easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

trypeta

parasuis

volutans

worse

roughtailed

pachycephaly

cscnibm

monotypes

gravaverantque

alliaria

inflexion

anarthrously

yusef

quintillus

nucleated

lupis

ungarter

monotriglyph


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: squirism
cipher variations:
trvjsjtn uswktkuo vtxlulvp wuymvmwq xvznwnxr
ywaoxoys zxbpypzt aycqzqau bzdrarbv caesbscw
dbftctdx ecguduey fdhvevfz geiwfwga hfjxgxhb
igkyhyic jhlzizjd kimajake ljnbkblf mkoclcmg
nlpdmdnh omqeneoi pnrfofpj qosgpgqk rpthqhrl

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: squirism
Cipher: hjfrirhn

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: squirism
Cipher: BAAAB ABBBB BAABB ABAAA BAAAA ABAAA BAAAB ABABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: squirism
cipher variations:
trvjsjtndxjzazdlndxpipnjxjlfqfxhhpzvyvhfrvnlglrdlhprwrlzvndhehvx
ftrxmxfvpzfnunptzftdcdzrjlhtktjpuswktkuoeykabaemoeyqjqokykmgrgyi
iqawzwigswomhmsemiqsxsmawoeifiwygusynygwqagovoquaguedeaskmiulukq
vtxlulvpfzlbcbfnpfzrkrplzlnhshzjjrbxaxjhtxpnintfnjrtytnbxpfjgjxz
hvtzozhxrbhpwprvbhvfefbtlnjvmvlrwuymvmwqgamcdcgoqgaslsqmamoitiak
kscybykiuyqojougoksuzuocyqgkhkyaiwuapaiysciqxqswciwgfgcumokwnwms
xvznwnxrhbndedhprhbtmtrnbnpjujblltdzczljvzrpkpvhpltvavpdzrhlilzb
jxvbqbjztdjryrtxdjxhghdvnplxoxntywaoxoysicoefeiqsicunusocoqkvkcm
mueadamkwasqlqwiqmuwbwqeasimjmackywcrckauekszsuyekyihiewoqmypyou
zxbpypztjdpfgfjrtjdvovtpdprlwldnnvfbebnlxbtrmrxjrnvxcxrfbtjnknbd
lzxdsdlbvfltatvzflzjijfxprnzqzpvaycqzqaukeqghgksukewpwuqeqsmxmeo
owgcfcomycusnsyksowydysgcukolocemayetemcwgmubuwagmakjkgyqsoaraqw
bzdrarbvlfrhihltvlfxqxvrfrtnynfppxhdgdpnzdvtotzltpxzezthdvlpmpdf
nbzfufndxhnvcvxbhnblklhzrtpbsbrxcaesbscwmgsijimuwmgyrywsgsuozogq
qyieheqoaewupuamuqyafauiewmqnqegocagvgoeyiowdwyciocmlmiasuqctcsy
dbftctdxnhtjkjnvxnhzszxthtvpaphrrzjfifrpbfxvqvbnvrzbgbvjfxnrorfh
pdbhwhpfzjpxexzdjpdnmnjbtvrdudtzecgudueyoiuklkowyoiatayuiuwqbqis
sakgjgsqcgywrwcowsachcwkgyospsgiqecixiqgakqyfyaekqeonokcuwseveua
fdhvevfzpjvlmlpxzpjbubzvjvxrcrjttblhkhtrdhzxsxdpxtbdidxlhzptqthj
rfdjyjrhblrzgzbflrfpopldvxtfwfvbgeiwfwgaqkwmnmqyaqkcvcawkwysdsku
ucmiliuseiaytyeqyucejeymiaquruiksgekzksicmsahacgmsgqpqmewyugxgwc
hfjxgxhbrlxnonrzbrldwdbxlxztetlvvdnjmjvtfjbzuzfrzvdfkfznjbrvsvjl
thflaltjdntbibdhnthrqrnfxzvhyhxdigkyhyicsmyoposacsmexecymyaufumw
weoknkwugkcavagsaweglgaokcswtwkmuigmbmukeoucjceiouisrsogyawiziye
jhlzizjdtnzpqptbdtnfyfdznzbvgvnxxfplolxvhldbwbhtbxfhmhbpldtxuxln
vjhncnvlfpvdkdfjpvjtstphzbxjajzfkimajakeuoaqrquceuogzgeaoacwhwoy
ygqmpmywimecxciucyginicqmeuyvymowkiodowmgqwelegkqwkutuqiacykbkag
ljnbkblfvpbrsrvdfvphahfbpbdxixpzzhrnqnzxjnfdydjvdzhjojdrnfvzwznp
xljpepxnhrxfmfhlrxlvuvrjbdzlclbhmkoclcmgwqcstswegwqibigcqceyjyqa
aisoroaykogezekweaikpkesogwaxaoqymkqfqyoisygngimsymwvwskceamdmci
nlpdmdnhxrdtutxfhxrjcjhdrdfzkzrbbjtpspbzlphfaflxfbjlqlftphxbybpr
znlrgrzpjtzhohjntznxwxtldfbnendjomqeneoiyseuvuygiyskdkiesegalasc
ckuqtqcamqigbgmygckmrmguqiyczcqsaomshsaqkuaipikouaoyxyumegcofoek
pnrfofpjztfvwvzhjztleljftfhbmbtddlvrurdbnrjhchnzhdlnsnhvrjzdadrt
bpntitbrlvbjqjlpvbpzyzvnfhdpgpflqosgpgqkaugwxwaikaumfmkgugicncue
emwsvsecoskidioaiemotoiwskaebesucqoujucsmwckrkmqwcqazawogieqhqgm
rpthqhrlbvhxyxbjlbvngnlhvhjdodvffnxtwtfdptljejpbjfnpupjxtlbfcftv
drpvkvdtnxdlslnrxdrbabxphjfrirhnsquirismcwiyzyckmcwohomiwikepewg
goyuxugequmkfkqckgoqvqkyumcgdguwesqwlweuoyemtmosyescbcyqikgsjsio

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: squirism
Cipher: fdhvevfz

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: squirism
Cipher: 3414544224423423

Extended Methods:
Method #1

Plaintext: squirism
method variations:
xvzowoxrcaetbtcwhfkygyhbnlpdmdng

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s q u i r i s m 
3 1 5 4 2 4 3 2 
4 4 4 2 4 2 4 3 
They are then read out in rows:
3154243244424243
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: squirism
Cipher: curhtiio

Read more ...
Method #3

Plaintext: squirism
method variations:
dytgtmin ytgtmind tgtmindy
gtmindyt tmindytg mindytgt
indytgtm ndytgtmi

