easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

actualizes

effoderemusque

uersabamque

eshbach

ulrichs

terricoline

jeanlouis

gaoith

exaltest

unawared

zephyrous

semibald

protoplast

servireque

odelet

proferebamini

weighters

probrick


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: spiriti
cipher variations:
tqjsjuj urktkvk vslulwl wtmvmxm xunwnyn
yvoxozo zwpypap axqzqbq byrarcr czsbsds
datctet ebudufu fcvevgv gdwfwhw hexgxix
ifyhyjy jgzizkz khajala libkbmb mjclcnc
nkdmdod olenepe pmfofqf qngpgrg rohqhsh

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: spiriti
Cipher: hkrirgr

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: spiriti
Cipher: BAAAB ABBBA ABAAA BAAAA ABAAA BAABA ABAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: spiriti
cipher variations:
tqjsjujduzazgznypipspxcfqfefhgvyvqvrklglcllsrwrarvwhehmh
faxmxyxpenunknzidcdwdjmtktiturktkvkevabahaozqjqtqydgrgfg
ihwzwrwslmhmdmmtsxsbswxifinigbynyzyqfovoloajedexeknuluju
vslulwlfwbcbibparkrurzehshghjixaxsxtmninennutytctxyjgjoj
hczozazrgpwpmpbkfefyflovmvkvwtmvmxmgxcdcjcqbslsvsafitihi
kjybytyunojofoovuzuduyzkhkpkidapabashqxqnqclgfgzgmpwnwlw
xunwnynhydedkdrctmtwtbgjujijlkzczuzvopkpgppwvavevzalilql
jebqbcbtiryrordmhghahnqxoxmxyvoxozoizefelesdunuxuchkvkjk
mladavawpqlqhqqxwbwfwabmjmrmkfcrcdcujszspsenihibiorypyny
zwpypapjafgfmftevovyvdilwlklnmbebwbxqrmrirryxcxgxbcnknsn
lgdsdedvktatqtfojijcjpszqzozaxqzqbqkbghgngufwpwzwejmxmlm
oncfcxcyrsnsjsszydyhycdolotomhetefewluburugpkjkdkqtarapa
byrarcrlchihohvgxqxaxfknynmnpodgdydzstotkttazezizdepmpup
nifufgfxmvcvsvhqlklelrubsbqbczsbsdsmdijipiwhyrybyglozono
qpehezeatupuluubafajaefqnqvqojgvghgynwdwtwirmlmfmsvctcrc
datctetnejkjqjxizszczhmpapoprqfifafbuvqvmvvcbgbkbfgrorwr
pkhwhihzoxexuxjsnmngntwdudsdebudufuofklkrkyjatadainqbqpq
srgjgbgcvwrwnwwdchclcghspsxsqlixijiapyfyvyktonohouxevete
fcvevgvpglmlslzkbubebjorcrqrtshkhchdwxsxoxxedidmdhitqtyt
rmjyjkjbqzgzwzlupopipvyfwfufgdwfwhwqhmnmtmalcvcfckpsdsrs
utilidiexytypyyfejeneijuruzusnkzklkcrahaxamvqpqjqwzgxgvg
hexgxixrinonunbmdwdgdlqtetstvujmjejfyzuzqzzgfkfofjkvsvav
tolalmldsbibybnwrqrkrxahyhwhifyhyjysjopovocnexehemrufutu
wvknkfkgzavaraahglgpgklwtwbwupmbmnmetcjczcoxsrslsybizixi
jgzizkztkpqpwpdofyfifnsvgvuvxwlolglhabwbsbbihmhqhlmxuxcx
vqncnonfudkdadpytstmtzcjajyjkhajalaulqrqxqepgzgjgotwhwvw
yxmpmhmibcxctccjinirimnyvydywrodopogvelebeqzutunuadkbkzk
libkbmbvmrsryrfqhahkhpuxixwxzynqninjcdyduddkjojsjnozwzez
xspepqphwfmfcfravuvovbelclalmjclcncwnstszsgribiliqvyjyxy
azorojokdezeveelkpktkopaxafaytqfqrqixgngdgsbwvwpwcfmdmbm
nkdmdodxotutathsjcjmjrwzkzyzbapspkplefafwffmlqlulpqbybgb
zurgrsrjyhohehtcxwxqxdgnencnolenepeypuvubuitkdknksxalaza
cbqtqlqmfgbgxggnmrmvmqrczchcavshstskzipifiudyxyryehofodo
pmfofqfzqvwvcvjuleloltybmbabdcrurmrnghchyhhonsnwnrsdadid
bwtitutlajqjgjvezyzszfipgpepqngpgrgarwxwdwkvmfmpmuzcncbc
edsvsnsohidiziipotoxostebejecxujuvumbkrkhkwfazatagjqhqfq
rohqhshbsxyxexlwngnqnvadodcdfetwtotpijejajjqpupyptufcfkf
dyvkvwvnclslilxgbabubhkrirgrspiritictyzyfymxohorowbepede
gfuxupuqjkfkbkkrqvqzquvgdglgezwlwxwodmtmjmyhcbcvcilsjshs

