easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

taenite

avosets

orbelian

krupicka

mungah

uncomprehensively

dandrige

camaraderie

strained

predestined

improbableness

reckoning

appointment

tyning

quivitistisque

uerius

overstaying

disclamation


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: stanta
cipher variations:
tuboub uvcpvc vwdqwd wxerxe xyfsyf
yzgtzg zahuah abivbi bcjwcj cdkxdk
delyel efmzfm fgnagn ghobho hipcip
ijqdjq jkrekr klsfls lmtgmt mnuhnu
noviov opwjpw pqxkqx qrylry rszmsz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: stanta
Cipher: hgzmgz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: stanta
Cipher: BAAAB BAABA AAAAA ABBAA BAABA AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: stanta
cipher variations:
tuboubdgbogbnsbosbxeboebhqboqbrcbocblaboabvmbomb
fyboybpkbokbzwbowbjiboibuvcpvcehcphcotcptcyfcpfc
ircprcsdcpdcmbcpbcwncpncgzcpzcqlcplcaxcpxckjcpjc
vwdqwdfidqidpudqudzgdqgdjsdqsdtedqedncdqcdxodqod
hadqadrmdqmdbydqydlkdqkdwxerxegjerjeqverveaherhe
kterteuferfeoderdeyperpeiberbesnerneczerzemlerle
xyfsyfhkfskfrwfswfbifsiflufsufvgfsgfpefsefzqfsqf
jcfscftofsofdafsafnmfsmfyzgtzgilgtlgsxgtxgcjgtjg
mvgtvgwhgthgqfgtfgargtrgkdgtdgupgtpgebgtbgongtng
zahuahjmhumhtyhuyhdkhukhnwhuwhxihuihrghughbshush
lehuehvqhuqhfchuchpohuohabivbiknivniuzivzielivli
oxivxiyjivjishivhictivtimfivfiwrivrigdivdiqpivpi
bcjwcjlojwojvajwajfmjwmjpyjwyjzkjwkjtijwijdujwuj
ngjwgjxsjwsjhejwejrqjwqjcdkxdkmpkxpkwbkxbkgnkxnk
qzkxzkalkxlkujkxjkevkxvkohkxhkytkxtkifkxfksrkxrk
delyelnqlyqlxclyclholyolralyalbmlymlvklyklfwlywl
pilyilzulyuljglygltslyslefmzfmormzrmydmzdmipmzpm
sbmzbmcnmznmwlmzlmgxmzxmqjmzjmavmzvmkhmzhmutmztm
fgnagnpsnasnzenaenjqnaqntcnacndonaonxmnamnhynayn
rknaknbwnawnlinainvunaunghobhoqtobtoafobfokrobro
udobdoepobpoynobnoizobzosloblocxobxomjobjowvobvo
hipciprupcupbgpcgplspcspvepcepfqpcqpzopcopjapcap
tmpcmpdypcypnkpckpxwpcwpijqdjqsvqdvqchqdhqmtqdtq
wfqdfqgrqdrqapqdpqkbqdbqunqdnqezqdzqolqdlqyxqdxq
jkrekrtwrewrdireirnureurxgregrhsresrbqreqrlcrecr
voreorfarearpmremrzyreyrklsflsuxsfxsejsfjsovsfvs
yhsfhsitsftscrsfrsmdsfdswpsfpsgbsfbsqnsfnsazsfzs
lmtgmtvytgytfktgktpwtgwtzitgitjutgutdstgstnetget
xqtgqthctgctrotgotbatgatmnuhnuwzuhzugluhluqxuhxu
ajuhjukvuhvuetuhtuofuhfuyruhruiduhduspuhpucbuhbu
noviovxaviavhmvimvryviyvbkvikvlwviwvfuviuvpgvigv
zsvisvjevievtqviqvdcvicvopwjpwybwjbwinwjnwszwjzw
clwjlwmxwjxwgvwjvwqhwjhwatwjtwkfwjfwurwjrwedwjdw
pqxkqxzcxkcxjoxkoxtaxkaxdmxkmxnyxkyxhwxkwxrixkix
buxkuxlgxkgxvsxksxfexkexqrylryadyldykpylpyubylby
enylnyozylzyixylxysjyljycvylvymhylhywtyltygfylfy
rszmszbezmezlqzmqzvczmczfozmozpazmazjyzmyztkzmkz
dwzmwznizmizxuzmuzhgzmgzstantacfanfamranrawdanda
gpanpaqbanbakzanzaulanlaexanxaojanjayvanvaihanha