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: squirism

first 5040 cipher variations(40320 total)
squirism squirims squirsim squirsmi squirmsi squirmis squiirsm squiirms squiisrm squiismr squiimsr
squiimrs squisirm squisimr squisrim squisrmi squismri squismir squimisr squimirs squimsir squimsri
squimrsi squimris squriism squriims squrisim squrismi squrimsi squrimis squriism squriims squrisim
squrismi squrimsi squrimis sqursiim sqursimi sqursiim sqursimi sqursmii sqursmii squrmisi squrmiis
squrmsii squrmsii squrmisi squrmiis squirism squirims squirsim squirsmi squirmsi squirmis squiirsm
squiirms squiisrm squiismr squiimsr squiimrs squisirm squisimr squisrim squisrmi squismri squismir
squimisr squimirs squimsir squimsri squimrsi squimris squsriim squsrimi squsriim squsrimi squsrmii
squsrmii squsirim squsirmi squsiirm squsiimr squsimir squsimri squsiirm squsiimr squsirim squsirmi
squsimri squsimir squsmiir squsmiri squsmiir squsmiri squsmrii squsmrii squmrisi squmriis squmrsii
squmrsii squmrisi squmriis squmirsi squmiris squmisri squmisir squmiisr squmiirs squmsiri squmsiir
squmsrii squmsrii squmsiri squmsiir squmiisr squmiirs squmisir squmisri squmirsi squmiris sqiurism
sqiurims sqiursim sqiursmi sqiurmsi sqiurmis sqiuirsm sqiuirms sqiuisrm sqiuismr sqiuimsr sqiuimrs
sqiusirm sqiusimr sqiusrim sqiusrmi sqiusmri sqiusmir sqiumisr sqiumirs sqiumsir sqiumsri sqiumrsi
sqiumris sqiruism sqiruims sqirusim sqirusmi sqirumsi sqirumis sqiriusm sqiriums sqirisum sqirismu
sqirimsu sqirimus sqirsium sqirsimu sqirsuim sqirsumi sqirsmui sqirsmiu sqirmisu sqirmius sqirmsiu
sqirmsui sqirmusi sqirmuis sqiirusm sqiirums sqiirsum sqiirsmu sqiirmsu sqiirmus sqiiursm sqiiurms
sqiiusrm sqiiusmr sqiiumsr sqiiumrs sqiisurm sqiisumr sqiisrum sqiisrmu sqiismru sqiismur sqiimusr
sqiimurs sqiimsur sqiimsru sqiimrsu sqiimrus sqisrium sqisrimu sqisruim sqisrumi sqisrmui sqisrmiu
sqisirum sqisirmu sqisiurm sqisiumr sqisimur sqisimru sqisuirm sqisuimr sqisurim sqisurmi sqisumri
sqisumir sqismiur sqismiru sqismuir sqismuri sqismrui sqismriu sqimrisu sqimrius sqimrsiu sqimrsui
sqimrusi sqimruis sqimirsu sqimirus sqimisru sqimisur sqimiusr sqimiurs sqimsiru sqimsiur sqimsriu
sqimsrui sqimsuri sqimsuir sqimuisr sqimuirs sqimusir sqimusri sqimursi sqimuris sqriuism sqriuims
sqriusim sqriusmi sqriumsi sqriumis sqriiusm sqriiums sqriisum sqriismu sqriimsu sqriimus sqrisium
sqrisimu sqrisuim sqrisumi sqrismui sqrismiu sqrimisu sqrimius sqrimsiu sqrimsui sqrimusi sqrimuis
sqruiism sqruiims sqruisim sqruismi sqruimsi sqruimis sqruiism sqruiims sqruisim sqruismi sqruimsi
sqruimis sqrusiim sqrusimi sqrusiim sqrusimi sqrusmii sqrusmii sqrumisi sqrumiis sqrumsii sqrumsii
sqrumisi sqrumiis sqriuism sqriuims sqriusim sqriusmi sqriumsi sqriumis sqriiusm sqriiums sqriisum
sqriismu sqriimsu sqriimus sqrisium sqrisimu sqrisuim sqrisumi sqrismui sqrismiu sqrimisu sqrimius
sqrimsiu sqrimsui sqrimusi sqrimuis sqrsuiim sqrsuimi sqrsuiim sqrsuimi sqrsumii sqrsumii sqrsiuim
sqrsiumi sqrsiium sqrsiimu sqrsimiu sqrsimui sqrsiium sqrsiimu sqrsiuim sqrsiumi sqrsimui sqrsimiu
sqrsmiiu sqrsmiui sqrsmiiu sqrsmiui sqrsmuii sqrsmuii sqrmuisi sqrmuiis sqrmusii sqrmusii sqrmuisi
sqrmuiis sqrmiusi sqrmiuis sqrmisui sqrmisiu sqrmiisu sqrmiius sqrmsiui sqrmsiiu sqrmsuii sqrmsuii
sqrmsiui sqrmsiiu sqrmiisu sqrmiius sqrmisiu sqrmisui sqrmiusi sqrmiuis sqiirusm sqiirums sqiirsum
sqiirsmu sqiirmsu sqiirmus sqiiursm sqiiurms sqiiusrm sqiiusmr sqiiumsr sqiiumrs sqiisurm sqiisumr
sqiisrum sqiisrmu sqiismru sqiismur sqiimusr sqiimurs sqiimsur sqiimsru sqiimrsu sqiimrus sqiriusm
sqiriums sqirisum sqirismu sqirimsu sqirimus sqiruism sqiruims sqirusim sqirusmi sqirumsi sqirumis
sqirsuim sqirsumi sqirsium sqirsimu sqirsmiu sqirsmui sqirmusi sqirmuis sqirmsui sqirmsiu sqirmisu
sqirmius sqiurism sqiurims sqiursim sqiursmi sqiurmsi sqiurmis sqiuirsm sqiuirms sqiuisrm sqiuismr
sqiuimsr sqiuimrs sqiusirm sqiusimr sqiusrim sqiusrmi sqiusmri sqiusmir sqiumisr sqiumirs sqiumsir
sqiumsri sqiumrsi sqiumris sqisruim sqisrumi sqisrium sqisrimu sqisrmiu sqisrmui sqisurim sqisurmi
sqisuirm sqisuimr sqisumir sqisumri sqisiurm sqisiumr sqisirum sqisirmu sqisimru sqisimur sqismuir
sqismuri sqismiur sqismiru sqismriu sqismrui sqimrusi sqimruis sqimrsui sqimrsiu sqimrisu sqimrius
sqimursi sqimuris sqimusri sqimusir sqimuisr sqimuirs sqimsuri sqimsuir sqimsrui sqimsriu sqimsiru
sqimsiur sqimiusr sqimiurs sqimisur sqimisru sqimirsu sqimirus sqsirium sqsirimu sqsiruim sqsirumi
sqsirmui sqsirmiu sqsiirum sqsiirmu sqsiiurm sqsiiumr sqsiimur sqsiimru sqsiuirm sqsiuimr sqsiurim
sqsiurmi sqsiumri sqsiumir sqsimiur sqsimiru sqsimuir sqsimuri sqsimrui sqsimriu sqsriium sqsriimu
sqsriuim sqsriumi sqsrimui sqsrimiu sqsriium sqsriimu sqsriuim sqsriumi sqsrimui sqsrimiu sqsruiim
sqsruimi sqsruiim sqsruimi sqsrumii sqsrumii sqsrmiui sqsrmiiu sqsrmuii sqsrmuii sqsrmiui sqsrmiiu
sqsirium sqsirimu sqsiruim sqsirumi sqsirmui sqsirmiu sqsiirum sqsiirmu sqsiiurm sqsiiumr sqsiimur
sqsiimru sqsiuirm sqsiuimr sqsiurim sqsiurmi sqsiumri sqsiumir sqsimiur sqsimiru sqsimuir sqsimuri
sqsimrui sqsimriu sqsuriim sqsurimi sqsuriim sqsurimi sqsurmii sqsurmii sqsuirim sqsuirmi sqsuiirm
sqsuiimr sqsuimir sqsuimri sqsuiirm sqsuiimr sqsuirim sqsuirmi sqsuimri sqsuimir sqsumiir sqsumiri
sqsumiir sqsumiri sqsumrii sqsumrii sqsmriui sqsmriiu sqsmruii sqsmruii sqsmriui sqsmriiu sqsmirui
sqsmiriu sqsmiuri sqsmiuir sqsmiiur sqsmiiru sqsmuiri sqsmuiir sqsmurii sqsmurii sqsmuiri sqsmuiir
sqsmiiur sqsmiiru sqsmiuir sqsmiuri sqsmirui sqsmiriu sqmirisu sqmirius sqmirsiu sqmirsui sqmirusi
sqmiruis sqmiirsu sqmiirus sqmiisru sqmiisur sqmiiusr sqmiiurs sqmisiru sqmisiur sqmisriu sqmisrui
sqmisuri sqmisuir sqmiuisr sqmiuirs sqmiusir sqmiusri sqmiursi sqmiuris sqmriisu sqmriius sqmrisiu
sqmrisui sqmriusi sqmriuis sqmriisu sqmriius sqmrisiu sqmrisui sqmriusi sqmriuis sqmrsiiu sqmrsiui
sqmrsiiu sqmrsiui sqmrsuii sqmrsuii sqmruisi sqmruiis sqmrusii sqmrusii sqmruisi sqmruiis sqmirisu
sqmirius sqmirsiu sqmirsui sqmirusi sqmiruis sqmiirsu sqmiirus sqmiisru sqmiisur sqmiiusr sqmiiurs
sqmisiru sqmisiur sqmisriu sqmisrui sqmisuri sqmisuir sqmiuisr sqmiuirs sqmiusir sqmiusri sqmiursi
sqmiuris sqmsriiu sqmsriui sqmsriiu sqmsriui sqmsruii sqmsruii sqmsiriu sqmsirui sqmsiiru sqmsiiur
sqmsiuir sqmsiuri sqmsiiru sqmsiiur sqmsiriu sqmsirui sqmsiuri sqmsiuir sqmsuiir sqmsuiri sqmsuiir
sqmsuiri sqmsurii sqmsurii sqmurisi sqmuriis sqmursii sqmursii sqmurisi sqmuriis sqmuirsi sqmuiris
sqmuisri sqmuisir sqmuiisr sqmuiirs sqmusiri sqmusiir sqmusrii sqmusrii sqmusiri sqmusiir sqmuiisr