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: spiriti
Cipher: fcvevgv

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: spiriti
Cipher: 34534224424442

Extended Methods:
Method #1

Plaintext: spiriti
method variations:
xuowoyocztbtdtheygyiynkdmdod

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s p i r i t i 
3 5 4 2 4 4 4 
4 3 2 4 2 4 2 
They are then read out in rows:
35424444324242
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: spiriti
Cipher: xitthii

Read more ...
Method #3

Plaintext: spiriti
method variations:
ysgtrtm sgtrtmy gtrtmys
trtmysg rtmysgt tmysgtr
mysgtrt

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: spiriti

all 5040 cipher variations:
spiriti spiriit spirtii spirtii spiriti spiriit spiirti spiirit spiitri spiitir spiiitr
spiiirt spitiri spitiir spitrii spitrii spitiri spitiir spiiitr spiiirt spiitir spiitri
spiirti spiirit spriiti spriiit spritii spritii spriiti spriiit spriiti spriiit spritii
spritii spriiti spriiit sprtiii sprtiii sprtiii sprtiii sprtiii sprtiii spriiti spriiit
spritii spritii spriiti spriiit spiriti spiriit spirtii spirtii spiriti spiriit spiirti
spiirit spiitri spiitir spiiitr spiiirt spitiri spitiir spitrii spitrii spitiri spitiir
spiiitr spiiirt spiitir spiitri spiirti spiirit sptriii sptriii sptriii sptriii sptriii
sptriii sptirii sptirii sptiiri sptiiir sptiiir sptiiri sptiiri sptiiir sptirii sptirii
sptiiri sptiiir sptiiir sptiiri sptiiir sptiiri sptirii sptirii spiriti spiriit spirtii
spirtii spiriti spiriit spiirti spiirit spiitri spiitir spiiitr spiiirt spitiri spitiir
spitrii spitrii spitiri spitiir spiiitr spiiirt spiitir spiitri spiirti spiirit sipriti
sipriit siprtii siprtii sipriti sipriit sipirti sipirit sipitri sipitir sipiitr sipiirt
siptiri siptiir siptrii siptrii siptiri siptiir sipiitr sipiirt sipitir sipitri sipirti
sipirit sirpiti sirpiit sirptii sirptii sirpiti sirpiit siripti siripit siritpi siritip
siriitp siriipt sirtipi sirtiip sirtpii sirtpii sirtipi sirtiip siriitp siriipt siritip
siritpi siripti siripit siirpti siirpit siirtpi siirtip siiritp siiript siiprti siiprit
siiptri siiptir siipitr siipirt siitpri siitpir siitrpi siitrip siitirp siitipr siiiptr
siiiprt siiitpr siiitrp siiirtp siiirpt sitripi sitriip sitrpii sitrpii sitripi sitriip
sitirpi sitirip sitipri sitipir sitiipr sitiirp sitpiri sitpiir sitprii sitprii sitpiri
sitpiir sitiipr sitiirp sitipir sitipri sitirpi sitirip siiritp siiript siirtip siirtpi
siirpti siirpit siiirtp siiirpt siiitrp siiitpr siiiptr siiiprt siitirp siitipr siitrip
siitrpi siitpri siitpir siipitr siipirt siiptir siiptri siiprti siiprit sripiti sripiit
sriptii sriptii sripiti sripiit sriipti sriipit sriitpi sriitip sriiitp sriiipt sritipi
sritiip sritpii sritpii sritipi sritiip sriiitp sriiipt sriitip sriitpi sriipti sriipit
srpiiti srpiiit srpitii srpitii srpiiti srpiiit srpiiti srpiiit srpitii srpitii srpiiti
srpiiit srptiii srptiii srptiii srptiii srptiii srptiii srpiiti srpiiit srpitii srpitii
srpiiti srpiiit sripiti sripiit sriptii sriptii sripiti sripiit sriipti sriipit sriitpi
sriitip sriiitp sriiipt sritipi sritiip sritpii sritpii sritipi sritiip sriiitp sriiipt
sriitip sriitpi sriipti sriipit srtpiii srtpiii srtpiii srtpiii srtpiii srtpiii srtipii
srtipii srtiipi srtiiip srtiiip srtiipi srtiipi srtiiip srtipii srtipii srtiipi srtiiip
srtiiip srtiipi srtiiip srtiipi srtipii srtipii sripiti sripiit sriptii sriptii sripiti
sripiit sriipti sriipit sriitpi sriitip sriiitp sriiipt sritipi sritiip sritpii sritpii
sritipi sritiip sriiitp sriiipt sriitip sriitpi sriipti sriipit siirpti siirpit siirtpi
siirtip siiritp siiript siiprti siiprit siiptri siiptir siipitr siipirt siitpri siitpir
