgr submereeeurqg submereeeurgq submereeeugrq submereeeugqr submereeegqur submereeegqru submereeeguqr
submereeegurq submereeegruq submereeegrqu submereeqerug submereeqergu submereeqeurg submereeqeugr submereeqegur submereeqegru
submereeqreug submereeqregu submereeqrueg submereeqruge submereeqrgue submereeqrgeu submereequreg submereequrge submereequerg
submereequegr submereequger submereequgre submereeqgrue submereeqgreu submereeqgure submereeqguer submereeqgeur submereeqgeru
submereeueqrg submereeueqgr submereeuerqg submereeuergq submereeuegrq submereeuegqr submereeuqerg submereeuqegr submereeuqreg
submereeuqrge submereeuqgre submereeuqger submereeurqeg submereeurqge submereeureqg submereeuregq submereeurgeq submereeurgqe
submereeugqre submereeugqer submereeugrqe submereeugreq submereeugerq submereeugeqr submereegequr submereegeqru submereegeuqr
submereegeurq submereegeruq submereegerqu submereegqeur submereegqeru submereegquer submereegqure submereegqrue submereegqreu
submereeguqer submereeguqre submereegueqr submereeguerq submereegureq submereegurqe submereegrque submereegrqeu submereegruqe
submereegrueq submereegreuq submereegrequ submerereequg submerereeqgu submerereeuqg submerereeugq submerereeguq submerereegqu
submerereqeug submerereqegu submererequeg submererequge submerereqgue submerereqgeu submerereuqeg submerereuqge submerereueqg
submerereuegq submerereugeq submerereugqe submereregque submereregqeu submerereguqe submereregueq submereregeuq submereregequ
submerereequg submerereeqgu submerereeuqg submerereeugq submerereeguq submerereegqu submerereqeug submerereqegu submererequeg
submererequge submerereqgue submerereqgeu submerereuqeg submerereuqge submerereueqg submerereuegq submerereugeq submerereugqe
submereregque submereregqeu submerereguqe submereregueq submereregeuq submereregequ submererqeeug submererqeegu submererqeueg
submererqeuge submererqegue submererqegeu submererqeeug submererqeegu submererqeueg submererqeuge submererqegue submererqegeu
submererqueeg submererquege submererqueeg submererquege submererqugee submererqugee submererqgeue submererqgeeu submererqguee
submererqguee submererqgeue submererqgeeu submererueqeg submererueqge submererueeqg submererueegq submereruegeq submereruegqe
submereruqeeg submereruqege submereruqeeg submereruqege submereruqgee submereruqgee submererueqeg submererueqge submererueeqg
submererueegq submereruegeq submereruegqe submererugqee submererugqee submererugeqe submererugeeq submererugeeq submererugeqe
submerergeque submerergeqeu submerergeuqe submerergeueq submerergeeuq submerergeequ submerergqeue submerergqeeu submerergquee
submerergquee submerergqeue submerergqeeu submererguqee submererguqee submerergueqe submerergueeq submerergueeq submerergueqe
submerergeque submerergeqeu submerergeuqe submerergeueq submerergeeuq submerergeequ submereerequg submereereqgu submereereuqg
submereereugq submereereguq submereeregqu submereerqeug submereerqegu submereerqueg submereerquge submereerqgue submereerqgeu
submereeruqeg submereeruqge submereerueqg submereeruegq submereerugeq submereerugqe submereergque submereergqeu submereerguqe
submereergueq submereergeuq submereergequ submereeerqug submereeerqgu submereeeruqg submereeerugq submereeerguq submereeergqu
submereeeqrug submereeeqrgu submereeequrg submereeequgr submereeeqgur submereeeqgru submereeeuqrg submereeeuqgr submereeeurqg
submereeeurgq submereeeugrq submereeeugqr submereeegqur submereeegqru submereeeguqr submereeegurq submereeegruq submereeegrqu
submereeqerug submereeqergu submereeqeurg submereeqeugr submereeqegur submereeqegru submereeqreug submereeqregu submereeqrueg
submereeqruge submereeqrgue submereeqrgeu submereequreg submereequrge submereequerg submereequegr submereequger submereequgre
submereeqgrue submereeqgreu submereeqgure submereeqguer submereeqgeur submereeqgeru submereeueqrg submereeueqgr submereeuerqg
submereeuergq submereeuegrq submereeuegqr submereeuqerg submereeuqegr submereeuqreg submereeuqrge submereeuqgre submereeuqger
submereeurqeg submereeurqge submereeureqg submereeuregq submereeurgeq submereeurgqe submereeugqre submereeugqer submereeugrqe
submereeugreq submereeugerq submereeugeqr submereegequr submereegeqru submereegeuqr submereegeurq submereegeruq submereegerqu
submereegqeur submereegqeru submereegquer submereegqure submereegqrue submereegqreu submereeguqer submereeguqre submereegueqr
submereeguerq submereegureq submereegurqe submereegrque submereegrqeu submereegruqe submereegrueq submereegreuq submereegrequ
submereqreeug submereqreegu submereqreueg submereqreuge submereqregue submereqregeu submereqreeug submereqreegu submereqreueg
submereqreuge submereqregue submereqregeu submereqrueeg submereqruege submereqrueeg submereqruege submereqrugee submereqrugee