sqmuiirs sqmuisir sqmuisri sqmuirsi sqmuiris suqirism suqirims suqirsim suqirsmi suqirmsi suqirmis
suqiirsm suqiirms suqiisrm suqiismr suqiimsr suqiimrs suqisirm suqisimr suqisrim suqisrmi suqismri
suqismir suqimisr suqimirs suqimsir suqimsri suqimrsi suqimris suqriism suqriims suqrisim suqrismi
suqrimsi suqrimis suqriism suqriims suqrisim suqrismi suqrimsi suqrimis suqrsiim suqrsimi suqrsiim
suqrsimi suqrsmii suqrsmii suqrmisi suqrmiis suqrmsii suqrmsii suqrmisi suqrmiis suqirism suqirims
suqirsim suqirsmi suqirmsi suqirmis suqiirsm suqiirms suqiisrm suqiismr suqiimsr suqiimrs suqisirm
suqisimr suqisrim suqisrmi suqismri suqismir suqimisr suqimirs suqimsir suqimsri suqimrsi suqimris
suqsriim suqsrimi suqsriim suqsrimi suqsrmii suqsrmii suqsirim suqsirmi suqsiirm suqsiimr suqsimir
suqsimri suqsiirm suqsiimr suqsirim suqsirmi suqsimri suqsimir suqsmiir suqsmiri suqsmiir suqsmiri
suqsmrii suqsmrii suqmrisi suqmriis suqmrsii suqmrsii suqmrisi suqmriis suqmirsi suqmiris suqmisri
suqmisir suqmiisr suqmiirs suqmsiri suqmsiir suqmsrii suqmsrii suqmsiri suqmsiir suqmiisr suqmiirs
suqmisir suqmisri suqmirsi suqmiris suiqrism suiqrims suiqrsim suiqrsmi suiqrmsi suiqrmis suiqirsm
suiqirms suiqisrm suiqismr suiqimsr suiqimrs suiqsirm suiqsimr suiqsrim suiqsrmi suiqsmri suiqsmir
suiqmisr suiqmirs suiqmsir suiqmsri suiqmrsi suiqmris suirqism suirqims suirqsim suirqsmi suirqmsi
suirqmis suiriqsm suiriqms suirisqm suirismq suirimsq suirimqs suirsiqm suirsimq suirsqim suirsqmi
suirsmqi suirsmiq suirmisq suirmiqs suirmsiq suirmsqi suirmqsi suirmqis suiirqsm suiirqms suiirsqm
suiirsmq suiirmsq suiirmqs suiiqrsm suiiqrms suiiqsrm suiiqsmr suiiqmsr suiiqmrs suiisqrm suiisqmr
suiisrqm suiisrmq suiismrq suiismqr suiimqsr suiimqrs suiimsqr suiimsrq suiimrsq suiimrqs suisriqm
suisrimq suisrqim suisrqmi suisrmqi suisrmiq suisirqm suisirmq suisiqrm suisiqmr suisimqr suisimrq
suisqirm suisqimr suisqrim suisqrmi suisqmri suisqmir suismiqr suismirq suismqir suismqri suismrqi
suismriq suimrisq suimriqs suimrsiq suimrsqi suimrqsi suimrqis suimirsq suimirqs suimisrq suimisqr
suimiqsr suimiqrs suimsirq suimsiqr suimsriq suimsrqi suimsqri suimsqir suimqisr suimqirs suimqsir
suimqsri suimqrsi suimqris suriqism suriqims suriqsim suriqsmi suriqmsi suriqmis suriiqsm suriiqms
suriisqm suriismq suriimsq suriimqs surisiqm surisimq surisqim surisqmi surismqi surismiq surimisq
surimiqs surimsiq surimsqi surimqsi surimqis surqiism surqiims surqisim surqismi surqimsi surqimis
surqiism surqiims surqisim surqismi surqimsi surqimis surqsiim surqsimi surqsiim surqsimi surqsmii
surqsmii surqmisi surqmiis surqmsii surqmsii surqmisi surqmiis suriqism suriqims suriqsim suriqsmi
suriqmsi suriqmis suriiqsm suriiqms suriisqm suriismq suriimsq suriimqs surisiqm surisimq surisqim
surisqmi surismqi surismiq surimisq surimiqs surimsiq surimsqi surimqsi surimqis sursqiim sursqimi
sursqiim sursqimi sursqmii sursqmii sursiqim sursiqmi sursiiqm sursiimq sursimiq sursimqi sursiiqm
sursiimq sursiqim sursiqmi sursimqi sursimiq sursmiiq sursmiqi sursmiiq sursmiqi sursmqii sursmqii
surmqisi surmqiis surmqsii surmqsii surmqisi surmqiis surmiqsi surmiqis surmisqi surmisiq surmiisq
surmiiqs surmsiqi surmsiiq surmsqii surmsqii surmsiqi surmsiiq surmiisq surmiiqs surmisiq surmisqi
surmiqsi surmiqis suiirqsm suiirqms suiirsqm suiirsmq suiirmsq suiirmqs suiiqrsm suiiqrms suiiqsrm
suiiqsmr suiiqmsr suiiqmrs suiisqrm suiisqmr suiisrqm suiisrmq suiismrq suiismqr suiimqsr suiimqrs
suiimsqr suiimsrq suiimrsq suiimrqs suiriqsm suiriqms suirisqm suirismq suirimsq suirimqs suirqism
suirqims suirqsim suirqsmi suirqmsi suirqmis suirsqim suirsqmi suirsiqm suirsimq suirsmiq suirsmqi
suirmqsi suirmqis suirmsqi suirmsiq suirmisq suirmiqs suiqrism suiqrims suiqrsim suiqrsmi suiqrmsi
suiqrmis suiqirsm suiqirms suiqisrm suiqismr suiqimsr suiqimrs suiqsirm suiqsimr suiqsrim suiqsrmi
suiqsmri suiqsmir suiqmisr suiqmirs suiqmsir suiqmsri suiqmrsi suiqmris suisrqim suisrqmi suisriqm
suisrimq suisrmiq suisrmqi suisqrim suisqrmi suisqirm suisqimr suisqmir suisqmri suisiqrm suisiqmr
suisirqm suisirmq suisimrq suisimqr suismqir suismqri suismiqr suismirq suismriq suismrqi suimrqsi
suimrqis suimrsqi suimrsiq suimrisq suimriqs suimqrsi suimqris suimqsri suimqsir suimqisr suimqirs
suimsqri suimsqir suimsrqi suimsriq suimsirq suimsiqr suimiqsr suimiqrs suimisqr suimisrq suimirsq
suimirqs susiriqm susirimq susirqim susirqmi susirmqi susirmiq susiirqm susiirmq susiiqrm susiiqmr
susiimqr susiimrq susiqirm susiqimr susiqrim susiqrmi susiqmri susiqmir susimiqr susimirq susimqir
susimqri susimrqi susimriq susriiqm susriimq susriqim susriqmi susrimqi susrimiq susriiqm susriimq
susriqim susriqmi susrimqi susrimiq susrqiim susrqimi susrqiim susrqimi susrqmii susrqmii susrmiqi
susrmiiq susrmqii susrmqii susrmiqi susrmiiq susiriqm susirimq susirqim susirqmi susirmqi susirmiq
susiirqm susiirmq susiiqrm susiiqmr susiimqr susiimrq susiqirm susiqimr susiqrim susiqrmi susiqmri
susiqmir susimiqr susimirq susimqir susimqri susimrqi susimriq susqriim susqrimi susqriim susqrimi
susqrmii susqrmii susqirim susqirmi susqiirm susqiimr susqimir susqimri susqiirm susqiimr susqirim
susqirmi susqimri susqimir susqmiir susqmiri susqmiir susqmiri susqmrii susqmrii susmriqi susmriiq
susmrqii susmrqii susmriqi susmriiq susmirqi susmiriq susmiqri susmiqir susmiiqr susmiirq susmqiri
susmqiir susmqrii susmqrii susmqiri susmqiir susmiiqr susmiirq susmiqir susmiqri susmirqi susmiriq
sumirisq sumiriqs sumirsiq sumirsqi sumirqsi sumirqis sumiirsq sumiirqs sumiisrq sumiisqr sumiiqsr
sumiiqrs sumisirq sumisiqr sumisriq sumisrqi sumisqri sumisqir sumiqisr sumiqirs sumiqsir sumiqsri
sumiqrsi sumiqris sumriisq sumriiqs sumrisiq sumrisqi sumriqsi sumriqis sumriisq sumriiqs sumrisiq
sumrisqi sumriqsi sumriqis sumrsiiq sumrsiqi sumrsiiq sumrsiqi sumrsqii sumrsqii sumrqisi sumrqiis
sumrqsii sumrqsii sumrqisi sumrqiis sumirisq sumiriqs sumirsiq sumirsqi sumirqsi sumirqis sumiirsq
sumiirqs sumiisrq sumiisqr sumiiqsr sumiiqrs sumisirq sumisiqr sumisriq sumisrqi sumisqri sumisqir
sumiqisr sumiqirs sumiqsir sumiqsri sumiqrsi sumiqris sumsriiq sumsriqi sumsriiq sumsriqi sumsrqii
sumsrqii sumsiriq sumsirqi sumsiirq sumsiiqr sumsiqir sumsiqri sumsiirq sumsiiqr sumsiriq sumsirqi
sumsiqri sumsiqir sumsqiir sumsqiri sumsqiir sumsqiri sumsqrii sumsqrii sumqrisi sumqriis sumqrsii
sumqrsii sumqrisi sumqriis sumqirsi sumqiris sumqisri sumqisir sumqiisr sumqiirs sumqsiri sumqsiir
