easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

miserasque

writhed

dargin

climes

keymas

praetexunt

unctionless

conveniantque

inusitate

unionizing

reestimate

agendums

impracticableness

integrate

unshop

steichen

bifilarly

resuck


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: subdefinition
cipher variations:
tvcefgjojujpo uwdfghkpkvkqp vxeghilqlwlrq wyfhijmrmxmsr xzgijknsnynts
yahjklotozout zbiklmpupapvu acjlmnqvqbqwv bdkmnorwrcrxw celnopsxsdsyx
dfmopqtytetzy egnpqruzufuaz fhoqrsvavgvba giprstwbwhwcb hjqstuxcxixdc
ikrtuvydyjyed jlsuvwzezkzfe kmtvwxafalagf lnuwxybgbmbhg movxyzchcncih
npwyzadidodji oqxzabejepekj pryabcfkfqflk qszbcdglgrgml rtacdehmhshnm

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: subdefinition
Cipher: hfywvurmrgrlm

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: subdefinition
Cipher: BAAAB BAABB AAAAB AAABB AABAA AABAB ABAAA ABBAA ABAAA BAABA ABAAA ABBAB ABBAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: subdefinition
cipher variations:
tvcefgjojujpodjeknqzozgzronxgqvapopsptoxliwdkfofefvohzkcluvovqvxornmitelolclzolpqujyrorardovdsarihohmhfo
frugzsxoxyxhopfwmhcnonknjoztyspmdodwdlojhayxwtotitnouwdfghkpkvkqpekflorapahaspoyhrwbqpqtqupymjxelgpgfgwp
ialdmvwpwrwypsonjufmpmdmapmqrvkzspsbsepwetbsjipinigpgsvhatypyzyipqgxnidopolokpauztqnepexempkibzyxupujuop
vxeghilqlwlrqflgmpsbqbibtqpzisxcrqrurvqznkyfmhqhghxqjbmenwxqxsxzqtpokvgnqnenbqnrswlatqtctfqxfuctkjqjojhq
htwibuzqzazjqrhyojepqpmplqbvaurofqfyfnqljcazyvqvkvpqwyfhijmrmxmsrgmhnqtcrcjcurqajtydsrsvswraolzgnirihiyr
kcnfoxyrytyaruqplwhorofocrostxmburudugrygvdulkrkpkiriuxjcvarabakrsizpkfqrqnqmrcwbvspgrgzgormkdbazwrwlwqr
xzgijknsnyntshniorudsdkdvsrbkuzetstwtxsbpmahojsjijzsldogpyzszuzbsvrqmxipspgpdsptuyncvsvevhszhwevmlslqljs
jvykdwbsbcblstjaqlgrsrornsdxcwtqhshahpsnlecbaxsxmxrsyahjklotozoutiojpsvetelewtsclvafutuxuytcqnbipktkjkat
mephqzatavactwsrnyjqtqhqetquvzodwtwfwitaixfwnmtmrmktkwzlexctcdcmtukbrmhstspsoteydxuritibiqtomfdcbytynyst
zbiklmpupapvujpkqtwfufmfxutdmwbgvuvyvzudrocjqlulklbunfqirabubwbduxtsozkrurirfurvwapexuxgxjubjygxonunsnlu
lxamfydudednuvlcsnitutqtpufzeyvsjujcjrupngedczuzoztuacjlmnqvqbqwvkqlruxgvgngyvuenxchwvwzwavespdkrmvmlmcv
ogrjsbcvcxcevyutpalsvsjsgvswxbqfyvyhykvckzhypovotomvmybngzevefeovwmdtojuvuruqvgafzwtkvkdksvqohfedavapauv
bdkmnorwrcrxwlrmsvyhwhohzwvfoydixwxaxbwftqelsnwnmndwphsktcdwdydfwzvuqbmtwtkthwtxycrgzwzizlwdlaizqpwpupnw
nzcohafwfgfpwxneupkvwvsvrwhbgaxulwleltwrpigfebwbqbvwcelnopsxsdsyxmsntwzixipiaxwgpzejyxybycxgurfmtoxonoex
qitludexezegxawvrcnuxuluixuyzdshaxajamxembjarqxqvqoxoadpibgxghgqxyofvqlwxwtwsxichbyvmxmfmuxsqjhgfcxcrcwx
dfmopqtytetzyntouxajyjqjbyxhqafkzyzczdyhvsgnupypopfyrjumvefyfafhybxwsdovyvmvjyvzaetibybkbnyfnckbsryrwrpy
pbeqjchyhihryzpgwrmxyxuxtyjdiczwnyngnvytrkihgdydsdxyegnpqruzufuazoupvybkzkrkczyirbglazadaeziwthovqzqpqgz
skvnwfgzgbgizcyxtepwzwnwkzwabfujczclcozgodlctszsxsqzqcfrkdizijiszaqhxsnyzyvyuzkejdaxozohowzusljihezeteyz
fhoqrsvavgvbapvqwzclalsldazjschmbabebfajxuipwrarqrhatlwoxghahchjadzyufqxaxoxlaxbcgvkdadmdpahpemdutatytra
rdgslejajkjtabriytozazwzvalfkebypapipxavtmkjifafufzagiprstwbwhwcbqwrxadmbmtmebaktdincbcfcgbkyvjqxsbsrsib
umxpyhibidikbeazvgrybypymbycdhwlebeneqbiqfnevubuzusbsehtmfkbklkubcsjzupabaxawbmglfczqbqjqybwunlkjgbgvgab
hjqstuxcxixdcrxsybencnunfcbluejodcdgdhclzwkrytctstjcvnyqzijcjejlcfbawhszczqznczdeixmfcfofrcjrgofwvcvavtc
tfiunglclmlvcdtkavqbcbybxcnhmgdarcrkrzcxvomlkhchwhbcikrtuvydyjyedsytzcfodovogdcmvfkpedeheidmaxlszudutukd
wozrajkdkfkmdgcbxitadaraodaefjyngdgpgsdkshpgxwdwbwudugjvohmdmnmwdeulbwrcdczcydoinhebsdslsadywpnmlidixicd
jlsuvwzezkzfetzuadgpepwphednwglqfefifjenbymtavevuvlexpasbklelglnehdcyjubebsbpebfgkzohehqhteltiqhyxexcxve
vhkwpinenonxefvmcxsdedadzepjoifctetmtbezxqonmjejyjdekmtvwxafalagfuavbehqfqxqifeoxhmrgfgjgkfocznubwfwvwmf
yqbtclmfmhmofiedzkvcfctcqfcghlapifiriufmujrizyfydywfwilxqjofopoyfgwndytefebeafqkpjgdufunucfayrponkfkzkef
lnuwxybgbmbhgvbwcfirgryrjgfpyinshghkhlgpdaovcxgxwxngzrcudmngninpgjfealwdgdudrgdhimbqjgjsjvgnvksjazgzezxg
xjmyrkpgpqpzghxoezufgfcfbgrlqkhevgvovdgbzsqpolglalfgmovxyzchcncihwcxdgjshszskhgqzjotihilimhqebpwdyhyxyoh
asdvenohojoqhkgfbmxehevesheijncrkhktkwhowltkbahafayhyknzslqhqrqahiypfavghgdgchsmrlifwhwpwehcatrqpmhmbmgh
npwyzadidodjixdyehktitatlihrakpujijmjnirfcqxezizyzpibtewfopipkprilhgcnyfifwftifjkodslilulxipxmulcbibgbzi
zloatmrirsrbijzqgbwhihehditnsmjgxixqxfidbusrqnincnhioqxzabejepekjyezfilujubumjisblqvkjknkojsgdryfajazaqj
cufxgpqjqlqsjmihdozgjgxgujgklpetmjmvmyjqynvmdcjchcajampbunsjstscjkarhcxijifiejuotnkhyjyrygjecvtsrojodoij
pryabcfkfqflkzfagjmvkvcvnkjtcmrwlklolpktheszgbkbabrkdvgyhqrkrmrtknjiepahkhyhvkhlmqfunknwnzkrzownedkdidbk
bnqcvotktutdklbsidyjkjgjfkvpuolizkzszhkfdwutspkpepjkqszbcdglgrgmlagbhknwlwdwolkudnsxmlmpmqluiftahclcbcsl
ewhzirslsnsulokjfqbiliziwlimnrgvoloxoalsapxofelejeclcordwpuluvuelmctjezklkhkglwqvpmjalatailgexvutqlqfqkl
rtacdehmhshnmbhciloxmxexpmlveotynmnqnrmvjgubidmdcdtmfxiajstmtotvmplkgrcjmjajxmjnoshwpmpypbmtbqypgfmfkfdm
dpsexqvmvwvfmndukfalmlilhmxrwqnkbmbubjmhfywvurmrgrlmsubdefinitioncidjmpynyfyqnmwfpuzonorosnwkhvcjenedeun
gyjbktunupuwnqmlhsdknkbkynkoptixqnqzqcnucrzqhgnglgeneqtfyrwnwxwgnoevlgbmnmjminysxrolcncvcknigzxwvsnshsmn

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: subdefinition
Cipher: fhoqrsvavgvba

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: subdefinition
Cipher: 34542141511242334244424333

Extended Methods:
Method #1

Plaintext: subdefinition
method variations:
xzgiklosoyotscemopqtxtdtyxhkrtuvycyiydcnpwyzadhdodih

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s u b d e f i n i t i o n 
3 5 2 4 5 1 4 3 4 4 4 4 3 
4 4 1 1 1 2 2 3 2 4 2 3 3 
They are then read out in rows:
35245143444434411122324233
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: subdefinition
Cipher: xreottsdaghin

Read more ...
Method #3

Plaintext: subdefinition
method variations:
yiqvarmsrtrnn iqvarmsrtrnny qvarmsrtrnnyi
varmsrtrnnyiq armsrtrnnyiqv rmsrtrnnyiqva
msrtrnnyiqvar srtrnnyiqvarm rtrnnyiqvarms
trnnyiqvarmsr rnnyiqvarmsrt nnyiqvarmsrtr
nyiqvarmsrtrn