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: stanta
Cipher: fgnagn

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: stanta
Cipher: 344411334411

Extended Methods:
Method #1

Plaintext: stanta
method variations:
xyfsyfcdlxdlhiqciqnovhov

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s t a n t a 
3 4 1 3 4 1 
4 4 1 3 4 1 
They are then read out in rows:
341341441341
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: stanta
Cipher: sldtld

Read more ...
Method #3

Plaintext: stanta
method variations:
tdlsdl dlsdlt lsdltd
sdltdl dltdls ltdlsd

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: stanta

all 720 cipher variations:
stanta stanat statna statan staatn staant stnata stnaat stntaa stntaa stnata
stnaat sttnaa sttnaa sttana sttaan sttaan sttana stanta stanat statna statan
staatn staant satnta satnat sattna sattan satatn satant santta santat santta
santat sanatt sanatt satnta satnat sattna sattan satatn satant saantt saantt
saatnt saattn saattn saatnt snatta snatat snatta snatat snaatt snaatt sntata
sntaat snttaa snttaa sntata sntaat snttaa snttaa sntata sntaat sntaat sntata
snatta snatat snatta snatat snaatt snaatt stanta stanat statna statan staatn
staant stnata stnaat stntaa stntaa stnata stnaat sttnaa sttnaa sttana sttaan
sttaan sttana stanta stanat statna statan staatn staant saantt saantt saatnt
saattn saattn saatnt sanatt sanatt santat santta santta santat satnat satnta
satant satatn sattan sattna satnta satnat sattna sattan satatn satant tsanta
tsanat tsatna tsatan tsaatn tsaant tsnata tsnaat tsntaa tsntaa tsnata tsnaat
tstnaa tstnaa tstana tstaan tstaan tstana tsanta tsanat tsatna tsatan tsaatn
tsaant tasnta tasnat tastna tastan tasatn tasant tansta tansat tantsa tantas
tanats tanast tatnsa tatnas tatsna tatsan tatasn tatans taants taanst taatns
taatsn taastn taasnt tnasta tnasat tnatsa tnatas tnaats tnaast tnsata tnsaat
tnstaa tnstaa tnsata tnsaat tntsaa tntsaa tntasa tntaas tntaas tntasa tnasta
tnasat tnatsa tnatas tnaats tnaast ttansa ttanas ttasna ttasan ttaasn ttaans
ttnasa ttnaas ttnsaa ttnsaa ttnasa ttnaas ttsnaa ttsnaa ttsana ttsaan ttsaan
ttsana ttansa ttanas ttasna ttasan ttaasn ttaans taants taanst taatns taatsn
taastn taasnt tanats tanast tantas tantsa tansta tansat tatnas tatnsa tatans
tatasn tatsan tatsna tasnta tasnat tastna tastan tasatn tasant atsnta atsnat
atstna atstan atsatn atsant atnsta atnsat atntsa atntas atnats atnast attnsa
attnas attsna attsan attasn attans atants atanst atatns atatsn atastn atasnt
astnta astnat asttna asttan astatn astant asntta asntat asntta asntat asnatt
asnatt astnta astnat asttna asttan astatn astant asantt asantt asatnt asattn
asattn asatnt anstta anstat anstta anstat ansatt ansatt antsta antsat anttsa
anttas antats antast anttsa anttas antsta antsat antast antats anatts anatst
anatts anatst anastt anastt atsnta atsnat atstna atstan atsatn atsant atnsta