sumqsrii sumqsrii sumqsiri sumqsiir sumqiisr sumqiirs sumqisir sumqisri sumqirsi sumqiris siuqrism
siuqrims siuqrsim siuqrsmi siuqrmsi siuqrmis siuqirsm siuqirms siuqisrm siuqismr siuqimsr siuqimrs
siuqsirm siuqsimr siuqsrim siuqsrmi siuqsmri siuqsmir siuqmisr siuqmirs siuqmsir siuqmsri siuqmrsi
siuqmris siurqism siurqims siurqsim siurqsmi siurqmsi siurqmis siuriqsm siuriqms siurisqm siurismq
siurimsq siurimqs siursiqm siursimq siursqim siursqmi siursmqi siursmiq siurmisq siurmiqs siurmsiq
siurmsqi siurmqsi siurmqis siuirqsm siuirqms siuirsqm siuirsmq siuirmsq siuirmqs siuiqrsm siuiqrms
siuiqsrm siuiqsmr siuiqmsr siuiqmrs siuisqrm siuisqmr siuisrqm siuisrmq siuismrq siuismqr siuimqsr
siuimqrs siuimsqr siuimsrq siuimrsq siuimrqs siusriqm siusrimq siusrqim siusrqmi siusrmqi siusrmiq
siusirqm siusirmq siusiqrm siusiqmr siusimqr siusimrq siusqirm siusqimr siusqrim siusqrmi siusqmri
siusqmir siusmiqr siusmirq siusmqir siusmqri siusmrqi siusmriq siumrisq siumriqs siumrsiq siumrsqi
siumrqsi siumrqis siumirsq siumirqs siumisrq siumisqr siumiqsr siumiqrs siumsirq siumsiqr siumsriq
siumsrqi siumsqri siumsqir siumqisr siumqirs siumqsir siumqsri siumqrsi siumqris siqurism siqurims
siqursim siqursmi siqurmsi siqurmis siquirsm siquirms siquisrm siquismr siquimsr siquimrs siqusirm
siqusimr siqusrim siqusrmi siqusmri siqusmir siqumisr siqumirs siqumsir siqumsri siqumrsi siqumris
siqruism siqruims siqrusim siqrusmi siqrumsi siqrumis siqriusm siqriums siqrisum siqrismu siqrimsu
siqrimus siqrsium siqrsimu siqrsuim siqrsumi siqrsmui siqrsmiu siqrmisu siqrmius siqrmsiu siqrmsui
siqrmusi siqrmuis siqirusm siqirums siqirsum siqirsmu siqirmsu siqirmus siqiursm siqiurms siqiusrm
siqiusmr siqiumsr siqiumrs siqisurm siqisumr siqisrum siqisrmu siqismru siqismur siqimusr siqimurs
siqimsur siqimsru siqimrsu siqimrus siqsrium siqsrimu siqsruim siqsrumi siqsrmui siqsrmiu siqsirum
siqsirmu siqsiurm siqsiumr siqsimur siqsimru siqsuirm siqsuimr siqsurim siqsurmi siqsumri siqsumir
siqsmiur siqsmiru siqsmuir siqsmuri siqsmrui siqsmriu siqmrisu siqmrius siqmrsiu siqmrsui siqmrusi
siqmruis siqmirsu siqmirus siqmisru siqmisur siqmiusr siqmiurs siqmsiru siqmsiur siqmsriu siqmsrui
siqmsuri siqmsuir siqmuisr siqmuirs siqmusir siqmusri siqmursi siqmuris sirquism sirquims sirqusim
sirqusmi sirqumsi sirqumis sirqiusm sirqiums sirqisum sirqismu sirqimsu sirqimus sirqsium sirqsimu
sirqsuim sirqsumi sirqsmui sirqsmiu sirqmisu sirqmius sirqmsiu sirqmsui sirqmusi sirqmuis siruqism
siruqims siruqsim siruqsmi siruqmsi siruqmis siruiqsm siruiqms siruisqm siruismq siruimsq siruimqs
sirusiqm sirusimq sirusqim sirusqmi sirusmqi sirusmiq sirumisq sirumiqs sirumsiq sirumsqi sirumqsi
sirumqis siriuqsm siriuqms siriusqm siriusmq siriumsq siriumqs siriqusm siriqums siriqsum siriqsmu
siriqmsu siriqmus sirisqum sirisqmu sirisuqm sirisumq sirismuq sirismqu sirimqsu sirimqus sirimsqu
sirimsuq sirimusq sirimuqs sirsuiqm sirsuimq sirsuqim sirsuqmi sirsumqi sirsumiq sirsiuqm sirsiumq
sirsiqum sirsiqmu sirsimqu sirsimuq sirsqium sirsqimu sirsquim sirsqumi sirsqmui sirsqmiu sirsmiqu
sirsmiuq sirsmqiu sirsmqui sirsmuqi sirsmuiq sirmuisq sirmuiqs sirmusiq sirmusqi sirmuqsi sirmuqis
sirmiusq sirmiuqs sirmisuq sirmisqu sirmiqsu sirmiqus sirmsiuq sirmsiqu sirmsuiq sirmsuqi sirmsqui
sirmsqiu sirmqisu sirmqius sirmqsiu sirmqsui sirmqusi sirmquis siiqrusm siiqrums siiqrsum siiqrsmu
siiqrmsu siiqrmus siiqursm siiqurms siiqusrm siiqusmr siiqumsr siiqumrs siiqsurm siiqsumr siiqsrum
siiqsrmu siiqsmru siiqsmur siiqmusr siiqmurs siiqmsur siiqmsru siiqmrsu siiqmrus siirqusm siirqums
siirqsum siirqsmu siirqmsu siirqmus siiruqsm siiruqms siirusqm siirusmq siirumsq siirumqs siirsuqm
siirsumq siirsqum siirsqmu siirsmqu siirsmuq siirmusq siirmuqs siirmsuq siirmsqu siirmqsu siirmqus
siiurqsm siiurqms siiursqm siiursmq siiurmsq siiurmqs siiuqrsm siiuqrms siiuqsrm siiuqsmr siiuqmsr
siiuqmrs siiusqrm siiusqmr siiusrqm siiusrmq siiusmrq siiusmqr siiumqsr siiumqrs siiumsqr siiumsrq
siiumrsq siiumrqs siisruqm siisrumq siisrqum siisrqmu siisrmqu siisrmuq siisurqm siisurmq siisuqrm
siisuqmr siisumqr siisumrq siisqurm siisqumr siisqrum siisqrmu siisqmru siisqmur siismuqr siismurq
siismqur siismqru siismrqu siismruq siimrusq siimruqs siimrsuq siimrsqu siimrqsu siimrqus siimursq
siimurqs siimusrq siimusqr siimuqsr siimuqrs siimsurq siimsuqr siimsruq siimsrqu siimsqru siimsqur
siimqusr siimqurs siimqsur siimqsru siimqrsu siimqrus sisqrium sisqrimu sisqruim sisqrumi sisqrmui
sisqrmiu sisqirum sisqirmu sisqiurm sisqiumr sisqimur sisqimru sisquirm sisquimr sisqurim sisqurmi
sisqumri sisqumir sisqmiur sisqmiru sisqmuir sisqmuri sisqmrui sisqmriu sisrqium sisrqimu sisrquim
sisrqumi sisrqmui sisrqmiu sisriqum sisriqmu sisriuqm sisriumq sisrimuq sisrimqu sisruiqm sisruimq
sisruqim sisruqmi sisrumqi sisrumiq sisrmiuq sisrmiqu sisrmuiq sisrmuqi sisrmqui sisrmqiu sisirqum
sisirqmu sisiruqm sisirumq sisirmuq sisirmqu sisiqrum sisiqrmu sisiqurm sisiqumr sisiqmur sisiqmru
sisiuqrm sisiuqmr sisiurqm sisiurmq sisiumrq sisiumqr sisimqur sisimqru sisimuqr sisimurq sisimruq
sisimrqu sisuriqm sisurimq sisurqim sisurqmi sisurmqi sisurmiq sisuirqm sisuirmq sisuiqrm sisuiqmr
sisuimqr sisuimrq sisuqirm sisuqimr sisuqrim sisuqrmi sisuqmri sisuqmir sisumiqr sisumirq sisumqir
sisumqri sisumrqi sisumriq sismriuq sismriqu sismruiq sismruqi sismrqui sismrqiu sismiruq sismirqu
sismiurq sismiuqr sismiqur sismiqru sismuirq sismuiqr sismuriq sismurqi sismuqri sismuqir sismqiur
sismqiru sismquir sismquri sismqrui sismqriu simqrisu simqrius simqrsiu simqrsui simqrusi simqruis
simqirsu simqirus simqisru simqisur simqiusr simqiurs simqsiru simqsiur simqsriu simqsrui simqsuri
simqsuir simquisr simquirs simqusir simqusri simqursi simquris simrqisu simrqius simrqsiu simrqsui
simrqusi simrquis simriqsu simriqus simrisqu simrisuq simriusq simriuqs simrsiqu simrsiuq simrsqiu
simrsqui simrsuqi simrsuiq simruisq simruiqs simrusiq simrusqi simruqsi simruqis simirqsu simirqus
simirsqu simirsuq simirusq simiruqs simiqrsu simiqrus simiqsru simiqsur simiqusr simiqurs simisqru
simisqur simisrqu simisruq simisurq simisuqr simiuqsr simiuqrs simiusqr simiusrq simiursq simiurqs
simsriqu simsriuq simsrqiu simsrqui simsruqi simsruiq simsirqu simsiruq simsiqru simsiqur simsiuqr
simsiurq simsqiru simsqiur simsqriu simsqrui simsquri simsquir simsuiqr simsuirq simsuqir simsuqri
simsurqi simsuriq simurisq simuriqs simursiq simursqi simurqsi simurqis simuirsq simuirqs simuisrq
simuisqr simuiqsr simuiqrs simusirq simusiqr simusriq simusrqi simusqri simusqir simuqisr simuqirs