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: subdefinition

first 5040 cipher variations(6187239489 total)
subdefinition subdefinitino subdefinitoin subdefinitoni subdefinitnoi subdefinitnio subdefiniiton subdefiniitno subdefiniiotn
subdefiniiont subdefiniinot subdefiniinto subdefinioitn subdefinioint subdefiniotin subdefiniotni subdefinionti subdefinionit
subdefininiot subdefininito subdefininoit subdefininoti subdefinintoi subdefinintio subdefintiion subdefintiino subdefintioin
subdefintioni subdefintinoi subdefintinio subdefintiion subdefintiino subdefintioin subdefintioni subdefintinoi subdefintinio
subdefintoiin subdefintoini subdefintoiin subdefintoini subdefintonii subdefintonii subdefintnioi subdefintniio subdefintnoii
subdefintnoii subdefintnioi subdefintniio subdefinition subdefinitino subdefinitoin subdefinitoni subdefinitnoi subdefinitnio
subdefiniiton subdefiniitno subdefiniiotn subdefiniiont subdefiniinot subdefiniinto subdefinioitn subdefinioint subdefiniotin
subdefiniotni subdefinionti subdefinionit subdefininiot subdefininito subdefininoit subdefininoti subdefinintoi subdefinintio
subdefinotiin subdefinotini subdefinotiin subdefinotini subdefinotnii subdefinotnii subdefinoitin subdefinoitni subdefinoiitn
subdefinoiint subdefinoinit subdefinointi subdefinoiitn subdefinoiint subdefinoitin subdefinoitni subdefinointi subdefinoinit
subdefinoniit subdefinoniti subdefinoniit subdefinoniti subdefinontii subdefinontii subdefinntioi subdefinntiio subdefinntoii
subdefinntoii subdefinntioi subdefinntiio subdefinnitoi subdefinnitio subdefinnioti subdefinnioit subdefinniiot subdefinniito
subdefinnoiti subdefinnoiit subdefinnotii subdefinnotii subdefinnoiti subdefinnoiit subdefinniiot subdefinniito subdefinnioit
subdefinnioti subdefinnitoi subdefinnitio subdefiintion subdefiintino subdefiintoin subdefiintoni subdefiintnoi subdefiintnio
subdefiiniton subdefiinitno subdefiiniotn subdefiiniont subdefiininot subdefiininto subdefiinoitn subdefiinoint subdefiinotin
subdefiinotni subdefiinonti subdefiinonit subdefiinniot subdefiinnito subdefiinnoit subdefiinnoti subdefiinntoi subdefiinntio
subdefiitnion subdefiitnino subdefiitnoin subdefiitnoni subdefiitnnoi subdefiitnnio subdefiitinon subdefiitinno subdefiitionn
subdefiitionn subdefiitinon subdefiitinno subdefiitoinn subdefiitoinn subdefiitonin subdefiitonni subdefiitonni subdefiitonin
subdefiitnion subdefiitnino subdefiitnoin subdefiitnoni subdefiitnnoi subdefiitnnio subdefiiitnon subdefiiitnno subdefiiitonn
subdefiiitonn subdefiiitnon subdefiiitnno subdefiiinton subdefiiintno subdefiiinotn subdefiiinont subdefiiinnot subdefiiinnto
subdefiiiontn subdefiiionnt subdefiiiotnn subdefiiiotnn subdefiiiontn subdefiiionnt subdefiiinnot subdefiiinnto subdefiiinont
subdefiiinotn subdefiiinton subdefiiintno subdefiiotinn subdefiiotinn subdefiiotnin subdefiiotnni subdefiiotnni subdefiiotnin
subdefiioitnn subdefiioitnn subdefiiointn subdefiioinnt subdefiioinnt subdefiiointn subdefiionitn subdefiionint subdefiiontin
subdefiiontni subdefiionnti subdefiionnit subdefiionint subdefiionitn subdefiionnit subdefiionnti subdefiiontni subdefiiontin
subdefiintion subdefiintino subdefiintoin subdefiintoni subdefiintnoi subdefiintnio subdefiiniton subdefiinitno subdefiiniotn
subdefiiniont subdefiininot subdefiininto subdefiinoitn subdefiinoint subdefiinotin subdefiinotni subdefiinonti subdefiinonit
subdefiinniot subdefiinnito subdefiinnoit subdefiinnoti subdefiinntoi subdefiinntio subdefitinion subdefitinino subdefitinoin
subdefitinoni subdefitinnoi subdefitinnio subdefitiinon subdefitiinno subdefitiionn subdefitiionn subdefitiinon subdefitiinno
subdefitioinn subdefitioinn subdefitionin subdefitionni subdefitionni subdefitionin subdefitinion subdefitinino subdefitinoin
subdefitinoni subdefitinnoi subdefitinnio subdefitniion subdefitniino subdefitnioin subdefitnioni subdefitninoi subdefitninio
subdefitniion subdefitniino subdefitnioin subdefitnioni subdefitninoi subdefitninio subdefitnoiin subdefitnoini subdefitnoiin
subdefitnoini subdefitnonii subdefitnonii subdefitnnioi subdefitnniio subdefitnnoii subdefitnnoii subdefitnnioi subdefitnniio
subdefitinion subdefitinino subdefitinoin subdefitinoni subdefitinnoi subdefitinnio subdefitiinon subdefitiinno subdefitiionn
subdefitiionn subdefitiinon subdefitiinno subdefitioinn subdefitioinn subdefitionin subdefitionni subdefitionni subdefitionin
subdefitinion subdefitinino subdefitinoin subdefitinoni subdefitinnoi subdefitinnio subdefitoniin subdefitonini subdefitoniin
subdefitonini subdefitonnii subdefitonnii subdefitoinin subdefitoinni subdefitoiinn subdefitoiinn subdefitoinin subdefitoinni
subdefitoiinn subdefitoiinn subdefitoinin subdefitoinni subdefitoinni subdefitoinin subdefitoniin subdefitonini subdefitoniin
subdefitonini subdefitonnii subdefitonnii subdefitnnioi subdefitnniio subdefitnnoii subdefitnnoii subdefitnnioi subdefitnniio
subdefitninoi subdefitninio subdefitnioni subdefitnioin subdefitniion subdefitniino subdefitnoini subdefitnoiin subdefitnonii
subdefitnonii subdefitnoini subdefitnoiin subdefitniion subdefitniino subdefitnioin subdefitnioni subdefitninoi subdefitninio
subdefiiitnon subdefiiitnno subdefiiitonn subdefiiitonn subdefiiitnon subdefiiitnno subdefiiinton subdefiiintno subdefiiinotn
subdefiiinont subdefiiinnot subdefiiinnto subdefiiiontn subdefiiionnt subdefiiiotnn subdefiiiotnn subdefiiiontn subdefiiionnt
subdefiiinnot subdefiiinnto subdefiiinont subdefiiinotn subdefiiinton subdefiiintno subdefiitinon subdefiitinno subdefiitionn
subdefiitionn subdefiitinon subdefiitinno subdefiitnion subdefiitnino subdefiitnoin subdefiitnoni subdefiitnnoi subdefiitnnio
subdefiitonin subdefiitonni subdefiitoinn subdefiitoinn subdefiitonin subdefiitonni subdefiitnnoi subdefiitnnio subdefiitnoni
subdefiitnoin subdefiitnion subdefiitnino subdefiintion subdefiintino subdefiintoin subdefiintoni subdefiintnoi subdefiintnio
subdefiiniton subdefiinitno subdefiiniotn subdefiiniont subdefiininot subdefiininto subdefiinoitn subdefiinoint subdefiinotin
subdefiinotni subdefiinonti subdefiinonit subdefiinniot subdefiinnito subdefiinnoit subdefiinnoti subdefiinntoi subdefiinntio
subdefiiotnin subdefiiotnni subdefiiotinn subdefiiotinn subdefiiotnin subdefiiotnni subdefiiontin subdefiiontni subdefiionitn
subdefiionint subdefiionnit subdefiionnti subdefiiointn subdefiioinnt subdefiioitnn subdefiioitnn subdefiiointn subdefiioinnt
subdefiionnit subdefiionnti subdefiionint subdefiionitn subdefiiontin subdefiiontni subdefiintnoi subdefiintnio subdefiintoni
subdefiintoin subdefiintion subdefiintino subdefiinntoi subdefiinntio subdefiinnoti subdefiinnoit subdefiinniot subdefiinnito
subdefiinonti subdefiinonit subdefiinotni subdefiinotin subdefiinoitn subdefiinoint subdefiininot subdefiininto subdefiiniont
subdefiiniotn subdefiiniton subdefiinitno subdefioitinn subdefioitinn subdefioitnin subdefioitnni subdefioitnni subdefioitnin
subdefioiitnn subdefioiitnn subdefioiintn subdefioiinnt subdefioiinnt subdefioiintn subdefioinitn subdefioinint subdefiointin
subdefiointni subdefioinnti subdefioinnit subdefioinint subdefioinitn subdefioinnit subdefioinnti subdefiointni subdefiointin
subdefiotiinn subdefiotiinn subdefiotinin subdefiotinni subdefiotinni subdefiotinin subdefiotiinn subdefiotiinn subdefiotinin
subdefiotinni subdefiotinni subdefiotinin subdefiotniin subdefiotnini subdefiotniin subdefiotnini subdefiotnnii subdefiotnnii
subdefiotnini subdefiotniin subdefiotnnii subdefiotnnii subdefiotnini subdefiotniin subdefioitinn subdefioitinn subdefioitnin
subdefioitnni subdefioitnni subdefioitnin subdefioiitnn subdefioiitnn subdefioiintn subdefioiinnt subdefioiinnt subdefioiintn
subdefioinitn subdefioinint subdefiointin subdefiointni subdefioinnti subdefioinnit subdefioinint subdefioinitn subdefioinnit
subdefioinnti subdefiointni subdefiointin subdefiontiin subdefiontini subdefiontiin subdefiontini subdefiontnii subdefiontnii
subdefionitin subdefionitni subdefioniitn subdefioniint subdefioninit subdefioninti subdefioniitn subdefioniint subdefionitin
subdefionitni subdefioninti subdefioninit subdefionniit subdefionniti subdefionniit subdefionniti subdefionntii subdefionntii
subdefiontini subdefiontiin subdefiontnii subdefiontnii subdefiontini subdefiontiin subdefionitni subdefionitin subdefioninti
subdefioninit subdefioniint subdefioniitn subdefionniti subdefionniit subdefionntii subdefionntii subdefionniti subdefionniit
subdefioniint subdefioniitn subdefioninit subdefioninti subdefionitni subdefionitin subdefinition subdefinitino subdefinitoin
subdefinitoni subdefinitnoi subdefinitnio subdefiniiton subdefiniitno subdefiniiotn subdefiniiont subdefiniinot subdefiniinto
subdefinioitn subdefinioint subdefiniotin subdefiniotni subdefinionti subdefinionit subdefininiot subdefininito subdefininoit
subdefininoti subdefinintoi subdefinintio subdefintiion subdefintiino subdefintioin subdefintioni subdefintinoi subdefintinio
subdefintiion subdefintiino subdefintioin subdefintioni subdefintinoi subdefintinio subdefintoiin subdefintoini subdefintoiin
subdefintoini subdefintonii subdefintonii subdefintnioi subdefintniio subdefintnoii subdefintnoii subdefintnioi subdefintniio
subdefinition subdefinitino subdefinitoin subdefinitoni subdefinitnoi subdefinitnio subdefiniiton subdefiniitno subdefiniiotn
subdefiniiont subdefiniinot subdefiniinto subdefinioitn subdefinioint subdefiniotin subdefiniotni subdefinionti subdefinionit
subdefininiot subdefininito subdefininoit subdefininoti subdefinintoi subdefinintio subdefinotiin subdefinotini subdefinotiin
subdefinotini subdefinotnii subdefinotnii subdefinoitin subdefinoitni subdefinoiitn subdefinoiint subdefinoinit subdefinointi
subdefinoiitn subdefinoiint subdefinoitin subdefinoitni subdefinointi subdefinoinit subdefinoniit subdefinoniti subdefinoniit
subdefinoniti subdefinontii subdefinontii subdefinntioi subdefinntiio subdefinntoii subdefinntoii subdefinntioi subdefinntiio
subdefinnitoi subdefinnitio subdefinnioti subdefinnioit subdefinniiot subdefinniito subdefinnoiti subdefinnoiit subdefinnotii