submereqrgeue submereqrgeeu submereqrguee submereqrguee submereqrgeue submereqrgeeu submereqereug submereqeregu submereqerueg
submereqeruge submereqergue submereqergeu submereqeerug submereqeergu submereqeeurg submereqeeugr submereqeegur submereqeegru
submereqeuerg submereqeuegr submereqeureg submereqeurge submereqeugre submereqeuger submereqegeur submereqegeru submereqeguer
submereqegure submereqegrue submereqegreu submereqeerug submereqeergu submereqeeurg submereqeeugr submereqeegur submereqeegru
submereqereug submereqeregu submereqerueg submereqeruge submereqergue submereqergeu submereqeureg submereqeurge submereqeuerg
submereqeuegr submereqeuger submereqeugre submereqegrue submereqegreu submereqegure submereqeguer submereqegeur submereqegeru
submerequeerg submerequeegr submerequereg submerequerge submerequegre submerequeger submerequeerg submerequeegr submerequereg
submerequerge submerequegre submerequeger submerequreeg submerequrege submerequreeg submerequrege submerequrgee submerequrgee
submerequgere submerequgeer submerequgree submerequgree submerequgere submerequgeer submereqgeeur submereqgeeru submereqgeuer
submereqgeure submereqgerue submereqgereu submereqgeeur submereqgeeru submereqgeuer submereqgeure submereqgerue submereqgereu
submereqgueer submereqguere submereqgueer submereqguere submereqguree submereqguree submereqgreue submereqgreeu submereqgruee
submereqgruee submereqgreue submereqgreeu submereureqeg submereureqge submereureeqg submereureegq submereuregeq submereuregqe
submereurqeeg submereurqege submereurqeeg submereurqege submereurqgee submereurqgee submereureqeg submereureqge submereureeqg
submereureegq submereuregeq submereuregqe submereurgqee submereurgqee submereurgeqe submereurgeeq submereurgeeq submereurgeqe
submereuerqeg submereuerqge submereuereqg submereueregq submereuergeq submereuergqe submereueqreg submereueqrge submereueqerg
submereueqegr submereueqger submereueqgre submereueeqrg submereueeqgr submereueerqg submereueergq submereueegrq submereueegqr
submereuegqer submereuegqre submereuegeqr submereuegerq submereuegreq submereuegrqe submereuqereg submereuqerge submereuqeerg
submereuqeegr submereuqeger submereuqegre submereuqreeg submereuqrege submereuqreeg submereuqrege submereuqrgee submereuqrgee
submereuqereg submereuqerge submereuqeerg submereuqeegr submereuqeger submereuqegre submereuqgree submereuqgree submereuqgere
submereuqgeer submereuqgeer submereuqgere submereueeqrg submereueeqgr submereueerqg submereueergq submereueegrq submereueegqr
submereueqerg submereueqegr submereueqreg submereueqrge submereueqgre submereueqger submereuerqeg submereuerqge submereuereqg
submereueregq submereuergeq submereuergqe submereuegqre submereuegqer submereuegrqe submereuegreq submereuegerq submereuegeqr
submereugeqer submereugeqre submereugeeqr submereugeerq submereugereq submereugerqe submereugqeer submereugqere submereugqeer
submereugqere submereugqree submereugqree submereugeqer submereugeqre submereugeeqr submereugeerq submereugereq submereugerqe
submereugrqee submereugrqee submereugreqe submereugreeq submereugreeq submereugreqe submeregreque submeregreqeu submeregreuqe
submeregreueq submeregreeuq submeregreequ submeregrqeue submeregrqeeu submeregrquee submeregrquee submeregrqeue submeregrqeeu
submeregruqee submeregruqee submeregrueqe submeregrueeq submeregrueeq submeregrueqe submeregreque submeregreqeu submeregreuqe
submeregreueq submeregreeuq submeregreequ submeregerque submeregerqeu submeregeruqe submeregerueq submeregereuq submeregerequ
submeregeqrue submeregeqreu submeregequre submeregequer submeregeqeur submeregeqeru submeregeuqre submeregeuqer submeregeurqe
submeregeureq submeregeuerq submeregeueqr submeregeequr submeregeeqru submeregeeuqr submeregeeurq submeregeeruq submeregeerqu
submeregqerue submeregqereu submeregqeure submeregqeuer submeregqeeur submeregqeeru submeregqreue submeregqreeu submeregqruee
submeregqruee submeregqreue submeregqreeu submeregquree submeregquree submeregquere submeregqueer submeregqueer submeregquere
submeregqerue submeregqereu submeregqeure submeregqeuer submeregqeeur submeregqeeru submeregueqre submeregueqer submereguerqe
submereguereq submeregueerq submeregueeqr submereguqere submereguqeer submereguqree submereguqree submereguqere submereguqeer
submeregurqee submeregurqee submeregureqe submeregureeq submeregureeq submeregureqe submeregueqre submeregueqer submereguerqe
submereguereq submeregueerq submeregueeqr submeregeequr submeregeeqru submeregeeuqr submeregeeurq submeregeeruq submeregeerqu
submeregeqeur submeregeqeru submeregequer submeregequre submeregeqrue submeregeqreu submeregeuqer submeregeuqre submeregeueqr
submeregeuerq submeregeureq submeregeurqe submeregerque submeregerqeu submeregeruqe submeregerueq submeregereuq submeregerequ

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us