simuqsir simuqsri simuqrsi simuqris sruiqism sruiqims sruiqsim sruiqsmi sruiqmsi sruiqmis sruiiqsm
sruiiqms sruiisqm sruiismq sruiimsq sruiimqs sruisiqm sruisimq sruisqim sruisqmi sruismqi sruismiq
sruimisq sruimiqs sruimsiq sruimsqi sruimqsi sruimqis sruqiism sruqiims sruqisim sruqismi sruqimsi
sruqimis sruqiism sruqiims sruqisim sruqismi sruqimsi sruqimis sruqsiim sruqsimi sruqsiim sruqsimi
sruqsmii sruqsmii sruqmisi sruqmiis sruqmsii sruqmsii sruqmisi sruqmiis sruiqism sruiqims sruiqsim
sruiqsmi sruiqmsi sruiqmis sruiiqsm sruiiqms sruiisqm sruiismq sruiimsq sruiimqs sruisiqm sruisimq
sruisqim sruisqmi sruismqi sruismiq sruimisq sruimiqs sruimsiq sruimsqi sruimqsi sruimqis srusqiim
srusqimi srusqiim srusqimi srusqmii srusqmii srusiqim srusiqmi srusiiqm srusiimq srusimiq srusimqi
srusiiqm srusiimq srusiqim srusiqmi srusimqi srusimiq srusmiiq srusmiqi srusmiiq srusmiqi srusmqii
srusmqii srumqisi srumqiis srumqsii srumqsii srumqisi srumqiis srumiqsi srumiqis srumisqi srumisiq
srumiisq srumiiqs srumsiqi srumsiiq srumsqii srumsqii srumsiqi srumsiiq srumiisq srumiiqs srumisiq
srumisqi srumiqsi srumiqis sriuqism sriuqims sriuqsim sriuqsmi sriuqmsi sriuqmis sriuiqsm sriuiqms
sriuisqm sriuismq sriuimsq sriuimqs sriusiqm sriusimq sriusqim sriusqmi sriusmqi sriusmiq sriumisq
sriumiqs sriumsiq sriumsqi sriumqsi sriumqis sriquism sriquims sriqusim sriqusmi sriqumsi sriqumis
sriqiusm sriqiums sriqisum sriqismu sriqimsu sriqimus sriqsium sriqsimu sriqsuim sriqsumi sriqsmui
sriqsmiu sriqmisu sriqmius sriqmsiu sriqmsui sriqmusi sriqmuis sriiqusm sriiqums sriiqsum sriiqsmu
sriiqmsu sriiqmus sriiuqsm sriiuqms sriiusqm sriiusmq sriiumsq sriiumqs sriisuqm sriisumq sriisqum
sriisqmu sriismqu sriismuq sriimusq sriimuqs sriimsuq sriimsqu sriimqsu sriimqus srisqium srisqimu
srisquim srisqumi srisqmui srisqmiu srisiqum srisiqmu srisiuqm srisiumq srisimuq srisimqu srisuiqm
srisuimq srisuqim srisuqmi srisumqi srisumiq srismiuq srismiqu srismuiq srismuqi srismqui srismqiu
srimqisu srimqius srimqsiu srimqsui srimqusi srimquis srimiqsu srimiqus srimisqu srimisuq srimiusq
srimiuqs srimsiqu srimsiuq srimsqiu srimsqui srimsuqi srimsuiq srimuisq srimuiqs srimusiq srimusqi
srimuqsi srimuqis srqiuism srqiuims srqiusim srqiusmi srqiumsi srqiumis srqiiusm srqiiums srqiisum
srqiismu srqiimsu srqiimus srqisium srqisimu srqisuim srqisumi srqismui srqismiu srqimisu srqimius
srqimsiu srqimsui srqimusi srqimuis srquiism srquiims srquisim srquismi srquimsi srquimis srquiism
srquiims srquisim srquismi srquimsi srquimis srqusiim srqusimi srqusiim srqusimi srqusmii srqusmii
srqumisi srqumiis srqumsii srqumsii srqumisi srqumiis srqiuism srqiuims srqiusim srqiusmi srqiumsi
srqiumis srqiiusm srqiiums srqiisum srqiismu srqiimsu srqiimus srqisium srqisimu srqisuim srqisumi
srqismui srqismiu srqimisu srqimius srqimsiu srqimsui srqimusi srqimuis srqsuiim srqsuimi srqsuiim
srqsuimi srqsumii srqsumii srqsiuim srqsiumi srqsiium srqsiimu srqsimiu srqsimui srqsiium srqsiimu
srqsiuim srqsiumi srqsimui srqsimiu srqsmiiu srqsmiui srqsmiiu srqsmiui srqsmuii srqsmuii srqmuisi
srqmuiis srqmusii srqmusii srqmuisi srqmuiis srqmiusi srqmiuis srqmisui srqmisiu srqmiisu srqmiius
srqmsiui srqmsiiu srqmsuii srqmsuii srqmsiui srqmsiiu srqmiisu srqmiius srqmisiu srqmisui srqmiusi
srqmiuis sriiqusm sriiqums sriiqsum sriiqsmu sriiqmsu sriiqmus sriiuqsm sriiuqms sriiusqm sriiusmq
sriiumsq sriiumqs sriisuqm sriisumq sriisqum sriisqmu sriismqu sriismuq sriimusq sriimuqs sriimsuq
sriimsqu sriimqsu sriimqus sriqiusm sriqiums sriqisum sriqismu sriqimsu sriqimus sriquism sriquims
sriqusim sriqusmi sriqumsi sriqumis sriqsuim sriqsumi sriqsium sriqsimu sriqsmiu sriqsmui sriqmusi
sriqmuis sriqmsui sriqmsiu sriqmisu sriqmius sriuqism sriuqims sriuqsim sriuqsmi sriuqmsi sriuqmis
sriuiqsm sriuiqms sriuisqm sriuismq sriuimsq sriuimqs sriusiqm sriusimq sriusqim sriusqmi sriusmqi
sriusmiq sriumisq sriumiqs sriumsiq sriumsqi sriumqsi sriumqis srisquim srisqumi srisqium srisqimu
srisqmiu srisqmui srisuqim srisuqmi srisuiqm srisuimq srisumiq srisumqi srisiuqm srisiumq srisiqum
srisiqmu srisimqu srisimuq srismuiq srismuqi srismiuq srismiqu srismqiu srismqui srimqusi srimquis
srimqsui srimqsiu srimqisu srimqius srimuqsi srimuqis srimusqi srimusiq srimuisq srimuiqs srimsuqi
srimsuiq srimsqui srimsqiu srimsiqu srimsiuq srimiusq srimiuqs srimisuq srimisqu srimiqsu srimiqus
srsiqium srsiqimu srsiquim srsiqumi srsiqmui srsiqmiu srsiiqum srsiiqmu srsiiuqm srsiiumq srsiimuq
srsiimqu srsiuiqm srsiuimq srsiuqim srsiuqmi srsiumqi srsiumiq srsimiuq srsimiqu srsimuiq srsimuqi
srsimqui srsimqiu srsqiium srsqiimu srsqiuim srsqiumi srsqimui srsqimiu srsqiium srsqiimu srsqiuim
srsqiumi srsqimui srsqimiu srsquiim srsquimi srsquiim srsquimi srsqumii srsqumii srsqmiui srsqmiiu
srsqmuii srsqmuii srsqmiui srsqmiiu srsiqium srsiqimu srsiquim srsiqumi srsiqmui srsiqmiu srsiiqum
srsiiqmu srsiiuqm srsiiumq srsiimuq srsiimqu srsiuiqm srsiuimq srsiuqim srsiuqmi srsiumqi srsiumiq
srsimiuq srsimiqu srsimuiq srsimuqi srsimqui srsimqiu srsuqiim srsuqimi srsuqiim srsuqimi srsuqmii
srsuqmii srsuiqim srsuiqmi srsuiiqm srsuiimq srsuimiq srsuimqi srsuiiqm srsuiimq srsuiqim srsuiqmi
srsuimqi srsuimiq srsumiiq srsumiqi srsumiiq srsumiqi srsumqii srsumqii srsmqiui srsmqiiu srsmquii
srsmquii srsmqiui srsmqiiu srsmiqui srsmiqiu srsmiuqi srsmiuiq srsmiiuq srsmiiqu srsmuiqi srsmuiiq
srsmuqii srsmuqii srsmuiqi srsmuiiq srsmiiuq srsmiiqu srsmiuiq srsmiuqi srsmiqui srsmiqiu srmiqisu
srmiqius srmiqsiu srmiqsui srmiqusi srmiquis srmiiqsu srmiiqus srmiisqu srmiisuq srmiiusq srmiiuqs
srmisiqu srmisiuq srmisqiu srmisqui srmisuqi srmisuiq srmiuisq srmiuiqs srmiusiq srmiusqi srmiuqsi
srmiuqis srmqiisu srmqiius srmqisiu srmqisui srmqiusi srmqiuis srmqiisu srmqiius srmqisiu srmqisui
srmqiusi srmqiuis srmqsiiu srmqsiui srmqsiiu srmqsiui srmqsuii srmqsuii srmquisi srmquiis srmqusii
srmqusii srmquisi srmquiis srmiqisu srmiqius srmiqsiu srmiqsui srmiqusi srmiquis srmiiqsu srmiiqus
srmiisqu srmiisuq srmiiusq srmiiuqs srmisiqu srmisiuq srmisqiu srmisqui srmisuqi srmisuiq srmiuisq
srmiuiqs srmiusiq srmiusqi srmiuqsi srmiuqis srmsqiiu srmsqiui srmsqiiu srmsqiui srmsquii srmsquii
srmsiqiu srmsiqui srmsiiqu srmsiiuq srmsiuiq srmsiuqi srmsiiqu srmsiiuq srmsiqiu srmsiqui srmsiuqi
srmsiuiq srmsuiiq srmsuiqi srmsuiiq srmsuiqi srmsuqii srmsuqii srmuqisi srmuqiis srmuqsii srmuqsii
srmuqisi srmuqiis srmuiqsi srmuiqis srmuisqi srmuisiq srmuiisq srmuiiqs srmusiqi srmusiiq srmusqii
srmusqii srmusiqi srmusiiq srmuiisq srmuiiqs srmuisiq srmuisqi srmuiqsi srmuiqis siuirqsm siuirqms