subdefinnotii subdefinnoiti subdefinnoiit subdefinniiot subdefinniito subdefinnioit subdefinnioti subdefinnitoi subdefinnitio
subdefniition subdefniitino subdefniitoin subdefniitoni subdefniitnoi subdefniitnio subdefniiiton subdefniiitno subdefniiiotn
subdefniiiont subdefniiinot subdefniiinto subdefniioitn subdefniioint subdefniiotin subdefniiotni subdefniionti subdefniionit
subdefniiniot subdefniinito subdefniinoit subdefniinoti subdefniintoi subdefniintio subdefnitiion subdefnitiino subdefnitioin
subdefnitioni subdefnitinoi subdefnitinio subdefnitiion subdefnitiino subdefnitioin subdefnitioni subdefnitinoi subdefnitinio
subdefnitoiin subdefnitoini subdefnitoiin subdefnitoini subdefnitonii subdefnitonii subdefnitnioi subdefnitniio subdefnitnoii
subdefnitnoii subdefnitnioi subdefnitniio subdefniition subdefniitino subdefniitoin subdefniitoni subdefniitnoi subdefniitnio
subdefniiiton subdefniiitno subdefniiiotn subdefniiiont subdefniiinot subdefniiinto subdefniioitn subdefniioint subdefniiotin
subdefniiotni subdefniionti subdefniionit subdefniiniot subdefniinito subdefniinoit subdefniinoti subdefniintoi subdefniintio
subdefniotiin subdefniotini subdefniotiin subdefniotini subdefniotnii subdefniotnii subdefnioitin subdefnioitni subdefnioiitn
subdefnioiint subdefnioinit subdefniointi subdefnioiitn subdefnioiint subdefnioitin subdefnioitni subdefniointi subdefnioinit
subdefnioniit subdefnioniti subdefnioniit subdefnioniti subdefniontii subdefniontii subdefnintioi subdefnintiio subdefnintoii
subdefnintoii subdefnintioi subdefnintiio subdefninitoi subdefninitio subdefninioti subdefninioit subdefniniiot subdefniniito
subdefninoiti subdefninoiit subdefninotii subdefninotii subdefninoiti subdefninoiit subdefniniiot subdefniniito subdefninioit
subdefninioti subdefninitoi subdefninitio subdefniition subdefniitino subdefniitoin subdefniitoni subdefniitnoi subdefniitnio
subdefniiiton subdefniiitno subdefniiiotn subdefniiiont subdefniiinot subdefniiinto subdefniioitn subdefniioint subdefniiotin
subdefniiotni subdefniionti subdefniionit subdefniiniot subdefniinito subdefniinoit subdefniinoti subdefniintoi subdefniintio
subdefnitiion subdefnitiino subdefnitioin subdefnitioni subdefnitinoi subdefnitinio subdefnitiion subdefnitiino subdefnitioin
subdefnitioni subdefnitinoi subdefnitinio subdefnitoiin subdefnitoini subdefnitoiin subdefnitoini subdefnitonii subdefnitonii
subdefnitnioi subdefnitniio subdefnitnoii subdefnitnoii subdefnitnioi subdefnitniio subdefniition subdefniitino subdefniitoin
subdefniitoni subdefniitnoi subdefniitnio subdefniiiton subdefniiitno subdefniiiotn subdefniiiont subdefniiinot subdefniiinto
subdefniioitn subdefniioint subdefniiotin subdefniiotni subdefniionti subdefniionit subdefniiniot subdefniinito subdefniinoit
subdefniinoti subdefniintoi subdefniintio subdefniotiin subdefniotini subdefniotiin subdefniotini subdefniotnii subdefniotnii
subdefnioitin subdefnioitni subdefnioiitn subdefnioiint subdefnioinit subdefniointi subdefnioiitn subdefnioiint subdefnioitin
subdefnioitni subdefniointi subdefnioinit subdefnioniit subdefnioniti subdefnioniit subdefnioniti subdefniontii subdefniontii
subdefnintioi subdefnintiio subdefnintoii subdefnintoii subdefnintioi subdefnintiio subdefninitoi subdefninitio subdefninioti
subdefninioit subdefniniiot subdefniniito subdefninoiti subdefninoiit subdefninotii subdefninotii subdefninoiti subdefninoiit
subdefniniiot subdefniniito subdefninioit subdefninioti subdefninitoi subdefninitio subdefntiiion subdefntiiino subdefntiioin
subdefntiioni subdefntiinoi subdefntiinio subdefntiiion subdefntiiino subdefntiioin subdefntiioni subdefntiinoi subdefntiinio
subdefntioiin subdefntioini subdefntioiin subdefntioini subdefntionii subdefntionii subdefntinioi subdefntiniio subdefntinoii
subdefntinoii subdefntinioi subdefntiniio subdefntiiion subdefntiiino subdefntiioin subdefntiioni subdefntiinoi subdefntiinio
subdefntiiion subdefntiiino subdefntiioin subdefntiioni subdefntiinoi subdefntiinio subdefntioiin subdefntioini subdefntioiin
subdefntioini subdefntionii subdefntionii subdefntinioi subdefntiniio subdefntinoii subdefntinoii subdefntinioi subdefntiniio
subdefntiiion subdefntiiino subdefntiioin subdefntiioni subdefntiinoi subdefntiinio subdefntiiion subdefntiiino subdefntiioin
subdefntiioni subdefntiinoi subdefntiinio subdefntioiin subdefntioini subdefntioiin subdefntioini subdefntionii subdefntionii
subdefntinioi subdefntiniio subdefntinoii subdefntinoii subdefntinioi subdefntiniio subdefntoiiin subdefntoiini subdefntoiiin
subdefntoiini subdefntoinii subdefntoinii subdefntoiiin subdefntoiini subdefntoiiin subdefntoiini subdefntoinii subdefntoinii
subdefntoiiin subdefntoiini subdefntoiiin subdefntoiini subdefntoinii subdefntoinii subdefntoniii subdefntoniii subdefntoniii
subdefntoniii subdefntoniii subdefntoniii subdefntniioi subdefntniiio subdefntnioii subdefntnioii subdefntniioi subdefntniiio
subdefntniioi subdefntniiio subdefntnioii subdefntnioii subdefntniioi subdefntniiio subdefntnoiii subdefntnoiii subdefntnoiii
subdefntnoiii subdefntnoiii subdefntnoiii subdefntniioi subdefntniiio subdefntnioii subdefntnioii subdefntniioi subdefntniiio
subdefniition subdefniitino subdefniitoin subdefniitoni subdefniitnoi subdefniitnio subdefniiiton subdefniiitno subdefniiiotn
subdefniiiont subdefniiinot subdefniiinto subdefniioitn subdefniioint subdefniiotin subdefniiotni subdefniionti subdefniionit
subdefniiniot subdefniinito subdefniinoit subdefniinoti subdefniintoi subdefniintio subdefnitiion subdefnitiino subdefnitioin
subdefnitioni subdefnitinoi subdefnitinio subdefnitiion subdefnitiino subdefnitioin subdefnitioni subdefnitinoi subdefnitinio
subdefnitoiin subdefnitoini subdefnitoiin subdefnitoini subdefnitonii subdefnitonii subdefnitnioi subdefnitniio subdefnitnoii
subdefnitnoii subdefnitnioi subdefnitniio subdefniition subdefniitino subdefniitoin subdefniitoni subdefniitnoi subdefniitnio
subdefniiiton subdefniiitno subdefniiiotn subdefniiiont subdefniiinot subdefniiinto subdefniioitn subdefniioint subdefniiotin
subdefniiotni subdefniionti subdefniionit subdefniiniot subdefniinito subdefniinoit subdefniinoti subdefniintoi subdefniintio
subdefniotiin subdefniotini subdefniotiin subdefniotini subdefniotnii subdefniotnii subdefnioitin subdefnioitni subdefnioiitn
subdefnioiint subdefnioinit subdefniointi subdefnioiitn subdefnioiint subdefnioitin subdefnioitni subdefniointi subdefnioinit
subdefnioniit subdefnioniti subdefnioniit subdefnioniti subdefniontii subdefniontii subdefnintioi subdefnintiio subdefnintoii
subdefnintoii subdefnintioi subdefnintiio subdefninitoi subdefninitio subdefninioti subdefninioit subdefniniiot subdefniniito
subdefninoiti subdefninoiit subdefninotii subdefninotii subdefninoiti subdefninoiit subdefniniiot subdefniniito subdefninioit
subdefninioti subdefninitoi subdefninitio subdefnoitiin subdefnoitini subdefnoitiin subdefnoitini subdefnoitnii subdefnoitnii
subdefnoiitin subdefnoiitni subdefnoiiitn subdefnoiiint subdefnoiinit subdefnoiinti subdefnoiiitn subdefnoiiint subdefnoiitin
subdefnoiitni subdefnoiinti subdefnoiinit subdefnoiniit subdefnoiniti subdefnoiniit subdefnoiniti subdefnointii subdefnointii
subdefnotiiin subdefnotiini subdefnotiiin subdefnotiini subdefnotinii subdefnotinii subdefnotiiin subdefnotiini subdefnotiiin
subdefnotiini subdefnotinii subdefnotinii subdefnotiiin subdefnotiini subdefnotiiin subdefnotiini subdefnotinii subdefnotinii
subdefnotniii subdefnotniii subdefnotniii subdefnotniii subdefnotniii subdefnotniii subdefnoitiin subdefnoitini subdefnoitiin
subdefnoitini subdefnoitnii subdefnoitnii subdefnoiitin subdefnoiitni subdefnoiiitn subdefnoiiint subdefnoiinit subdefnoiinti
subdefnoiiitn subdefnoiiint subdefnoiitin subdefnoiitni subdefnoiinti subdefnoiinit subdefnoiniit subdefnoiniti subdefnoiniit
subdefnoiniti subdefnointii subdefnointii subdefnoitiin subdefnoitini subdefnoitiin subdefnoitini subdefnoitnii subdefnoitnii
subdefnoiitin subdefnoiitni subdefnoiiitn subdefnoiiint subdefnoiinit subdefnoiinti subdefnoiiitn subdefnoiiint subdefnoiitin
subdefnoiitni subdefnoiinti subdefnoiinit subdefnoiniit subdefnoiniti subdefnoiniit subdefnoiniti subdefnointii subdefnointii
subdefnontiii subdefnontiii subdefnontiii subdefnontiii subdefnontiii subdefnontiii subdefnonitii subdefnonitii subdefnoniiti
subdefnoniiit subdefnoniiit subdefnoniiti subdefnoniiti subdefnoniiit subdefnonitii subdefnonitii subdefnoniiti subdefnoniiit
subdefnoniiit subdefnoniiti subdefnoniiit subdefnoniiti subdefnonitii subdefnonitii subdefnnitioi subdefnnitiio subdefnnitoii
subdefnnitoii subdefnnitioi subdefnnitiio subdefnniitoi subdefnniitio subdefnniioti subdefnniioit subdefnniiiot subdefnniiito
subdefnnioiti subdefnnioiit subdefnniotii subdefnniotii subdefnnioiti subdefnnioiit subdefnniiiot subdefnniiito subdefnniioit
subdefnniioti subdefnniitoi subdefnniitio subdefnntiioi subdefnntiiio subdefnntioii subdefnntioii subdefnntiioi subdefnntiiio
subdefnntiioi subdefnntiiio subdefnntioii subdefnntioii subdefnntiioi subdefnntiiio subdefnntoiii subdefnntoiii subdefnntoiii
subdefnntoiii subdefnntoiii subdefnntoiii subdefnntiioi subdefnntiiio subdefnntioii subdefnntioii subdefnntiioi subdefnntiiio
subdefnnitioi subdefnnitiio subdefnnitoii subdefnnitoii subdefnnitioi subdefnnitiio subdefnniitoi subdefnniitio subdefnniioti
subdefnniioit subdefnniiiot subdefnniiito subdefnnioiti subdefnnioiit subdefnniotii subdefnniotii subdefnnioiti subdefnnioiit
subdefnniiiot subdefnniiito subdefnniioit subdefnniioti subdefnniitoi subdefnniitio subdefnnotiii subdefnnotiii subdefnnotiii
subdefnnotiii subdefnnotiii subdefnnotiii subdefnnoitii subdefnnoitii subdefnnoiiti subdefnnoiiit subdefnnoiiit subdefnnoiiti
subdefnnoiiti subdefnnoiiit subdefnnoitii subdefnnoitii subdefnnoiiti subdefnnoiiit subdefnnoiiit subdefnnoiiti subdefnnoiiit
subdefnnoiiti subdefnnoitii subdefnnoitii subdefnnitioi subdefnnitiio subdefnnitoii subdefnnitoii subdefnnitioi subdefnnitiio
subdefnniitoi subdefnniitio subdefnniioti subdefnniioit subdefnniiiot subdefnniiito subdefnnioiti subdefnnioiit subdefnniotii