atnsat atntsa atntas atnats atnast attnsa attnas attsna attsan attasn attans
atants atanst atatns atatsn atastn atasnt aasntt aasntt aastnt aasttn aasttn
aastnt aanstt aanstt aantst aantts aantts aantst aatnst aatnts aatsnt aatstn
aattsn aattns aatnts aatnst aattns aattsn aatstn aatsnt ntasta ntasat ntatsa
ntatas ntaats ntaast ntsata ntsaat ntstaa ntstaa ntsata ntsaat nttsaa nttsaa
nttasa nttaas nttaas nttasa ntasta ntasat ntatsa ntatas ntaats ntaast natsta
natsat nattsa nattas natats natast nastta nastat nastta nastat nasatt nasatt
natsta natsat nattsa nattas natats natast naastt naastt naatst naatts naatts
naatst nsatta nsatat nsatta nsatat nsaatt nsaatt nstata nstaat nsttaa nsttaa
nstata nstaat nsttaa nsttaa nstata nstaat nstaat nstata nsatta nsatat nsatta
nsatat nsaatt nsaatt ntasta ntasat ntatsa ntatas ntaats ntaast ntsata ntsaat
ntstaa ntstaa ntsata ntsaat nttsaa nttsaa nttasa nttaas nttaas nttasa ntasta
ntasat ntatsa ntatas ntaats ntaast naastt naastt naatst naatts naatts naatst
nasatt nasatt nastat nastta nastta nastat natsat natsta natast natats nattas
nattsa natsta natsat nattsa nattas natats natast ttansa ttanas ttasna ttasan
ttaasn ttaans ttnasa ttnaas ttnsaa ttnsaa ttnasa ttnaas ttsnaa ttsnaa ttsana
ttsaan ttsaan ttsana ttansa ttanas ttasna ttasan ttaasn ttaans tatnsa tatnas
tatsna tatsan tatasn tatans tantsa tantas tansta tansat tanast tanats tasnta
tasnat tastna tastan tasatn tasant taanst taants taasnt taastn taatsn taatns
tnatsa tnatas tnasta tnasat tnaast tnaats tntasa tntaas tntsaa tntsaa tntasa
tntaas tnstaa tnstaa tnsata tnsaat tnsaat tnsata tnatsa tnatas tnasta tnasat
tnaast tnaats tsanta tsanat tsatna tsatan tsaatn tsaant tsnata tsnaat tsntaa
tsntaa tsnata tsnaat tstnaa tstnaa tstana tstaan tstaan tstana tsanta tsanat
tsatna tsatan tsaatn tsaant taanst taants taasnt taastn taatsn taatns tanast
tanats tansat tansta tantsa tantas tasnat tasnta tasant tasatn tastan tastna
tatnsa tatnas tatsna tatsan tatasn tatans atants atanst atatns atatsn atastn
atasnt atnats atnast atntas atntsa atnsta atnsat attnas attnsa attans attasn
attsan attsna atsnta atsnat atstna atstan atsatn atsant aatnts aatnst aattns
aattsn aatstn aatsnt aantts aantst aantts aantst aanstt aanstt aatnts aatnst
aattns aattsn aatstn aatsnt aasntt aasntt aastnt aasttn aasttn aastnt anatts
anatst anatts anatst anastt anastt antats antast anttas anttsa antsta antsat
anttas anttsa antats antast antsat antsta anstta anstat anstta anstat ansatt
ansatt atants atanst atatns atatsn atastn atasnt atnats atnast atntas atntsa
atnsta atnsat attnas attnsa attans attasn attsan attsna atsnta atsnat atstna
atstan atsatn atsant asantt asantt asatnt asattn asattn asatnt asnatt asnatt
asntat asntta asntta asntat astnat astnta astant astatn asttan asttna astnta
astnat asttna asttan astatn astant

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us