siuirsqm siuirsmq siuirmsq siuirmqs siuiqrsm siuiqrms siuiqsrm siuiqsmr siuiqmsr siuiqmrs siuisqrm
siuisqmr siuisrqm siuisrmq siuismrq siuismqr siuimqsr siuimqrs siuimsqr siuimsrq siuimrsq siuimrqs
siuriqsm siuriqms siurisqm siurismq siurimsq siurimqs siurqism siurqims siurqsim siurqsmi siurqmsi
siurqmis siursqim siursqmi siursiqm siursimq siursmiq siursmqi siurmqsi siurmqis siurmsqi siurmsiq
siurmisq siurmiqs siuqrism siuqrims siuqrsim siuqrsmi siuqrmsi siuqrmis siuqirsm siuqirms siuqisrm
siuqismr siuqimsr siuqimrs siuqsirm siuqsimr siuqsrim siuqsrmi siuqsmri siuqsmir siuqmisr siuqmirs
siuqmsir siuqmsri siuqmrsi siuqmris siusrqim siusrqmi siusriqm siusrimq siusrmiq siusrmqi siusqrim
siusqrmi siusqirm siusqimr siusqmir siusqmri siusiqrm siusiqmr siusirqm siusirmq siusimrq siusimqr
siusmqir siusmqri siusmiqr siusmirq siusmriq siusmrqi siumrqsi siumrqis siumrsqi siumrsiq siumrisq
siumriqs siumqrsi siumqris siumqsri siumqsir siumqisr siumqirs siumsqri siumsqir siumsrqi siumsriq
siumsirq siumsiqr siumiqsr siumiqrs siumisqr siumisrq siumirsq siumirqs siiurqsm siiurqms siiursqm
siiursmq siiurmsq siiurmqs siiuqrsm siiuqrms siiuqsrm siiuqsmr siiuqmsr siiuqmrs siiusqrm siiusqmr
siiusrqm siiusrmq siiusmrq siiusmqr siiumqsr siiumqrs siiumsqr siiumsrq siiumrsq siiumrqs siiruqsm
siiruqms siirusqm siirusmq siirumsq siirumqs siirqusm siirqums siirqsum siirqsmu siirqmsu siirqmus
siirsqum siirsqmu siirsuqm siirsumq siirsmuq siirsmqu siirmqsu siirmqus siirmsqu siirmsuq siirmusq
siirmuqs siiqrusm siiqrums siiqrsum siiqrsmu siiqrmsu siiqrmus siiqursm siiqurms siiqusrm siiqusmr
siiqumsr siiqumrs siiqsurm siiqsumr siiqsrum siiqsrmu siiqsmru siiqsmur siiqmusr siiqmurs siiqmsur
siiqmsru siiqmrsu siiqmrus siisrqum siisrqmu siisruqm siisrumq siisrmuq siisrmqu siisqrum siisqrmu
siisqurm siisqumr siisqmur siisqmru siisuqrm siisuqmr siisurqm siisurmq siisumrq siisumqr siismqur
siismqru siismuqr siismurq siismruq siismrqu siimrqsu siimrqus siimrsqu siimrsuq siimrusq siimruqs
siimqrsu siimqrus siimqsru siimqsur siimqusr siimqurs siimsqru siimsqur siimsrqu siimsruq siimsurq
siimsuqr siimuqsr siimuqrs siimusqr siimusrq siimursq siimurqs siriuqsm siriuqms siriusqm siriusmq
siriumsq siriumqs siriqusm siriqums siriqsum siriqsmu siriqmsu siriqmus sirisqum sirisqmu sirisuqm
sirisumq sirismuq sirismqu sirimqsu sirimqus sirimsqu sirimsuq sirimusq sirimuqs siruiqsm siruiqms
siruisqm siruismq siruimsq siruimqs siruqism siruqims siruqsim siruqsmi siruqmsi siruqmis sirusqim
sirusqmi sirusiqm sirusimq sirusmiq sirusmqi sirumqsi sirumqis sirumsqi sirumsiq sirumisq sirumiqs
sirquism sirquims sirqusim sirqusmi sirqumsi sirqumis sirqiusm sirqiums sirqisum sirqismu sirqimsu
sirqimus sirqsium sirqsimu sirqsuim sirqsumi sirqsmui sirqsmiu sirqmisu sirqmius sirqmsiu sirqmsui
sirqmusi sirqmuis sirsuqim sirsuqmi sirsuiqm sirsuimq sirsumiq sirsumqi sirsquim sirsqumi sirsqium
sirsqimu sirsqmiu sirsqmui sirsiqum sirsiqmu sirsiuqm sirsiumq sirsimuq sirsimqu sirsmqiu sirsmqui
sirsmiqu sirsmiuq sirsmuiq sirsmuqi sirmuqsi sirmuqis sirmusqi sirmusiq sirmuisq sirmuiqs sirmqusi
sirmquis sirmqsui sirmqsiu sirmqisu sirmqius sirmsqui sirmsqiu sirmsuqi sirmsuiq sirmsiuq sirmsiqu
sirmiqsu sirmiqus sirmisqu sirmisuq sirmiusq sirmiuqs siqirusm siqirums siqirsum siqirsmu siqirmsu
siqirmus siqiursm siqiurms siqiusrm siqiusmr siqiumsr siqiumrs siqisurm siqisumr siqisrum siqisrmu
siqismru siqismur siqimusr siqimurs siqimsur siqimsru siqimrsu siqimrus siqriusm siqriums siqrisum
siqrismu siqrimsu siqrimus siqruism siqruims siqrusim siqrusmi siqrumsi siqrumis siqrsuim siqrsumi
siqrsium siqrsimu siqrsmiu siqrsmui siqrmusi siqrmuis siqrmsui siqrmsiu siqrmisu siqrmius siqurism
siqurims siqursim siqursmi siqurmsi siqurmis siquirsm siquirms siquisrm siquismr siquimsr siquimrs
siqusirm siqusimr siqusrim siqusrmi siqusmri siqusmir siqumisr siqumirs siqumsir siqumsri siqumrsi
siqumris siqsruim siqsrumi siqsrium siqsrimu siqsrmiu siqsrmui siqsurim siqsurmi siqsuirm siqsuimr
siqsumir siqsumri siqsiurm siqsiumr siqsirum siqsirmu siqsimru siqsimur siqsmuir siqsmuri siqsmiur
siqsmiru siqsmriu siqsmrui siqmrusi siqmruis siqmrsui siqmrsiu siqmrisu siqmrius siqmursi siqmuris
siqmusri siqmusir siqmuisr siqmuirs siqmsuri siqmsuir siqmsrui siqmsriu siqmsiru siqmsiur siqmiusr
siqmiurs siqmisur siqmisru siqmirsu siqmirus sisirqum sisirqmu sisiruqm sisirumq sisirmuq sisirmqu
sisiqrum sisiqrmu sisiqurm sisiqumr sisiqmur sisiqmru sisiuqrm sisiuqmr sisiurqm sisiurmq sisiumrq
sisiumqr sisimqur sisimqru sisimuqr sisimurq sisimruq sisimrqu sisriqum sisriqmu sisriuqm sisriumq
sisrimuq sisrimqu sisrqium sisrqimu sisrquim sisrqumi sisrqmui sisrqmiu sisruqim sisruqmi sisruiqm
sisruimq sisrumiq sisrumqi sisrmqui sisrmqiu sisrmuqi sisrmuiq sisrmiuq sisrmiqu sisqrium sisqrimu
sisqruim sisqrumi sisqrmui sisqrmiu sisqirum sisqirmu sisqiurm sisqiumr sisqimur sisqimru sisquirm
sisquimr sisqurim sisqurmi sisqumri sisqumir sisqmiur sisqmiru sisqmuir sisqmuri sisqmrui sisqmriu
sisurqim sisurqmi sisuriqm sisurimq sisurmiq sisurmqi sisuqrim sisuqrmi sisuqirm sisuqimr sisuqmir
sisuqmri sisuiqrm sisuiqmr sisuirqm sisuirmq sisuimrq sisuimqr sisumqir sisumqri sisumiqr sisumirq
sisumriq sisumrqi sismrqui sismrqiu sismruqi sismruiq sismriuq sismriqu sismqrui sismqriu sismquri
sismquir sismqiur sismqiru sismuqri sismuqir sismurqi sismuriq sismuirq sismuiqr sismiqur sismiqru
sismiuqr sismiurq sismiruq sismirqu simirqsu simirqus simirsqu simirsuq simirusq simiruqs simiqrsu
simiqrus simiqsru simiqsur simiqusr simiqurs simisqru simisqur simisrqu simisruq simisurq simisuqr
simiuqsr simiuqrs simiusqr simiusrq simiursq simiurqs simriqsu simriqus simrisqu simrisuq simriusq
simriuqs simrqisu simrqius simrqsiu simrqsui simrqusi simrquis simrsqiu simrsqui simrsiqu simrsiuq
simrsuiq simrsuqi simruqsi simruqis simrusqi simrusiq simruisq simruiqs simqrisu simqrius simqrsiu
simqrsui simqrusi simqruis simqirsu simqirus simqisru simqisur simqiusr simqiurs simqsiru simqsiur
simqsriu simqsrui simqsuri simqsuir simquisr simquirs simqusir simqusri simqursi simquris simsrqiu
simsrqui simsriqu simsriuq simsruiq simsruqi simsqriu simsqrui simsqiru simsqiur simsquir simsquri
simsiqru simsiqur simsirqu simsiruq simsiurq simsiuqr simsuqir simsuqri simsuiqr simsuirq simsuriq
simsurqi simurqsi simurqis simursqi simursiq simurisq simuriqs simuqrsi simuqris simuqsri simuqsir
simuqisr simuqirs simusqri simusqir simusrqi simusriq simusirq simusiqr simuiqsr simuiqrs simuisqr