subdefnniotii subdefnnioiti subdefnnioiit subdefnniiiot subdefnniiito subdefnniioit subdefnniioti subdefnniitoi subdefnniitio
subdefinition subdefinitino subdefinitoin subdefinitoni subdefinitnoi subdefinitnio subdefiniiton subdefiniitno subdefiniiotn
subdefiniiont subdefiniinot subdefiniinto subdefinioitn subdefinioint subdefiniotin subdefiniotni subdefinionti subdefinionit
subdefininiot subdefininito subdefininoit subdefininoti subdefinintoi subdefinintio subdefintiion subdefintiino subdefintioin
subdefintioni subdefintinoi subdefintinio subdefintiion subdefintiino subdefintioin subdefintioni subdefintinoi subdefintinio
subdefintoiin subdefintoini subdefintoiin subdefintoini subdefintonii subdefintonii subdefintnioi subdefintniio subdefintnoii
subdefintnoii subdefintnioi subdefintniio subdefinition subdefinitino subdefinitoin subdefinitoni subdefinitnoi subdefinitnio
subdefiniiton subdefiniitno subdefiniiotn subdefiniiont subdefiniinot subdefiniinto subdefinioitn subdefinioint subdefiniotin
subdefiniotni subdefinionti subdefinionit subdefininiot subdefininito subdefininoit subdefininoti subdefinintoi subdefinintio
subdefinotiin subdefinotini subdefinotiin subdefinotini subdefinotnii subdefinotnii subdefinoitin subdefinoitni subdefinoiitn
subdefinoiint subdefinoinit subdefinointi subdefinoiitn subdefinoiint subdefinoitin subdefinoitni subdefinointi subdefinoinit
subdefinoniit subdefinoniti subdefinoniit subdefinoniti subdefinontii subdefinontii subdefinntioi subdefinntiio subdefinntoii
subdefinntoii subdefinntioi subdefinntiio subdefinnitoi subdefinnitio subdefinnioti subdefinnioit subdefinniiot subdefinniito
subdefinnoiti subdefinnoiit subdefinnotii subdefinnotii subdefinnoiti subdefinnoiit subdefinniiot subdefinniito subdefinnioit
subdefinnioti subdefinnitoi subdefinnitio subdefiintion subdefiintino subdefiintoin subdefiintoni subdefiintnoi subdefiintnio
subdefiiniton subdefiinitno subdefiiniotn subdefiiniont subdefiininot subdefiininto subdefiinoitn subdefiinoint subdefiinotin
subdefiinotni subdefiinonti subdefiinonit subdefiinniot subdefiinnito subdefiinnoit subdefiinnoti subdefiinntoi subdefiinntio
subdefiitnion subdefiitnino subdefiitnoin subdefiitnoni subdefiitnnoi subdefiitnnio subdefiitinon subdefiitinno subdefiitionn
subdefiitionn subdefiitinon subdefiitinno subdefiitoinn subdefiitoinn subdefiitonin subdefiitonni subdefiitonni subdefiitonin
subdefiitnion subdefiitnino subdefiitnoin subdefiitnoni subdefiitnnoi subdefiitnnio subdefiiitnon subdefiiitnno subdefiiitonn
subdefiiitonn subdefiiitnon subdefiiitnno subdefiiinton subdefiiintno subdefiiinotn subdefiiinont subdefiiinnot subdefiiinnto
subdefiiiontn subdefiiionnt subdefiiiotnn subdefiiiotnn subdefiiiontn subdefiiionnt subdefiiinnot subdefiiinnto subdefiiinont
subdefiiinotn subdefiiinton subdefiiintno subdefiiotinn subdefiiotinn subdefiiotnin subdefiiotnni subdefiiotnni subdefiiotnin
subdefiioitnn subdefiioitnn subdefiiointn subdefiioinnt subdefiioinnt subdefiiointn subdefiionitn subdefiionint subdefiiontin
subdefiiontni subdefiionnti subdefiionnit subdefiionint subdefiionitn subdefiionnit subdefiionnti subdefiiontni subdefiiontin
subdefiintion subdefiintino subdefiintoin subdefiintoni subdefiintnoi subdefiintnio subdefiiniton subdefiinitno subdefiiniotn
subdefiiniont subdefiininot subdefiininto subdefiinoitn subdefiinoint subdefiinotin subdefiinotni subdefiinonti subdefiinonit
subdefiinniot subdefiinnito subdefiinnoit subdefiinnoti subdefiinntoi subdefiinntio subdefitinion subdefitinino subdefitinoin
subdefitinoni subdefitinnoi subdefitinnio subdefitiinon subdefitiinno subdefitiionn subdefitiionn subdefitiinon subdefitiinno
subdefitioinn subdefitioinn subdefitionin subdefitionni subdefitionni subdefitionin subdefitinion subdefitinino subdefitinoin
subdefitinoni subdefitinnoi subdefitinnio subdefitniion subdefitniino subdefitnioin subdefitnioni subdefitninoi subdefitninio
subdefitniion subdefitniino subdefitnioin subdefitnioni subdefitninoi subdefitninio subdefitnoiin subdefitnoini subdefitnoiin
subdefitnoini subdefitnonii subdefitnonii subdefitnnioi subdefitnniio subdefitnnoii subdefitnnoii subdefitnnioi subdefitnniio
subdefitinion subdefitinino subdefitinoin subdefitinoni subdefitinnoi subdefitinnio subdefitiinon subdefitiinno subdefitiionn
subdefitiionn subdefitiinon subdefitiinno subdefitioinn subdefitioinn subdefitionin subdefitionni subdefitionni subdefitionin
subdefitinion subdefitinino subdefitinoin subdefitinoni subdefitinnoi subdefitinnio subdefitoniin subdefitonini subdefitoniin
subdefitonini subdefitonnii subdefitonnii subdefitoinin subdefitoinni subdefitoiinn subdefitoiinn subdefitoinin subdefitoinni
subdefitoiinn subdefitoiinn subdefitoinin subdefitoinni subdefitoinni subdefitoinin subdefitoniin subdefitonini subdefitoniin
subdefitonini subdefitonnii subdefitonnii subdefitnnioi subdefitnniio subdefitnnoii subdefitnnoii subdefitnnioi subdefitnniio
subdefitninoi subdefitninio subdefitnioni subdefitnioin subdefitniion subdefitniino subdefitnoini subdefitnoiin subdefitnonii
subdefitnonii subdefitnoini subdefitnoiin subdefitniion subdefitniino subdefitnioin subdefitnioni subdefitninoi subdefitninio
subdefiiitnon subdefiiitnno subdefiiitonn subdefiiitonn subdefiiitnon subdefiiitnno subdefiiinton subdefiiintno subdefiiinotn
subdefiiinont subdefiiinnot subdefiiinnto subdefiiiontn subdefiiionnt subdefiiiotnn subdefiiiotnn subdefiiiontn subdefiiionnt
subdefiiinnot subdefiiinnto subdefiiinont subdefiiinotn subdefiiinton subdefiiintno subdefiitinon subdefiitinno subdefiitionn
subdefiitionn subdefiitinon subdefiitinno subdefiitnion subdefiitnino subdefiitnoin subdefiitnoni subdefiitnnoi subdefiitnnio
subdefiitonin subdefiitonni subdefiitoinn subdefiitoinn subdefiitonin subdefiitonni subdefiitnnoi subdefiitnnio subdefiitnoni
subdefiitnoin subdefiitnion subdefiitnino subdefiintion subdefiintino subdefiintoin subdefiintoni subdefiintnoi subdefiintnio
subdefiiniton subdefiinitno subdefiiniotn subdefiiniont subdefiininot subdefiininto subdefiinoitn subdefiinoint subdefiinotin
subdefiinotni subdefiinonti subdefiinonit subdefiinniot subdefiinnito subdefiinnoit subdefiinnoti subdefiinntoi subdefiinntio
subdefiiotnin subdefiiotnni subdefiiotinn subdefiiotinn subdefiiotnin subdefiiotnni subdefiiontin subdefiiontni subdefiionitn
subdefiionint subdefiionnit subdefiionnti subdefiiointn subdefiioinnt subdefiioitnn subdefiioitnn subdefiiointn subdefiioinnt
subdefiionnit subdefiionnti subdefiionint subdefiionitn subdefiiontin subdefiiontni subdefiintnoi subdefiintnio subdefiintoni
subdefiintoin subdefiintion subdefiintino subdefiinntoi subdefiinntio subdefiinnoti subdefiinnoit subdefiinniot subdefiinnito
subdefiinonti subdefiinonit subdefiinotni subdefiinotin subdefiinoitn subdefiinoint subdefiininot subdefiininto subdefiiniont
subdefiiniotn subdefiiniton subdefiinitno subdefioitinn subdefioitinn subdefioitnin subdefioitnni subdefioitnni subdefioitnin
subdefioiitnn subdefioiitnn subdefioiintn subdefioiinnt subdefioiinnt subdefioiintn subdefioinitn subdefioinint subdefiointin
subdefiointni subdefioinnti subdefioinnit subdefioinint subdefioinitn subdefioinnit subdefioinnti subdefiointni subdefiointin
subdefiotiinn subdefiotiinn subdefiotinin subdefiotinni subdefiotinni subdefiotinin subdefiotiinn subdefiotiinn subdefiotinin
subdefiotinni subdefiotinni subdefiotinin subdefiotniin subdefiotnini subdefiotniin subdefiotnini subdefiotnnii subdefiotnnii
subdefiotnini subdefiotniin subdefiotnnii subdefiotnnii subdefiotnini subdefiotniin subdefioitinn subdefioitinn subdefioitnin
subdefioitnni subdefioitnni subdefioitnin subdefioiitnn subdefioiitnn subdefioiintn subdefioiinnt subdefioiinnt subdefioiintn
subdefioinitn subdefioinint subdefiointin subdefiointni subdefioinnti subdefioinnit subdefioinint subdefioinitn subdefioinnit
subdefioinnti subdefiointni subdefiointin subdefiontiin subdefiontini subdefiontiin subdefiontini subdefiontnii subdefiontnii
subdefionitin subdefionitni subdefioniitn subdefioniint subdefioninit subdefioninti subdefioniitn subdefioniint subdefionitin
subdefionitni subdefioninti subdefioninit subdefionniit subdefionniti subdefionniit subdefionniti subdefionntii subdefionntii
subdefiontini subdefiontiin subdefiontnii subdefiontnii subdefiontini subdefiontiin subdefionitni subdefionitin subdefioninti
subdefioninit subdefioniint subdefioniitn subdefionniti subdefionniit subdefionntii subdefionntii subdefionniti subdefionniit
subdefioniint subdefioniitn subdefioninit subdefioninti subdefionitni subdefionitin subdefinition subdefinitino subdefinitoin
subdefinitoni subdefinitnoi subdefinitnio subdefiniiton subdefiniitno subdefiniiotn subdefiniiont subdefiniinot subdefiniinto
subdefinioitn subdefinioint subdefiniotin subdefiniotni subdefinionti subdefinionit subdefininiot subdefininito subdefininoit
subdefininoti subdefinintoi subdefinintio subdefintiion subdefintiino subdefintioin subdefintioni subdefintinoi subdefintinio
subdefintiion subdefintiino subdefintioin subdefintioni subdefintinoi subdefintinio subdefintoiin subdefintoini subdefintoiin
subdefintoini subdefintonii subdefintonii subdefintnioi subdefintniio subdefintnoii subdefintnoii subdefintnioi subdefintniio
subdefinition subdefinitino subdefinitoin subdefinitoni subdefinitnoi subdefinitnio subdefiniiton subdefiniitno subdefiniiotn
subdefiniiont subdefiniinot subdefiniinto subdefinioitn subdefinioint subdefiniotin subdefiniotni subdefinionti subdefinionit
subdefininiot subdefininito subdefininoit subdefininoti subdefinintoi subdefinintio subdefinotiin subdefinotini subdefinotiin
subdefinotini subdefinotnii subdefinotnii subdefinoitin subdefinoitni subdefinoiitn subdefinoiint subdefinoinit subdefinointi
subdefinoiitn subdefinoiint subdefinoitin subdefinoitni subdefinointi subdefinoinit subdefinoniit subdefinoniti subdefinoniit
subdefinoniti subdefinontii subdefinontii subdefinntioi subdefinntiio subdefinntoii subdefinntoii subdefinntioi subdefinntiio
subdefinnitoi subdefinnitio subdefinnioti subdefinnioit subdefinniiot subdefinniito subdefinnoiti subdefinnoiit subdefinnotii
subdefinnotii subdefinnoiti subdefinnoiit subdefinniiot subdefinniito subdefinnioit subdefinnioti subdefinnitoi subdefinnitio