simuisrq simuirsq simuirqs ssuiriqm ssuirimq ssuirqim ssuirqmi ssuirmqi ssuirmiq ssuiirqm ssuiirmq
ssuiiqrm ssuiiqmr ssuiimqr ssuiimrq ssuiqirm ssuiqimr ssuiqrim ssuiqrmi ssuiqmri ssuiqmir ssuimiqr
ssuimirq ssuimqir ssuimqri ssuimrqi ssuimriq ssuriiqm ssuriimq ssuriqim ssuriqmi ssurimqi ssurimiq
ssuriiqm ssuriimq ssuriqim ssuriqmi ssurimqi ssurimiq ssurqiim ssurqimi ssurqiim ssurqimi ssurqmii
ssurqmii ssurmiqi ssurmiiq ssurmqii ssurmqii ssurmiqi ssurmiiq ssuiriqm ssuirimq ssuirqim ssuirqmi
ssuirmqi ssuirmiq ssuiirqm ssuiirmq ssuiiqrm ssuiiqmr ssuiimqr ssuiimrq ssuiqirm ssuiqimr ssuiqrim
ssuiqrmi ssuiqmri ssuiqmir ssuimiqr ssuimirq ssuimqir ssuimqri ssuimrqi ssuimriq ssuqriim ssuqrimi
ssuqriim ssuqrimi ssuqrmii ssuqrmii ssuqirim ssuqirmi ssuqiirm ssuqiimr ssuqimir ssuqimri ssuqiirm
ssuqiimr ssuqirim ssuqirmi ssuqimri ssuqimir ssuqmiir ssuqmiri ssuqmiir ssuqmiri ssuqmrii ssuqmrii
ssumriqi ssumriiq ssumrqii ssumrqii ssumriqi ssumriiq ssumirqi ssumiriq ssumiqri ssumiqir ssumiiqr
ssumiirq ssumqiri ssumqiir ssumqrii ssumqrii ssumqiri ssumqiir ssumiiqr ssumiirq ssumiqir ssumiqri
ssumirqi ssumiriq ssiuriqm ssiurimq ssiurqim ssiurqmi ssiurmqi ssiurmiq ssiuirqm ssiuirmq ssiuiqrm
ssiuiqmr ssiuimqr ssiuimrq ssiuqirm ssiuqimr ssiuqrim ssiuqrmi ssiuqmri ssiuqmir ssiumiqr ssiumirq
ssiumqir ssiumqri ssiumrqi ssiumriq ssiruiqm ssiruimq ssiruqim ssiruqmi ssirumqi ssirumiq ssiriuqm
ssiriumq ssiriqum ssiriqmu ssirimqu ssirimuq ssirqium ssirqimu ssirquim ssirqumi ssirqmui ssirqmiu
ssirmiqu ssirmiuq ssirmqiu ssirmqui ssirmuqi ssirmuiq ssiiruqm ssiirumq ssiirqum ssiirqmu ssiirmqu
ssiirmuq ssiiurqm ssiiurmq ssiiuqrm ssiiuqmr ssiiumqr ssiiumrq ssiiqurm ssiiqumr ssiiqrum ssiiqrmu
ssiiqmru ssiiqmur ssiimuqr ssiimurq ssiimqur ssiimqru ssiimrqu ssiimruq ssiqrium ssiqrimu ssiqruim
ssiqrumi ssiqrmui ssiqrmiu ssiqirum ssiqirmu ssiqiurm ssiqiumr ssiqimur ssiqimru ssiquirm ssiquimr
ssiqurim ssiqurmi ssiqumri ssiqumir ssiqmiur ssiqmiru ssiqmuir ssiqmuri ssiqmrui ssiqmriu ssimriqu
ssimriuq ssimrqiu ssimrqui ssimruqi ssimruiq ssimirqu ssimiruq ssimiqru ssimiqur ssimiuqr ssimiurq
ssimqiru ssimqiur ssimqriu ssimqrui ssimquri ssimquir ssimuiqr ssimuirq ssimuqir ssimuqri ssimurqi
ssimuriq ssriuiqm ssriuimq ssriuqim ssriuqmi ssriumqi ssriumiq ssriiuqm ssriiumq ssriiqum ssriiqmu
ssriimqu ssriimuq ssriqium ssriqimu ssriquim ssriqumi ssriqmui ssriqmiu ssrimiqu ssrimiuq ssrimqiu
ssrimqui ssrimuqi ssrimuiq ssruiiqm ssruiimq ssruiqim ssruiqmi ssruimqi ssruimiq ssruiiqm ssruiimq
ssruiqim ssruiqmi ssruimqi ssruimiq ssruqiim ssruqimi ssruqiim ssruqimi ssruqmii ssruqmii ssrumiqi
ssrumiiq ssrumqii ssrumqii ssrumiqi ssrumiiq ssriuiqm ssriuimq ssriuqim ssriuqmi ssriumqi ssriumiq
ssriiuqm ssriiumq ssriiqum ssriiqmu ssriimqu ssriimuq ssriqium ssriqimu ssriquim ssriqumi ssriqmui
ssriqmiu ssrimiqu ssrimiuq ssrimqiu ssrimqui ssrimuqi ssrimuiq ssrquiim ssrquimi ssrquiim ssrquimi
ssrqumii ssrqumii ssrqiuim ssrqiumi ssrqiium ssrqiimu ssrqimiu ssrqimui ssrqiium ssrqiimu ssrqiuim
ssrqiumi ssrqimui ssrqimiu ssrqmiiu ssrqmiui ssrqmiiu ssrqmiui ssrqmuii ssrqmuii ssrmuiqi ssrmuiiq
ssrmuqii ssrmuqii ssrmuiqi ssrmuiiq ssrmiuqi ssrmiuiq ssrmiqui ssrmiqiu ssrmiiqu ssrmiiuq ssrmqiui
ssrmqiiu ssrmquii ssrmquii ssrmqiui ssrmqiiu ssrmiiqu ssrmiiuq ssrmiqiu ssrmiqui ssrmiuqi ssrmiuiq
ssiiruqm ssiirumq ssiirqum ssiirqmu ssiirmqu ssiirmuq ssiiurqm ssiiurmq ssiiuqrm ssiiuqmr ssiiumqr
ssiiumrq ssiiqurm ssiiqumr ssiiqrum ssiiqrmu ssiiqmru ssiiqmur ssiimuqr ssiimurq ssiimqur ssiimqru
ssiimrqu ssiimruq ssiriuqm ssiriumq ssiriqum ssiriqmu ssirimqu ssirimuq ssiruiqm ssiruimq ssiruqim
ssiruqmi ssirumqi ssirumiq ssirquim ssirqumi ssirqium ssirqimu ssirqmiu ssirqmui ssirmuqi ssirmuiq
ssirmqui ssirmqiu ssirmiqu ssirmiuq ssiuriqm ssiurimq ssiurqim ssiurqmi ssiurmqi ssiurmiq ssiuirqm
ssiuirmq ssiuiqrm ssiuiqmr ssiuimqr ssiuimrq ssiuqirm ssiuqimr ssiuqrim ssiuqrmi ssiuqmri ssiuqmir
ssiumiqr ssiumirq ssiumqir ssiumqri ssiumrqi ssiumriq ssiqruim ssiqrumi ssiqrium ssiqrimu ssiqrmiu
ssiqrmui ssiqurim ssiqurmi ssiquirm ssiquimr ssiqumir ssiqumri ssiqiurm ssiqiumr ssiqirum ssiqirmu
ssiqimru ssiqimur ssiqmuir ssiqmuri ssiqmiur ssiqmiru ssiqmriu ssiqmrui ssimruqi ssimruiq ssimrqui
ssimrqiu ssimriqu ssimriuq ssimurqi ssimuriq ssimuqri ssimuqir ssimuiqr ssimuirq ssimquri ssimquir
ssimqrui ssimqriu ssimqiru ssimqiur ssimiuqr ssimiurq ssimiqur ssimiqru ssimirqu ssimiruq ssqirium
ssqirimu ssqiruim ssqirumi ssqirmui ssqirmiu ssqiirum ssqiirmu ssqiiurm ssqiiumr ssqiimur ssqiimru
ssqiuirm ssqiuimr ssqiurim ssqiurmi ssqiumri ssqiumir ssqimiur ssqimiru ssqimuir ssqimuri ssqimrui
ssqimriu ssqriium ssqriimu ssqriuim ssqriumi ssqrimui ssqrimiu ssqriium ssqriimu ssqriuim ssqriumi
ssqrimui ssqrimiu ssqruiim ssqruimi ssqruiim ssqruimi ssqrumii ssqrumii ssqrmiui ssqrmiiu ssqrmuii
ssqrmuii ssqrmiui ssqrmiiu ssqirium ssqirimu ssqiruim ssqirumi ssqirmui ssqirmiu ssqiirum ssqiirmu
ssqiiurm ssqiiumr ssqiimur ssqiimru ssqiuirm ssqiuimr ssqiurim ssqiurmi ssqiumri ssqiumir ssqimiur
ssqimiru ssqimuir ssqimuri ssqimrui ssqimriu ssquriim ssqurimi ssquriim ssqurimi ssqurmii ssqurmii
ssquirim ssquirmi ssquiirm ssquiimr ssquimir ssquimri ssquiirm ssquiimr ssquirim ssquirmi ssquimri
ssquimir ssqumiir ssqumiri ssqumiir ssqumiri ssqumrii ssqumrii ssqmriui ssqmriiu ssqmruii ssqmruii
ssqmriui ssqmriiu ssqmirui ssqmiriu ssqmiuri ssqmiuir ssqmiiur ssqmiiru ssqmuiri ssqmuiir ssqmurii
ssqmurii ssqmuiri ssqmuiir ssqmiiur ssqmiiru ssqmiuir ssqmiuri ssqmirui ssqmiriu ssmiriqu ssmiriuq
ssmirqiu ssmirqui ssmiruqi ssmiruiq ssmiirqu ssmiiruq ssmiiqru ssmiiqur ssmiiuqr ssmiiurq ssmiqiru
ssmiqiur ssmiqriu ssmiqrui ssmiquri ssmiquir ssmiuiqr ssmiuirq ssmiuqir ssmiuqri ssmiurqi ssmiuriq
ssmriiqu ssmriiuq ssmriqiu ssmriqui ssmriuqi ssmriuiq ssmriiqu ssmriiuq ssmriqiu ssmriqui ssmriuqi
ssmriuiq ssmrqiiu ssmrqiui ssmrqiiu ssmrqiui ssmrquii ssmrquii ssmruiqi ssmruiiq ssmruqii ssmruqii
ssmruiqi ssmruiiq ssmiriqu ssmiriuq ssmirqiu ssmirqui ssmiruqi ssmiruiq ssmiirqu ssmiiruq ssmiiqru
ssmiiqur ssmiiuqr ssmiiurq ssmiqiru ssmiqiur ssmiqriu ssmiqrui ssmiquri ssmiquir ssmiuiqr ssmiuirq
ssmiuqir ssmiuqri ssmiurqi ssmiuriq ssmqriiu ssmqriui ssmqriiu ssmqriui ssmqruii ssmqruii ssmqiriu
ssmqirui ssmqiiru ssmqiiur ssmqiuir ssmqiuri ssmqiiru ssmqiiur ssmqiriu ssmqirui ssmqiuri ssmqiuir
ssmquiir ssmquiri ssmquiir ssmquiri ssmqurii ssmqurii ssmuriqi ssmuriiq ssmurqii ssmurqii ssmuriqi
ssmuriiq ssmuirqi ssmuiriq ssmuiqri ssmuiqir ssmuiiqr ssmuiirq ssmuqiri ssmuqiir ssmuqrii ssmuqrii
ssmuqiri ssmuqiir ssmuiiqr ssmuiirq ssmuiqir ssmuiqri ssmuirqi ssmuiriq smuirisq smuiriqs smuirsiq
smuirsqi smuirqsi smuirqis smuiirsq smuiirqs smuiisrq smuiisqr smuiiqsr smuiiqrs smuisirq smuisiqr
smuisriq smuisrqi smuisqri smuisqir smuiqisr smuiqirs smuiqsir smuiqsri smuiqrsi smuiqris smuriisq
smuriiqs smurisiq smurisqi smuriqsi smuriqis smuriisq smuriiqs smurisiq smurisqi smuriqsi smuriqis
smursiiq smursiqi smursiiq smursiqi smursqii smursqii smurqisi smurqiis smurqsii smurqsii smurqisi
smurqiis smuirisq smuiriqs smuirsiq smuirsqi smuirqsi smuirqis smuiirsq smuiirqs smuiisrq smuiisqr
smuiiqsr smuiiqrs smuisirq smuisiqr smuisriq smuisrqi smuisqri smuisqir smuiqisr smuiqirs smuiqsir
smuiqsri smuiqrsi smuiqris smusriiq smusriqi smusriiq smusriqi smusrqii smusrqii smusiriq smusirqi
smusiirq smusiiqr smusiqir smusiqri smusiirq smusiiqr smusiriq smusirqi smusiqri smusiqir smusqiir
smusqiri smusqiir smusqiri smusqrii smusqrii smuqrisi smuqriis smuqrsii smuqrsii smuqrisi smuqriis
smuqirsi smuqiris smuqisri smuqisir smuqiisr smuqiirs smuqsiri smuqsiir smuqsrii smuqsrii smuqsiri
smuqsiir smuqiisr smuqiirs smuqisir smuqisri smuqirsi smuqiris smiurisq smiuriqs smiursiq smiursqi
smiurqsi smiurqis smiuirsq smiuirqs smiuisrq smiuisqr smiuiqsr smiuiqrs smiusirq smiusiqr smiusriq
smiusrqi smiusqri smiusqir smiuqisr smiuqirs smiuqsir smiuqsri smiuqrsi smiuqris smiruisq smiruiqs
smirusiq smirusqi smiruqsi smiruqis smiriusq smiriuqs smirisuq smirisqu smiriqsu smiriqus smirsiuq
smirsiqu smirsuiq smirsuqi smirsqui smirsqiu smirqisu smirqius smirqsiu smirqsui smirqusi smirquis
smiirusq smiiruqs smiirsuq smiirsqu smiirqsu smiirqus smiiursq smiiurqs smiiusrq smiiusqr smiiuqsr
smiiuqrs smiisurq smiisuqr smiisruq smiisrqu smiisqru smiisqur smiiqusr smiiqurs smiiqsur smiiqsru
smiiqrsu smiiqrus smisriuq smisriqu smisruiq smisruqi smisrqui smisrqiu smisiruq smisirqu smisiurq
smisiuqr smisiqur smisiqru smisuirq smisuiqr smisuriq smisurqi smisuqri smisuqir smisqiur smisqiru
smisquir smisquri smisqrui smisqriu smiqrisu smiqrius smiqrsiu smiqrsui smiqrusi smiqruis smiqirsu
smiqirus smiqisru smiqisur smiqiusr smiqiurs smiqsiru smiqsiur smiqsriu smiqsrui smiqsuri smiqsuir
smiquisr smiquirs smiqusir smiqusri smiqursi smiquris smriuisq smriuiqs smriusiq smriusqi smriuqsi
smriuqis smriiusq smriiuqs smriisuq smriisqu smriiqsu smriiqus smrisiuq smrisiqu smrisuiq smrisuqi
smrisqui smrisqiu smriqisu smriqius smriqsiu smriqsui smriqusi smriquis smruiisq smruiiqs smruisiq
smruisqi smruiqsi smruiqis smruiisq smruiiqs smruisiq smruisqi smruiqsi smruiqis smrusiiq smrusiqi
smrusiiq smrusiqi smrusqii smrusqii smruqisi smruqiis smruqsii smruqsii smruqisi smruqiis smriuisq
smriuiqs smriusiq smriusqi smriuqsi smriuqis smriiusq smriiuqs smriisuq smriisqu smriiqsu smriiqus
smrisiuq smrisiqu smrisuiq smrisuqi smrisqui smrisqiu smriqisu smriqius smriqsiu smriqsui smriqusi
smriquis smrsuiiq smrsuiqi smrsuiiq smrsuiqi smrsuqii smrsuqii smrsiuiq smrsiuqi smrsiiuq smrsiiqu
smrsiqiu smrsiqui smrsiiuq smrsiiqu smrsiuiq smrsiuqi smrsiqui smrsiqiu smrsqiiu smrsqiui smrsqiiu
smrsqiui smrsquii smrsquii smrquisi smrquiis smrqusii smrqusii smrquisi smrquiis smrqiusi smrqiuis
smrqisui smrqisiu smrqiisu smrqiius smrqsiui smrqsiiu smrqsuii smrqsuii smrqsiui smrqsiiu smrqiisu
smrqiius smrqisiu smrqisui smrqiusi smrqiuis smiirusq smiiruqs smiirsuq smiirsqu smiirqsu smiirqus
smiiursq smiiurqs smiiusrq smiiusqr smiiuqsr smiiuqrs smiisurq smiisuqr smiisruq smiisrqu smiisqru
smiisqur smiiqusr smiiqurs smiiqsur smiiqsru smiiqrsu smiiqrus smiriusq smiriuqs smirisuq smirisqu
smiriqsu smiriqus smiruisq smiruiqs smirusiq smirusqi smiruqsi smiruqis smirsuiq smirsuqi smirsiuq
smirsiqu smirsqiu smirsqui smirqusi smirquis smirqsui smirqsiu smirqisu smirqius smiurisq smiuriqs
smiursiq smiursqi smiurqsi smiurqis smiuirsq smiuirqs smiuisrq smiuisqr smiuiqsr smiuiqrs smiusirq
smiusiqr smiusriq smiusrqi smiusqri smiusqir smiuqisr smiuqirs smiuqsir smiuqsri smiuqrsi smiuqris
smisruiq smisruqi smisriuq smisriqu smisrqiu smisrqui smisuriq smisurqi smisuirq smisuiqr smisuqir
smisuqri smisiurq smisiuqr smisiruq smisirqu smisiqru smisiqur smisquir smisquri smisqiur smisqiru
smisqriu smisqrui smiqrusi smiqruis smiqrsui smiqrsiu smiqrisu smiqrius smiqursi smiquris smiqusri
smiqusir smiquisr smiquirs smiqsuri smiqsuir smiqsrui smiqsriu smiqsiru smiqsiur smiqiusr smiqiurs
smiqisur smiqisru smiqirsu smiqirus smsiriuq smsiriqu smsiruiq smsiruqi smsirqui smsirqiu smsiiruq
smsiirqu smsiiurq smsiiuqr smsiiqur smsiiqru smsiuirq smsiuiqr smsiuriq smsiurqi smsiuqri smsiuqir
smsiqiur smsiqiru smsiquir smsiquri smsiqrui smsiqriu smsriiuq smsriiqu smsriuiq smsriuqi smsriqui
smsriqiu smsriiuq smsriiqu smsriuiq smsriuqi smsriqui smsriqiu smsruiiq smsruiqi smsruiiq smsruiqi
smsruqii smsruqii smsrqiui smsrqiiu smsrquii smsrquii smsrqiui smsrqiiu smsiriuq smsiriqu smsiruiq
smsiruqi smsirqui smsirqiu smsiiruq smsiirqu smsiiurq smsiiuqr smsiiqur smsiiqru smsiuirq smsiuiqr
smsiuriq smsiurqi smsiuqri smsiuqir smsiqiur smsiqiru smsiquir smsiquri smsiqrui smsiqriu smsuriiq
smsuriqi smsuriiq smsuriqi smsurqii smsurqii smsuiriq smsuirqi smsuiirq smsuiiqr smsuiqir smsuiqri
smsuiirq smsuiiqr smsuiriq smsuirqi smsuiqri smsuiqir smsuqiir smsuqiri smsuqiir smsuqiri smsuqrii
smsuqrii smsqriui smsqriiu smsqruii smsqruii smsqriui smsqriiu smsqirui smsqiriu smsqiuri smsqiuir
smsqiiur smsqiiru smsquiri smsquiir smsqurii smsqurii smsquiri smsquiir smsqiiur smsqiiru smsqiuir
smsqiuri smsqirui smsqiriu smqirisu smqirius smqirsiu smqirsui smqirusi smqiruis smqiirsu smqiirus
smqiisru smqiisur smqiiusr smqiiurs smqisiru smqisiur smqisriu smqisrui smqisuri smqisuir smqiuisr
smqiuirs smqiusir smqiusri smqiursi smqiuris smqriisu smqriius smqrisiu smqrisui smqriusi smqriuis
smqriisu smqriius smqrisiu smqrisui smqriusi smqriuis smqrsiiu smqrsiui smqrsiiu smqrsiui smqrsuii
smqrsuii smqruisi smqruiis smqrusii smqrusii smqruisi smqruiis smqirisu smqirius smqirsiu smqirsui
smqirusi smqiruis smqiirsu smqiirus smqiisru smqiisur smqiiusr smqiiurs smqisiru smqisiur smqisriu
smqisrui smqisuri smqisuir smqiuisr smqiuirs smqiusir smqiusri smqiursi smqiuris smqsriiu smqsriui
smqsriiu smqsriui smqsruii smqsruii smqsiriu smqsirui smqsiiru smqsiiur smqsiuir smqsiuri smqsiiru
smqsiiur smqsiriu smqsirui smqsiuri smqsiuir smqsuiir smqsuiri smqsuiir smqsuiri smqsurii smqsurii
smqurisi smquriis smqursii smqursii smqurisi smquriis smquirsi smquiris smquisri smquisir smquiisr
smquiirs smqusiri smqusiir smqusrii smqusrii smqusiri smqusiir smquiisr smquiirs smquisir smquisri
smquirsi smquiris

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us