subdeftniiion subdeftniiino subdeftniioin subdeftniioni subdeftniinoi subdeftniinio subdeftniiion subdeftniiino subdeftniioin
subdeftniioni subdeftniinoi subdeftniinio subdeftnioiin subdeftnioini subdeftnioiin subdeftnioini subdeftnionii subdeftnionii
subdeftninioi subdeftniniio subdeftninoii subdeftninoii subdeftninioi subdeftniniio subdeftniiion subdeftniiino subdeftniioin
subdeftniioni subdeftniinoi subdeftniinio subdeftniiion subdeftniiino subdeftniioin subdeftniioni subdeftniinoi subdeftniinio
subdeftnioiin subdeftnioini subdeftnioiin subdeftnioini subdeftnionii subdeftnionii subdeftninioi subdeftniniio subdeftninoii
subdeftninoii subdeftninioi subdeftniniio subdeftniiion subdeftniiino subdeftniioin subdeftniioni subdeftniinoi subdeftniinio
subdeftniiion subdeftniiino subdeftniioin subdeftniioni subdeftniinoi subdeftniinio subdeftnioiin subdeftnioini subdeftnioiin
subdeftnioini subdeftnionii subdeftnionii subdeftninioi subdeftniniio subdeftninoii subdeftninoii subdeftninioi subdeftniniio
subdeftnoiiin subdeftnoiini subdeftnoiiin subdeftnoiini subdeftnoinii subdeftnoinii subdeftnoiiin subdeftnoiini subdeftnoiiin
subdeftnoiini subdeftnoinii subdeftnoinii subdeftnoiiin subdeftnoiini subdeftnoiiin subdeftnoiini subdeftnoinii subdeftnoinii
subdeftnoniii subdeftnoniii subdeftnoniii subdeftnoniii subdeftnoniii subdeftnoniii subdeftnniioi subdeftnniiio subdeftnnioii
subdeftnnioii subdeftnniioi subdeftnniiio subdeftnniioi subdeftnniiio subdeftnnioii subdeftnnioii subdeftnniioi subdeftnniiio
subdeftnnoiii subdeftnnoiii subdeftnnoiii subdeftnnoiii subdeftnnoiii subdeftnnoiii subdeftnniioi subdeftnniiio subdeftnnioii
subdeftnnioii subdeftnniioi subdeftnniiio subdeftiniion subdeftiniino subdeftinioin subdeftinioni subdeftininoi subdeftininio
subdeftiniion subdeftiniino subdeftinioin subdeftinioni subdeftininoi subdeftininio subdeftinoiin subdeftinoini subdeftinoiin
subdeftinoini subdeftinonii subdeftinonii subdeftinnioi subdeftinniio subdeftinnoii subdeftinnoii subdeftinnioi subdeftinniio
subdeftiinion subdeftiinino subdeftiinoin subdeftiinoni subdeftiinnoi subdeftiinnio subdeftiiinon subdeftiiinno subdeftiiionn
subdeftiiionn subdeftiiinon subdeftiiinno subdeftiioinn subdeftiioinn subdeftiionin subdeftiionni subdeftiionni subdeftiionin
subdeftiinion subdeftiinino subdeftiinoin subdeftiinoni subdeftiinnoi subdeftiinnio subdeftiiinon subdeftiiinno subdeftiiionn
subdeftiiionn subdeftiiinon subdeftiiinno subdeftiinion subdeftiinino subdeftiinoin subdeftiinoni subdeftiinnoi subdeftiinnio
subdeftiionin subdeftiionni subdeftiioinn subdeftiioinn subdeftiionin subdeftiionni subdeftiinnoi subdeftiinnio subdeftiinoni
subdeftiinoin subdeftiinion subdeftiinino subdeftioiinn subdeftioiinn subdeftioinin subdeftioinni subdeftioinni subdeftioinin
subdeftioiinn subdeftioiinn subdeftioinin subdeftioinni subdeftioinni subdeftioinin subdeftioniin subdeftionini subdeftioniin
subdeftionini subdeftionnii subdeftionnii subdeftionini subdeftioniin subdeftionnii subdeftionnii subdeftionini subdeftioniin
subdeftiniion subdeftiniino subdeftinioin subdeftinioni subdeftininoi subdeftininio subdeftiniion subdeftiniino subdeftinioin
subdeftinioni subdeftininoi subdeftininio subdeftinoiin subdeftinoini subdeftinoiin subdeftinoini subdeftinonii subdeftinonii
subdeftinnioi subdeftinniio subdeftinnoii subdeftinnoii subdeftinnioi subdeftinniio subdeftiinion subdeftiinino subdeftiinoin
subdeftiinoni subdeftiinnoi subdeftiinnio subdeftiiinon subdeftiiinno subdeftiiionn subdeftiiionn subdeftiiinon subdeftiiinno
subdeftiioinn subdeftiioinn subdeftiionin subdeftiionni subdeftiionni subdeftiionin subdeftiinion subdeftiinino subdeftiinoin
subdeftiinoni subdeftiinnoi subdeftiinnio subdeftiniion subdeftiniino subdeftinioin subdeftinioni subdeftininoi subdeftininio
subdeftiniion subdeftiniino subdeftinioin subdeftinioni subdeftininoi subdeftininio subdeftinoiin subdeftinoini subdeftinoiin
subdeftinoini subdeftinonii subdeftinonii subdeftinnioi subdeftinniio subdeftinnoii subdeftinnoii subdeftinnioi subdeftinniio
subdeftiinion subdeftiinino subdeftiinoin subdeftiinoni subdeftiinnoi subdeftiinnio subdeftiiinon subdeftiiinno subdeftiiionn
subdeftiiionn subdeftiiinon subdeftiiinno subdeftiioinn subdeftiioinn subdeftiionin subdeftiionni subdeftiionni subdeftiionin
subdeftiinion subdeftiinino subdeftiinoin subdeftiinoni subdeftiinnoi subdeftiinnio subdeftioniin subdeftionini subdeftioniin
subdeftionini subdeftionnii subdeftionnii subdeftioinin subdeftioinni subdeftioiinn subdeftioiinn subdeftioinin subdeftioinni
subdeftioiinn subdeftioiinn subdeftioinin subdeftioinni subdeftioinni subdeftioinin subdeftioniin subdeftionini subdeftioniin
subdeftionini subdeftionnii subdeftionnii subdeftinnioi subdeftinniio subdeftinnoii subdeftinnoii subdeftinnioi subdeftinniio
subdeftininoi subdeftininio subdeftinioni subdeftinioin subdeftiniion subdeftiniino subdeftinoini subdeftinoiin subdeftinonii
subdeftinonii subdeftinoini subdeftinoiin subdeftiniion subdeftiniino subdeftinioin subdeftinioni subdeftininoi subdeftininio
subdeftiiinon subdeftiiinno subdeftiiionn subdeftiiionn subdeftiiinon subdeftiiinno subdeftiinion subdeftiinino subdeftiinoin
subdeftiinoni subdeftiinnoi subdeftiinnio subdeftiionin subdeftiionni subdeftiioinn subdeftiioinn subdeftiionin subdeftiionni
subdeftiinnoi subdeftiinnio subdeftiinoni subdeftiinoin subdeftiinion subdeftiinino subdeftiiinon subdeftiiinno subdeftiiionn
subdeftiiionn subdeftiiinon subdeftiiinno subdeftiinion subdeftiinino subdeftiinoin subdeftiinoni subdeftiinnoi subdeftiinnio
subdeftiionin subdeftiionni subdeftiioinn subdeftiioinn subdeftiionin subdeftiionni subdeftiinnoi subdeftiinnio subdeftiinoni
subdeftiinoin subdeftiinion subdeftiinino subdeftiniion subdeftiniino subdeftinioin subdeftinioni subdeftininoi subdeftininio
subdeftiniion subdeftiniino subdeftinioin subdeftinioni subdeftininoi subdeftininio subdeftinoiin subdeftinoini subdeftinoiin
subdeftinoini subdeftinonii subdeftinonii subdeftinnioi subdeftinniio subdeftinnoii subdeftinnoii subdeftinnioi subdeftinniio
subdeftioinin subdeftioinni subdeftioiinn subdeftioiinn subdeftioinin subdeftioinni subdeftioniin subdeftionini subdeftioniin
subdeftionini subdeftionnii subdeftionnii subdeftioinin subdeftioinni subdeftioiinn subdeftioiinn subdeftioinin subdeftioinni
subdeftionnii subdeftionnii subdeftionini subdeftioniin subdeftioniin subdeftionini subdeftininoi subdeftininio subdeftinioni
subdeftinioin subdeftiniion subdeftiniino subdeftinnioi subdeftinniio subdeftinnoii subdeftinnoii subdeftinnioi subdeftinniio
subdeftinonii subdeftinonii subdeftinoini subdeftinoiin subdeftinoiin subdeftinoini subdeftininoi subdeftininio subdeftinioni
subdeftinioin subdeftiniion subdeftiniino subdeftoiiinn subdeftoiiinn subdeftoiinin subdeftoiinni subdeftoiinni subdeftoiinin
subdeftoiiinn subdeftoiiinn subdeftoiinin subdeftoiinni subdeftoiinni subdeftoiinin subdeftoiniin subdeftoinini subdeftoiniin
subdeftoinini subdeftoinnii subdeftoinnii subdeftoinini subdeftoiniin subdeftoinnii subdeftoinnii subdeftoinini subdeftoiniin
subdeftoiiinn subdeftoiiinn subdeftoiinin subdeftoiinni subdeftoiinni subdeftoiinin subdeftoiiinn subdeftoiiinn subdeftoiinin
subdeftoiinni subdeftoiinni subdeftoiinin subdeftoiniin subdeftoinini subdeftoiniin subdeftoinini subdeftoinnii subdeftoinnii
subdeftoinini subdeftoiniin subdeftoinnii subdeftoinnii subdeftoinini subdeftoiniin subdeftoiiinn subdeftoiiinn subdeftoiinin
subdeftoiinni subdeftoiinni subdeftoiinin subdeftoiiinn subdeftoiiinn subdeftoiinin subdeftoiinni subdeftoiinni subdeftoiinin
subdeftoiniin subdeftoinini subdeftoiniin subdeftoinini subdeftoinnii subdeftoinnii subdeftoinini subdeftoiniin subdeftoinnii
subdeftoinnii subdeftoinini subdeftoiniin subdeftoniiin subdeftoniini subdeftoniiin subdeftoniini subdeftoninii subdeftoninii
subdeftoniiin subdeftoniini subdeftoniiin subdeftoniini subdeftoninii subdeftoninii subdeftoniiin subdeftoniini subdeftoniiin
subdeftoniini subdeftoninii subdeftoninii subdeftonniii subdeftonniii subdeftonniii subdeftonniii subdeftonniii subdeftonniii
subdeftoniini subdeftoniiin subdeftoninii subdeftoninii subdeftoniini subdeftoniiin subdeftoniini subdeftoniiin subdeftoninii
subdeftoninii subdeftoniini subdeftoniiin subdeftonniii subdeftonniii subdeftonniii subdeftonniii subdeftonniii subdeftonniii
subdeftoniini subdeftoniiin subdeftoninii subdeftoninii subdeftoniini subdeftoniiin subdeftniiion subdeftniiino subdeftniioin
subdeftniioni subdeftniinoi subdeftniinio subdeftniiion subdeftniiino subdeftniioin subdeftniioni subdeftniinoi subdeftniinio
subdeftnioiin subdeftnioini subdeftnioiin subdeftnioini subdeftnionii subdeftnionii subdeftninioi subdeftniniio subdeftninoii
subdeftninoii subdeftninioi subdeftniniio subdeftniiion subdeftniiino subdeftniioin subdeftniioni subdeftniinoi subdeftniinio
subdeftniiion subdeftniiino subdeftniioin subdeftniioni subdeftniinoi subdeftniinio subdeftnioiin subdeftnioini subdeftnioiin
subdeftnioini subdeftnionii subdeftnionii subdeftninioi subdeftniniio subdeftninoii subdeftninoii subdeftninioi subdeftniniio
subdeftniiion subdeftniiino subdeftniioin subdeftniioni subdeftniinoi subdeftniinio subdeftniiion subdeftniiino subdeftniioin
subdeftniioni subdeftniinoi subdeftniinio subdeftnioiin subdeftnioini subdeftnioiin subdeftnioini subdeftnionii subdeftnionii
subdeftninioi subdeftniniio subdeftninoii subdeftninoii subdeftninioi subdeftniniio subdeftnoiiin subdeftnoiini subdeftnoiiin
subdeftnoiini subdeftnoinii subdeftnoinii subdeftnoiiin subdeftnoiini subdeftnoiiin subdeftnoiini subdeftnoinii subdeftnoinii
subdeftnoiiin subdeftnoiini subdeftnoiiin subdeftnoiini subdeftnoinii subdeftnoinii subdeftnoniii subdeftnoniii subdeftnoniii
subdeftnoniii subdeftnoniii subdeftnoniii subdeftnniioi subdeftnniiio subdeftnnioii subdeftnnioii subdeftnniioi subdeftnniiio
subdeftnniioi subdeftnniiio subdeftnnioii subdeftnnioii subdeftnniioi subdeftnniiio subdeftnnoiii subdeftnnoiii subdeftnnoiii
subdeftnnoiii subdeftnnoiii subdeftnnoiii subdeftnniioi subdeftnniiio subdeftnnioii subdeftnnioii subdeftnniioi subdeftnniiio
subdefinition subdefinitino subdefinitoin subdefinitoni subdefinitnoi subdefinitnio subdefiniiton subdefiniitno subdefiniiotn
subdefiniiont subdefiniinot subdefiniinto subdefinioitn subdefinioint subdefiniotin subdefiniotni subdefinionti subdefinionit
subdefininiot subdefininito subdefininoit subdefininoti subdefinintoi subdefinintio subdefintiion subdefintiino subdefintioin
subdefintioni subdefintinoi subdefintinio subdefintiion subdefintiino subdefintioin subdefintioni subdefintinoi subdefintinio
subdefintoiin subdefintoini subdefintoiin subdefintoini subdefintonii subdefintonii subdefintnioi subdefintniio subdefintnoii
subdefintnoii subdefintnioi subdefintniio subdefinition subdefinitino subdefinitoin subdefinitoni subdefinitnoi subdefinitnio
subdefiniiton subdefiniitno subdefiniiotn subdefiniiont subdefiniinot subdefiniinto subdefinioitn subdefinioint subdefiniotin
subdefiniotni subdefinionti subdefinionit subdefininiot subdefininito subdefininoit subdefininoti subdefinintoi subdefinintio
subdefinotiin subdefinotini subdefinotiin subdefinotini subdefinotnii subdefinotnii subdefinoitin subdefinoitni subdefinoiitn
subdefinoiint subdefinoinit subdefinointi subdefinoiitn subdefinoiint subdefinoitin subdefinoitni subdefinointi subdefinoinit
subdefinoniit subdefinoniti subdefinoniit subdefinoniti subdefinontii subdefinontii subdefinntioi subdefinntiio subdefinntoii
subdefinntoii subdefinntioi subdefinntiio subdefinnitoi subdefinnitio subdefinnioti subdefinnioit subdefinniiot subdefinniito
subdefinnoiti subdefinnoiit subdefinnotii subdefinnotii subdefinnoiti subdefinnoiit subdefinniiot subdefinniito subdefinnioit
subdefinnioti subdefinnitoi subdefinnitio subdefiintion subdefiintino subdefiintoin subdefiintoni subdefiintnoi subdefiintnio
subdefiiniton subdefiinitno subdefiiniotn subdefiiniont subdefiininot subdefiininto subdefiinoitn subdefiinoint subdefiinotin
subdefiinotni subdefiinonti subdefiinonit subdefiinniot subdefiinnito subdefiinnoit subdefiinnoti subdefiinntoi subdefiinntio
subdefiitnion subdefiitnino subdefiitnoin subdefiitnoni subdefiitnnoi subdefiitnnio subdefiitinon subdefiitinno subdefiitionn
subdefiitionn subdefiitinon subdefiitinno subdefiitoinn subdefiitoinn subdefiitonin subdefiitonni subdefiitonni subdefiitonin
subdefiitnion subdefiitnino subdefiitnoin subdefiitnoni subdefiitnnoi subdefiitnnio subdefiiitnon subdefiiitnno subdefiiitonn
subdefiiitonn subdefiiitnon subdefiiitnno subdefiiinton subdefiiintno subdefiiinotn subdefiiinont subdefiiinnot subdefiiinnto
subdefiiiontn subdefiiionnt subdefiiiotnn subdefiiiotnn subdefiiiontn subdefiiionnt subdefiiinnot subdefiiinnto subdefiiinont
subdefiiinotn subdefiiinton subdefiiintno subdefiiotinn subdefiiotinn subdefiiotnin subdefiiotnni subdefiiotnni subdefiiotnin
subdefiioitnn subdefiioitnn subdefiiointn subdefiioinnt subdefiioinnt subdefiiointn subdefiionitn subdefiionint subdefiiontin
subdefiiontni subdefiionnti subdefiionnit subdefiionint subdefiionitn subdefiionnit subdefiionnti subdefiiontni subdefiiontin
subdefiintion subdefiintino subdefiintoin subdefiintoni subdefiintnoi subdefiintnio subdefiiniton subdefiinitno subdefiiniotn
subdefiiniont subdefiininot subdefiininto subdefiinoitn subdefiinoint subdefiinotin subdefiinotni subdefiinonti subdefiinonit
subdefiinniot subdefiinnito subdefiinnoit subdefiinnoti subdefiinntoi subdefiinntio subdefitinion subdefitinino subdefitinoin
subdefitinoni subdefitinnoi subdefitinnio subdefitiinon subdefitiinno subdefitiionn subdefitiionn subdefitiinon subdefitiinno
subdefitioinn subdefitioinn subdefitionin subdefitionni subdefitionni subdefitionin subdefitinion subdefitinino subdefitinoin
subdefitinoni subdefitinnoi subdefitinnio subdefitniion subdefitniino subdefitnioin subdefitnioni subdefitninoi subdefitninio
subdefitniion subdefitniino subdefitnioin subdefitnioni subdefitninoi subdefitninio subdefitnoiin subdefitnoini subdefitnoiin
subdefitnoini subdefitnonii subdefitnonii subdefitnnioi subdefitnniio subdefitnnoii subdefitnnoii subdefitnnioi subdefitnniio
subdefitinion subdefitinino subdefitinoin subdefitinoni subdefitinnoi subdefitinnio subdefitiinon subdefitiinno subdefitiionn
subdefitiionn subdefitiinon subdefitiinno subdefitioinn subdefitioinn subdefitionin subdefitionni subdefitionni subdefitionin
subdefitinion subdefitinino subdefitinoin subdefitinoni subdefitinnoi subdefitinnio subdefitoniin subdefitonini subdefitoniin
subdefitonini subdefitonnii subdefitonnii subdefitoinin subdefitoinni subdefitoiinn subdefitoiinn subdefitoinin subdefitoinni
subdefitoiinn subdefitoiinn subdefitoinin subdefitoinni subdefitoinni subdefitoinin subdefitoniin subdefitonini subdefitoniin
subdefitonini subdefitonnii subdefitonnii subdefitnnioi subdefitnniio subdefitnnoii subdefitnnoii subdefitnnioi subdefitnniio
subdefitninoi subdefitninio subdefitnioni subdefitnioin subdefitniion subdefitniino subdefitnoini subdefitnoiin subdefitnonii
subdefitnonii subdefitnoini subdefitnoiin subdefitniion subdefitniino subdefitnioin subdefitnioni subdefitninoi subdefitninio
subdefiiitnon subdefiiitnno subdefiiitonn subdefiiitonn subdefiiitnon subdefiiitnno subdefiiinton subdefiiintno subdefiiinotn
subdefiiinont subdefiiinnot subdefiiinnto subdefiiiontn subdefiiionnt subdefiiiotnn subdefiiiotnn subdefiiiontn subdefiiionnt
subdefiiinnot subdefiiinnto subdefiiinont subdefiiinotn subdefiiinton subdefiiintno subdefiitinon subdefiitinno subdefiitionn
subdefiitionn subdefiitinon subdefiitinno subdefiitnion subdefiitnino subdefiitnoin subdefiitnoni subdefiitnnoi subdefiitnnio
subdefiitonin subdefiitonni subdefiitoinn subdefiitoinn subdefiitonin subdefiitonni subdefiitnnoi subdefiitnnio subdefiitnoni
subdefiitnoin subdefiitnion subdefiitnino subdefiintion subdefiintino subdefiintoin subdefiintoni subdefiintnoi subdefiintnio
subdefiiniton subdefiinitno subdefiiniotn subdefiiniont subdefiininot subdefiininto subdefiinoitn subdefiinoint subdefiinotin
subdefiinotni subdefiinonti subdefiinonit subdefiinniot subdefiinnito subdefiinnoit subdefiinnoti subdefiinntoi subdefiinntio
subdefiiotnin subdefiiotnni subdefiiotinn subdefiiotinn subdefiiotnin subdefiiotnni subdefiiontin subdefiiontni subdefiionitn
subdefiionint subdefiionnit subdefiionnti subdefiiointn subdefiioinnt subdefiioitnn subdefiioitnn subdefiiointn subdefiioinnt
subdefiionnit subdefiionnti subdefiionint subdefiionitn subdefiiontin subdefiiontni subdefiintnoi subdefiintnio subdefiintoni
subdefiintoin subdefiintion subdefiintino subdefiinntoi subdefiinntio subdefiinnoti subdefiinnoit subdefiinniot subdefiinnito
subdefiinonti subdefiinonit subdefiinotni subdefiinotin subdefiinoitn subdefiinoint subdefiininot subdefiininto subdefiiniont
subdefiiniotn subdefiiniton subdefiinitno subdefioitinn subdefioitinn subdefioitnin subdefioitnni subdefioitnni subdefioitnin
subdefioiitnn subdefioiitnn subdefioiintn subdefioiinnt subdefioiinnt subdefioiintn subdefioinitn subdefioinint subdefiointin
subdefiointni subdefioinnti subdefioinnit subdefioinint subdefioinitn subdefioinnit subdefioinnti subdefiointni subdefiointin
subdefiotiinn subdefiotiinn subdefiotinin subdefiotinni subdefiotinni subdefiotinin subdefiotiinn subdefiotiinn subdefiotinin
subdefiotinni subdefiotinni subdefiotinin subdefiotniin subdefiotnini subdefiotniin subdefiotnini subdefiotnnii subdefiotnnii
subdefiotnini subdefiotniin subdefiotnnii subdefiotnnii subdefiotnini subdefiotniin subdefioitinn subdefioitinn subdefioitnin
subdefioitnni subdefioitnni subdefioitnin subdefioiitnn subdefioiitnn subdefioiintn subdefioiinnt subdefioiinnt subdefioiintn
subdefioinitn subdefioinint subdefiointin subdefiointni subdefioinnti subdefioinnit subdefioinint subdefioinitn subdefioinnit
subdefioinnti subdefiointni subdefiointin subdefiontiin subdefiontini subdefiontiin subdefiontini subdefiontnii subdefiontnii
subdefionitin subdefionitni subdefioniitn subdefioniint subdefioninit subdefioninti subdefioniitn subdefioniint subdefionitin
subdefionitni subdefioninti subdefioninit subdefionniit subdefionniti subdefionniit subdefionniti subdefionntii subdefionntii
subdefiontini subdefiontiin subdefiontnii subdefiontnii subdefiontini subdefiontiin subdefionitni subdefionitin subdefioninti
subdefioninit subdefioniint subdefioniitn subdefionniti subdefionniit subdefionntii subdefionntii subdefionniti subdefionniit
subdefioniint subdefioniitn subdefioninit subdefioninti subdefionitni subdefionitin subdefinition subdefinitino subdefinitoin
subdefinitoni subdefinitnoi subdefinitnio subdefiniiton subdefiniitno subdefiniiotn subdefiniiont subdefiniinot subdefiniinto
subdefinioitn subdefinioint subdefiniotin subdefiniotni subdefinionti subdefinionit subdefininiot subdefininito subdefininoit
subdefininoti subdefinintoi subdefinintio subdefintiion subdefintiino subdefintioin subdefintioni subdefintinoi subdefintinio
subdefintiion subdefintiino subdefintioin subdefintioni subdefintinoi subdefintinio subdefintoiin subdefintoini subdefintoiin
subdefintoini subdefintonii subdefintonii subdefintnioi subdefintniio subdefintnoii subdefintnoii subdefintnioi subdefintniio
subdefinition subdefinitino subdefinitoin subdefinitoni subdefinitnoi subdefinitnio subdefiniiton subdefiniitno subdefiniiotn
subdefiniiont subdefiniinot subdefiniinto subdefinioitn subdefinioint subdefiniotin subdefiniotni subdefinionti subdefinionit
subdefininiot subdefininito subdefininoit subdefininoti subdefinintoi subdefinintio subdefinotiin subdefinotini subdefinotiin
subdefinotini subdefinotnii subdefinotnii subdefinoitin subdefinoitni subdefinoiitn subdefinoiint subdefinoinit subdefinointi
subdefinoiitn subdefinoiint subdefinoitin subdefinoitni subdefinointi subdefinoinit subdefinoniit subdefinoniti subdefinoniit
subdefinoniti subdefinontii subdefinontii subdefinntioi subdefinntiio subdefinntoii subdefinntoii subdefinntioi subdefinntiio
subdefinnitoi subdefinnitio subdefinnioti subdefinnioit subdefinniiot subdefinniito subdefinnoiti subdefinnoiit subdefinnotii
subdefinnotii subdefinnoiti subdefinnoiit subdefinniiot subdefinniito subdefinnioit subdefinnioti subdefinnitoi subdefinnitio
subdefonitiin subdefonitini subdefonitiin subdefonitini subdefonitnii subdefonitnii subdefoniitin subdefoniitni subdefoniiitn
subdefoniiint subdefoniinit subdefoniinti subdefoniiitn subdefoniiint subdefoniitin subdefoniitni subdefoniinti subdefoniinit
subdefoniniit subdefoniniti subdefoniniit subdefoniniti subdefonintii subdefonintii subdefontiiin subdefontiini subdefontiiin
subdefontiini subdefontinii subdefontinii subdefontiiin subdefontiini subdefontiiin subdefontiini subdefontinii subdefontinii
subdefontiiin subdefontiini subdefontiiin subdefontiini subdefontinii subdefontinii subdefontniii subdefontniii subdefontniii
subdefontniii subdefontniii subdefontniii subdefonitiin subdefonitini subdefonitiin subdefonitini subdefonitnii subdefonitnii
subdefoniitin subdefoniitni subdefoniiitn subdefoniiint subdefoniinit subdefoniinti subdefoniiitn subdefoniiint subdefoniitin
subdefoniitni subdefoniinti subdefoniinit subdefoniniit subdefoniniti subdefoniniit subdefoniniti subdefonintii subdefonintii
subdefonitiin subdefonitini subdefonitiin subdefonitini subdefonitnii subdefonitnii subdefoniitin subdefoniitni subdefoniiitn
subdefoniiint subdefoniinit subdefoniinti subdefoniiitn subdefoniiint subdefoniitin subdefoniitni subdefoniinti subdefoniinit
subdefoniniit subdefoniniti subdefoniniit subdefoniniti subdefonintii subdefonintii subdefonntiii subdefonntiii subdefonntiii
subdefonntiii subdefonntiii subdefonntiii subdefonnitii subdefonnitii subdefonniiti subdefonniiit subdefonniiit subdefonniiti
subdefonniiti subdefonniiit subdefonnitii subdefonnitii subdefonniiti subdefonniiit subdefonniiit subdefonniiti subdefonniiit
subdefonniiti subdefonnitii subdefonnitii subdefointiin subdefointini subdefointiin subdefointini subdefointnii subdefointnii
subdefoinitin subdefoinitni subdefoiniitn subdefoiniint subdefoininit subdefoininti subdefoiniitn subdefoiniint subdefoinitin
subdefoinitni subdefoininti subdefoininit subdefoinniit subdefoinniti subdefoinniit subdefoinniti subdefoinntii subdefoinntii
subdefoitniin subdefoitnini subdefoitniin subdefoitnini subdefoitnnii subdefoitnnii subdefoitinin subdefoitinni subdefoitiinn
subdefoitiinn subdefoitinin subdefoitinni subdefoitiinn subdefoitiinn subdefoitinin subdefoitinni subdefoitinni subdefoitinin
subdefoitniin subdefoitnini subdefoitniin subdefoitnini subdefoitnnii subdefoitnnii subdefoiitnin subdefoiitnni subdefoiitinn
subdefoiitinn subdefoiitnin subdefoiitnni subdefoiintin subdefoiintni subdefoiinitn subdefoiinint subdefoiinnit subdefoiinnti
subdefoiiintn subdefoiiinnt subdefoiiitnn subdefoiiitnn subdefoiiintn subdefoiiinnt subdefoiinnit subdefoiinnti subdefoiinint
subdefoiinitn subdefoiintin subdefoiintni subdefoiitinn subdefoiitinn subdefoiitnin subdefoiitnni subdefoiitnni subdefoiitnin
subdefoiiitnn subdefoiiitnn subdefoiiintn subdefoiiinnt subdefoiiinnt subdefoiiintn subdefoiinitn subdefoiinint subdefoiintin
subdefoiintni subdefoiinnti subdefoiinnit subdefoiinint subdefoiinitn subdefoiinnit subdefoiinnti subdefoiintni subdefoiintin
subdefointiin subdefointini subdefointiin subdefointini subdefointnii subdefointnii subdefoinitin subdefoinitni subdefoiniitn
subdefoiniint subdefoininit subdefoininti subdefoiniitn subdefoiniint subdefoinitin subdefoinitni subdefoininti subdefoininit
subdefoinniit subdefoinniti subdefoinniit subdefoinniti subdefoinntii subdefoinntii subdefotiniin subdefotinini subdefotiniin
subdefotinini subdefotinnii subdefotinnii subdefotiinin subdefotiinni subdefotiiinn subdefotiiinn subdefotiinin subdefotiinni
subdefotiiinn subdefotiiinn subdefotiinin subdefotiinni subdefotiinni subdefotiinin subdefotiniin subdefotinini subdefotiniin
subdefotinini subdefotinnii subdefotinnii subdefotniiin subdefotniini subdefotniiin subdefotniini subdefotninii subdefotninii
subdefotniiin subdefotniini subdefotniiin subdefotniini subdefotninii subdefotninii subdefotniiin subdefotniini subdefotniiin
subdefotniini subdefotninii subdefotninii subdefotnniii subdefotnniii subdefotnniii subdefotnniii subdefotnniii subdefotnniii
subdefotiniin subdefotinini subdefotiniin subdefotinini subdefotinnii subdefotinnii subdefotiinin subdefotiinni subdefotiiinn
subdefotiiinn subdefotiinin subdefotiinni subdefotiiinn subdefotiiinn subdefotiinin subdefotiinni subdefotiinni subdefotiinin
subdefotiniin subdefotinini subdefotiniin subdefotinini subdefotinnii subdefotinnii subdefotiniin subdefotinini subdefotiniin
subdefotinini subdefotinnii subdefotinnii subdefotiinin subdefotiinni subdefotiiinn subdefotiiinn subdefotiinin subdefotiinni
subdefotiiinn subdefotiiinn subdefotiinin subdefotiinni subdefotiinni subdefotiinin subdefotiniin subdefotinini subdefotiniin
subdefotinini subdefotinnii subdefotinnii subdefotnniii subdefotnniii subdefotnniii subdefotnniii subdefotnniii subdefotnniii
subdefotninii subdefotninii subdefotniini subdefotniiin subdefotniiin subdefotniini subdefotniini subdefotniiin subdefotninii
subdefotninii subdefotniini subdefotniiin subdefotniiin subdefotniini subdefotniiin subdefotniini subdefotninii subdefotninii
subdefoiitnin subdefoiitnni subdefoiitinn subdefoiitinn subdefoiitnin subdefoiitnni subdefoiintin subdefoiintni subdefoiinitn
subdefoiinint subdefoiinnit subdefoiinnti subdefoiiintn subdefoiiinnt subdefoiiitnn subdefoiiitnn subdefoiiintn subdefoiiinnt
subdefoiinnit subdefoiinnti subdefoiinint subdefoiinitn subdefoiintin subdefoiintni subdefoitinin subdefoitinni subdefoitiinn
subdefoitiinn subdefoitinin subdefoitinni subdefoitniin subdefoitnini subdefoitniin subdefoitnini subdefoitnnii subdefoitnnii
subdefoitinin subdefoitinni subdefoitiinn subdefoitiinn subdefoitinin subdefoitinni subdefoitnnii subdefoitnnii subdefoitnini
subdefoitniin subdefoitniin subdefoitnini subdefointiin subdefointini subdefointiin subdefointini subdefointnii subdefointnii
subdefoinitin subdefoinitni subdefoiniitn subdefoiniint subdefoininit subdefoininti subdefoiniitn subdefoiniint subdefoinitin
subdefoinitni subdefoininti subdefoininit subdefoinniit subdefoinniti subdefoinniit subdefoinniti subdefoinntii subdefoinntii
subdefoiitnin subdefoiitnni subdefoiitinn subdefoiitinn subdefoiitnin subdefoiitnni subdefoiintin subdefoiintni subdefoiinitn
subdefoiinint subdefoiinnit subdefoiinnti subdefoiiintn subdefoiiinnt subdefoiiitnn subdefoiiitnn subdefoiiintn subdefoiiinnt
subdefoiinnit subdefoiinnti subdefoiinint subdefoiinitn subdefoiintin subdefoiintni subdefointnii subdefointnii subdefointini
subdefointiin subdefointiin subdefointini subdefoinntii subdefoinntii subdefoinniti subdefoinniit subdefoinniit subdefoinniti
subdefoininti subdefoininit subdefoinitni subdefoinitin subdefoiniitn subdefoiniint subdefoininit subdefoininti subdefoiniint
subdefoiniitn subdefoinitin subdefoinitni subdefoiitinn subdefoiitinn subdefoiitnin subdefoiitnni subdefoiitnni subdefoiitnin
subdefoiiitnn subdefoiiitnn subdefoiiintn subdefoiiinnt subdefoiiinnt subdefoiiintn subdefoiinitn subdefoiinint subdefoiintin
subdefoiintni subdefoiinnti subdefoiinnit subdefoiinint subdefoiinitn subdefoiinnit subdefoiinnti subdefoiintni subdefoiintin
subdefoitiinn subdefoitiinn subdefoitinin subdefoitinni subdefoitinni subdefoitinin subdefoitiinn subdefoitiinn subdefoitinin
subdefoitinni subdefoitinni subdefoitinin subdefoitniin subdefoitnini subdefoitniin subdefoitnini subdefoitnnii subdefoitnnii
subdefoitnini subdefoitniin subdefoitnnii subdefoitnnii subdefoitnini subdefoitniin subdefoiitinn subdefoiitinn subdefoiitnin
subdefoiitnni subdefoiitnni subdefoiitnin subdefoiiitnn subdefoiiitnn subdefoiiintn subdefoiiinnt subdefoiiinnt subdefoiiintn
subdefoiinitn subdefoiinint subdefoiintin subdefoiintni subdefoiinnti subdefoiinnit subdefoiinint subdefoiinitn subdefoiinnit
subdefoiinnti subdefoiintni subdefoiintin subdefointiin subdefointini subdefointiin subdefointini subdefointnii subdefointnii
subdefoinitin subdefoinitni subdefoiniitn subdefoiniint subdefoininit subdefoininti subdefoiniitn subdefoiniint subdefoinitin
subdefoinitni subdefoininti subdefoininit subdefoinniit subdefoinniti subdefoinniit subdefoinniti subdefoinntii subdefoinntii
subdefointini subdefointiin subdefointnii subdefointnii subdefointini subdefointiin subdefoinitni subdefoinitin subdefoininti
subdefoininit subdefoiniint subdefoiniitn subdefoinniti subdefoinniit subdefoinntii subdefoinntii subdefoinniti subdefoinniit
subdefoiniint subdefoiniitn subdefoininit subdefoininti subdefoinitni subdefoinitin subdefonitiin subdefonitini subdefonitiin
subdefonitini subdefonitnii subdefonitnii subdefoniitin subdefoniitni subdefoniiitn subdefoniiint subdefoniinit subdefoniinti
subdefoniiitn subdefoniiint subdefoniitin subdefoniitni subdefoniinti subdefoniinit subdefoniniit subdefoniniti subdefoniniit
subdefoniniti subdefonintii subdefonintii subdefontiiin subdefontiini subdefontiiin subdefontiini subdefontinii subdefontinii
subdefontiiin subdefontiini subdefontiiin subdefontiini subdefontinii subdefontinii subdefontiiin subdefontiini subdefontiiin
subdefontiini subdefontinii subdefontinii subdefontniii subdefontniii subdefontniii subdefontniii subdefontniii subdefontniii
subdefonitiin subdefonitini subdefonitiin subdefonitini subdefonitnii subdefonitnii subdefoniitin subdefoniitni subdefoniiitn
subdefoniiint subdefoniinit subdefoniinti subdefoniiitn subdefoniiint subdefoniitin subdefoniitni subdefoniinti subdefoniinit
subdefoniniit subdefoniniti subdefoniniit subdefoniniti subdefonintii subdefonintii subdefonitiin subdefonitini subdefonitiin
subdefonitini subdefonitnii subdefonitnii subdefoniitin subdefoniitni subdefoniiitn subdefoniiint subdefoniinit subdefoniinti
subdefoniiitn subdefoniiint subdefoniitin subdefoniitni subdefoniinti subdefoniinit subdefoniniit subdefoniniti subdefoniniit
subdefoniniti subdefonintii subdefonintii subdefonntiii subdefonntiii subdefonntiii subdefonntiii subdefonntiii subdefonntiii
subdefonnitii subdefonnitii subdefonniiti subdefonniiit subdefonniiit subdefonniiti subdefonniiti subdefonniiit subdefonnitii
subdefonnitii subdefonniiti subdefonniiit subdefonniiit subdefonniiti subdefonniiit subdefonniiti subdefonnitii subdefonnitii
subdefnnitioi subdefnnitiio subdefnnitoii subdefnnitoii subdefnnitioi subdefnnitiio subdefnniitoi subdefnniitio subdefnniioti
subdefnniioit subdefnniiiot subdefnniiito subdefnnioiti subdefnnioiit subdefnniotii subdefnniotii subdefnnioiti subdefnnioiit
subdefnniiiot subdefnniiito subdefnniioit subdefnniioti subdefnniitoi subdefnniitio subdefnntiioi subdefnntiiio subdefnntioii
subdefnntioii subdefnntiioi subdefnntiiio subdefnntiioi subdefnntiiio subdefnntioii subdefnntioii subdefnntiioi subdefnntiiio
subdefnntoiii subdefnntoiii subdefnntoiii subdefnntoiii subdefnntoiii subdefnntoiii subdefnntiioi subdefnntiiio subdefnntioii
subdefnntioii subdefnntiioi subdefnntiiio subdefnnitioi subdefnnitiio subdefnnitoii subdefnnitoii subdefnnitioi subdefnnitiio
subdefnniitoi subdefnniitio subdefnniioti subdefnniioit subdefnniiiot subdefnniiito subdefnnioiti subdefnnioiit subdefnniotii
subdefnniotii subdefnnioiti subdefnnioiit subdefnniiiot subdefnniiito subdefnniioit subdefnniioti subdefnniitoi subdefnniitio
subdefnnotiii subdefnnotiii subdefnnotiii subdefnnotiii subdefnnotiii subdefnnotiii subdefnnoitii subdefnnoitii subdefnnoiiti
subdefnnoiiit subdefnnoiiit subdefnnoiiti subdefnnoiiti subdefnnoiiit subdefnnoitii subdefnnoitii subdefnnoiiti subdefnnoiiit
subdefnnoiiit subdefnnoiiti subdefnnoiiit subdefnnoiiti subdefnnoitii subdefnnoitii subdefnnitioi subdefnnitiio subdefnnitoii
subdefnnitoii subdefnnitioi subdefnnitiio subdefnniitoi subdefnniitio subdefnniioti subdefnniioit subdefnniiiot subdefnniiito
subdefnnioiti subdefnnioiit subdefnniotii subdefnniotii subdefnnioiti subdefnnioiit subdefnniiiot subdefnniiito subdefnniioit
subdefnniioti subdefnniitoi subdefnniitio subdefnintioi subdefnintiio subdefnintoii subdefnintoii subdefnintioi subdefnintiio
subdefninitoi subdefninitio subdefninioti subdefninioit subdefniniiot subdefniniito subdefninoiti subdefninoiit subdefninotii
subdefninotii subdefninoiti subdefninoiit subdefniniiot subdefniniito subdefninioit subdefninioti subdefninitoi subdefninitio
subdefnitnioi subdefnitniio subdefnitnoii subdefnitnoii subdefnitnioi subdefnitniio subdefnitinoi subdefnitinio subdefnitioni
subdefnitioin subdefnitiion subdefnitiino subdefnitoini subdefnitoiin subdefnitonii subdefnitonii subdefnitoini subdefnitoiin
subdefnitiion subdefnitiino subdefnitioin subdefnitioni subdefnitinoi subdefnitinio subdefniitnoi subdefniitnio subdefniitoni
subdefniitoin subdefniition subdefniitino subdefniintoi subdefniintio subdefniinoti subdefniinoit subdefniiniot subdefniinito
subdefniionti subdefniionit subdefniiotni subdefniiotin subdefniioitn subdefniioint subdefniiinot subdefniiinto subdefniiiont
subdefniiiotn subdefniiiton subdefniiitno subdefniotini subdefniotiin subdefniotnii subdefniotnii subdefniotini subdefniotiin
subdefnioitni subdefnioitin subdefniointi subdefnioinit subdefnioiint subdefnioiitn subdefnioniti subdefnioniit subdefniontii
subdefniontii subdefnioniti subdefnioniit subdefnioiint subdefnioiitn subdefnioinit subdefniointi subdefnioitni subdefnioitin
subdefniition subdefniitino subdefniitoin subdefniitoni subdefniitnoi subdefniitnio subdefniiiton subdefniiitno subdefniiiotn
subdefniiiont subdefniiinot subdefniiinto subdefniioitn subdefniioint subdefniiotin subdefniiotni subdefniionti subdefniionit
subdefniiniot subdefniinito subdefniinoit subdefniinoti subdefniintoi subdefniintio subdefntinioi subdefntiniio subdefntinoii
subdefntinoii subdefntinioi subdefntiniio subdefntiinoi subdefntiinio subdefntiioni subdefntiioin subdefntiiion subdefntiiino
subdefntioini subdefntioiin subdefntionii subdefntionii subdefntioini subdefntioiin subdefntiiion subdefntiiino subdefntiioin
subdefntiioni subdefntiinoi subdefntiinio subdefntniioi subdefntniiio subdefntnioii subdefntnioii subdefntniioi subdefntniiio
subdefntniioi subdefntniiio subdefntnioii subdefntnioii subdefntniioi subdefntniiio subdefntnoiii subdefntnoiii subdefntnoiii
subdefntnoiii subdefntnoiii subdefntnoiii subdefntniioi subdefntniiio subdefntnioii subdefntnioii subdefntniioi subdefntniiio
subdefntinioi subdefntiniio subdefntinoii subdefntinoii subdefntinioi subdefntiniio subdefntiinoi subdefntiinio subdefntiioni
subdefntiioin subdefntiiion subdefntiiino subdefntioini subdefntioiin subdefntionii subdefntionii subdefntioini subdefntioiin
subdefntiiion subdefntiiino subdefntiioin subdefntiioni subdefntiinoi subdefntiinio subdefntoniii subdefntoniii subdefntoniii
subdefntoniii subdefntoniii subdefntoniii subdefntoinii subdefntoinii subdefntoiini subdefntoiiin subdefntoiiin subdefntoiini
subdefntoiini subdefntoiiin subdefntoinii subdefntoinii subdefntoiini subdefntoiiin subdefntoiiin subdefntoiini subdefntoiiin
subdefntoiini subdefntoinii subdefntoinii subdefntinioi subdefntiniio subdefntinoii subdefntinoii subdefntinioi subdefntiniio
subdefntiinoi subdefntiinio subdefntiioni subdefntiioin subdefntiiion subdefntiiino subdefntioini subdefntioiin subdefntionii
subdefntionii subdefntioini subdefntioiin subdefntiiion subdefntiiino subdefntiioin subdefntiioni subdefntiinoi subdefntiinio
subdefniitnoi subdefniitnio subdefniitoni subdefniitoin subdefniition subdefniitino subdefniintoi subdefniintio subdefniinoti
subdefniinoit subdefniiniot subdefniinito subdefniionti subdefniionit subdefniiotni subdefniiotin subdefniioitn subdefniioint
subdefniiinot subdefniiinto subdefniiiont subdefniiiotn subdefniiiton subdefniiitno subdefnitinoi subdefnitinio subdefnitioni
subdefnitioin subdefnitiion subdefnitiino subdefnitnioi subdefnitniio subdefnitnoii subdefnitnoii subdefnitnioi subdefnitniio
subdefnitonii subdefnitonii subdefnitoini subdefnitoiin subdefnitoiin subdefnitoini subdefnitinoi subdefnitinio subdefnitioni
subdefnitioin subdefnitiion subdefnitiino subdefnintioi subdefnintiio subdefnintoii subdefnintoii subdefnintioi subdefnintiio
subdefninitoi subdefninitio subdefninioti subdefninioit subdefniniiot subdefniniito subdefninoiti subdefninoiit subdefninotii
subdefninotii subdefninoiti subdefninoiit subdefniniiot subdefniniito subdefninioit subdefninioti subdefninitoi subdefninitio
subdefniotnii subdefniotnii subdefniotini subdefniotiin subdefniotiin subdefniotini subdefniontii subdefniontii subdefnioniti
subdefnioniit subdefnioniit subdefnioniti subdefniointi subdefnioinit subdefnioitni subdefnioitin subdefnioiitn subdefnioiint
subdefnioinit subdefniointi subdefnioiint subdefnioiitn subdefnioitin subdefnioitni subdefniitnoi subdefniitnio subdefniitoni
subdefniitoin subdefniition subdefniitino subdefniintoi subdefniintio subdefniinoti subdefniinoit subdefniiniot subdefniinito
subdefniionti subdefniionit subdefniiotni subdefniiotin subdefniioitn subdefniioint subdefniiinot subdefniiinto subdefniiiont
subdefniiiotn subdefniiiton subdefniiitno subdefnoitini subdefnoitiin subdefnoitnii subdefnoitnii subdefnoitini subdefnoitiin
subdefnoiitni subdefnoiitin subdefnoiinti subdefnoiinit subdefnoiiint subdefnoiiitn subdefnoiniti subdefnoiniit subdefnointii
subdefnointii subdefnoiniti subdefnoiniit subdefnoiiint subdefnoiiitn subdefnoiinit subdefnoiinti subdefnoiitni subdefnoiitin
subdefnotiini subdefnotiiin subdefnotinii subdefnotinii subdefnotiini subdefnotiiin subdefnotiini subdefnotiiin subdefnotinii
subdefnotinii subdefnotiini subdefnotiiin subdefnotniii subdefnotniii subdefnotniii subdefnotniii subdefnotniii subdefnotniii
subdefnotiini subdefnotiiin subdefnotinii subdefnotinii subdefnotiini subdefnotiiin subdefnoitini subdefnoitiin subdefnoitnii
subdefnoitnii subdefnoitini subdefnoitiin subdefnoiitni subdefnoiitin subdefnoiinti subdefnoiinit subdefnoiiint subdefnoiiitn
subdefnoiniti subdefnoiniit subdefnointii subdefnointii subdefnoiniti subdefnoiniit subdefnoiiint subdefnoiiitn subdefnoiinit
subdefnoiinti subdefnoiitni subdefnoiitin subdefnontiii subdefnontiii subdefnontiii subdefnontiii subdefnontiii subdefnontiii
subdefnonitii subdefnonitii subdefnoniiti subdefnoniiit subdefnoniiit subdefnoniiti subdefnoniiti subdefnoniiit subdefnonitii
subdefnonitii subdefnoniiti subdefnoniiit subdefnoniiit subdefnoniiti subdefnoniiit subdefnoniiti subdefnonitii subdefnonitii
subdefnoitini subdefnoitiin subdefnoitnii subdefnoitnii subdefnoitini subdefnoitiin subdefnoiitni subdefnoiitin subdefnoiinti
subdefnoiinit subdefnoiiint subdefnoiiitn subdefnoiniti subdefnoiniit subdefnointii subdefnointii subdefnoiniti subdefnoiniit
subdefnoiiint subdefnoiiitn subdefnoiinit subdefnoiinti subdefnoiitni subdefnoiitin subdefniition subdefniitino subdefniitoin
subdefniitoni subdefniitnoi subdefniitnio subdefniiiton subdefniiitno subdefniiiotn subdefniiiont subdefniiinot subdefniiinto
subdefniioitn subdefniioint subdefniiotin subdefniiotni subdefniionti subdefniionit subdefniiniot subdefniinito subdefniinoit
subdefniinoti subdefniintoi subdefniintio subdefnitiion subdefnitiino subdefnitioin subdefnitioni subdefnitinoi subdefnitinio
subdefnitiion subdefnitiino subdefnitioin subdefnitioni subdefnitinoi subdefnitinio subdefnitoiin subdefnitoini subdefnitoiin
subdefnitoini subdefnitonii subdefnitonii subdefnitnioi subdefnitniio subdefnitnoii subdefnitnoii subdefnitnioi subdefnitniio
subdefniition subdefniitino subdefniitoin subdefniitoni subdefniitnoi subdefniitnio subdefniiiton subdefniiitno subdefniiiotn
subdefniiiont subdefniiinot subdefniiinto subdefniioitn subdefniioint subdefniiotin subdefniiotni subdefniionti subdefniionit
subdefniiniot subdefniinito subdefniinoit subdefniinoti subdefniintoi subdefniintio subdefniotiin subdefniotini subdefniotiin
subdefniotini subdefniotnii subdefniotnii subdefnioitin subdefnioitni subdefnioiitn subdefnioiint subdefnioinit subdefniointi
subdefnioiitn subdefnioiint subdefnioitin subdefnioitni subdefniointi subdefnioinit subdefnioniit subdefnioniti subdefnioniit
subdefnioniti subdefniontii subdefniontii subdefnintioi subdefnintiio subdefnintoii subdefnintoii subdefnintioi subdefnintiio
subdefninitoi subdefninitio subdefninioti subdefninioit subdefniniiot subdefniniito subdefninoiti subdefninoiit subdefninotii
subdefninotii subdefninoiti subdefninoiit subdefniniiot subdefniniito subdefninioit subdefninioti subdefninitoi subdefninitio

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us