siitrpi siitrip siitirp siitipr siiiptr siiiprt siiitpr siiitrp siiirtp siiirpt siripti
siripit siritpi siritip siriitp siriipt sirpiti sirpiit sirptii sirptii sirpiti sirpiit
sirtpii sirtpii sirtipi sirtiip sirtiip sirtipi siripti siripit siritpi siritip siriitp
siriipt sipriti sipriit siprtii siprtii sipriti sipriit sipirti sipirit sipitri sipitir
sipiitr sipiirt siptiri siptiir siptrii siptrii siptiri siptiir sipiitr sipiirt sipitir
sipitri sipirti sipirit sitrpii sitrpii sitripi sitriip sitriip sitripi sitprii sitprii
sitpiri sitpiir sitpiir sitpiri sitipri sitipir sitirpi sitirip sitiirp sitiipr sitipir
sitipri sitiipr sitiirp sitirip sitirpi siirpti siirpit siirtpi siirtip siiritp siiript
siiprti siiprit siiptri siiptir siipitr siipirt siitpri siitpir siitrpi siitrip siitirp
siitipr siiiptr siiiprt siiitpr siiitrp siiirtp siiirpt stiripi stiriip stirpii stirpii
stiripi stiriip stiirpi stiirip stiipri stiipir stiiipr stiiirp stipiri stipiir stiprii
stiprii stipiri stipiir stiiipr stiiirp stiipir stiipri stiirpi stiirip striipi striiip
stripii stripii striipi striiip striipi striiip stripii stripii striipi striiip strpiii
strpiii strpiii strpiii strpiii strpiii striipi striiip stripii stripii striipi striiip
stiripi stiriip stirpii stirpii stiripi stiriip stiirpi stiirip stiipri stiipir stiiipr
stiiirp stipiri stipiir stiprii stiprii stipiri stipiir stiiipr stiiirp stiipir stiipri
stiirpi stiirip stpriii stpriii stpriii stpriii stpriii stpriii stpirii stpirii stpiiri
stpiiir stpiiir stpiiri stpiiri stpiiir stpirii stpirii stpiiri stpiiir stpiiir stpiiri
stpiiir stpiiri stpirii stpirii stiripi stiriip stirpii stirpii stiripi stiriip stiirpi
stiirip stiipri stiipir stiiipr stiiirp stipiri stipiir stiprii stiprii stipiri stipiir
stiiipr stiiirp stiipir stiipri stiirpi stiirip siiritp siiript siirtip siirtpi siirpti
siirpit siiirtp siiirpt siiitrp siiitpr siiiptr siiiprt siitirp siitipr siitrip siitrpi
siitpri siitpir siipitr siipirt siiptir siiptri siiprti siiprit siriitp siriipt siritip
siritpi siripti siripit siriitp siriipt siritip siritpi siripti siripit sirtiip sirtipi
sirtiip sirtipi sirtpii sirtpii sirpiti sirpiit sirptii sirptii sirpiti sirpiit siiritp
siiript siirtip siirtpi siirpti siirpit siiirtp siiirpt siiitrp siiitpr siiiptr siiiprt
siitirp siitipr siitrip siitrpi siitpri siitpir siipitr siipirt siiptir siiptri siiprti
siiprit sitriip sitripi sitriip sitripi sitrpii sitrpii sitirip sitirpi sitiirp sitiipr
sitipir sitipri sitiirp sitiipr sitirip sitirpi sitipri sitipir sitpiir sitpiri sitpiir
sitpiri sitprii sitprii sipriti sipriit siprtii siprtii sipriti sipriit sipirti sipirit
sipitri sipitir sipiitr sipiirt siptiri siptiir siptrii siptrii siptiri siptiir sipiitr
sipiirt sipitir sipitri sipirti sipirit psiriti psiriit psirtii psirtii psiriti psiriit
psiirti psiirit psiitri psiitir psiiitr psiiirt psitiri psitiir psitrii psitrii psitiri
psitiir psiiitr psiiirt psiitir psiitri psiirti psiirit psriiti psriiit psritii psritii
psriiti psriiit psriiti psriiit psritii psritii psriiti psriiit psrtiii psrtiii psrtiii
psrtiii psrtiii psrtiii psriiti psriiit psritii psritii psriiti psriiit psiriti psiriit
psirtii psirtii psiriti psiriit psiirti psiirit psiitri psiitir psiiitr psiiirt psitiri
psitiir psitrii psitrii psitiri psitiir psiiitr psiiirt psiitir psiitri psiirti psiirit
pstriii pstriii pstriii pstriii pstriii pstriii pstirii pstirii pstiiri pstiiir pstiiir
pstiiri pstiiri pstiiir pstirii pstirii pstiiri pstiiir pstiiir pstiiri pstiiir pstiiri
pstirii pstirii psiriti psiriit psirtii psirtii psiriti psiriit psiirti psiirit psiitri
psiitir psiiitr psiiirt psitiri psitiir psitrii psitrii psitiri psitiir psiiitr psiiirt
psiitir psiitri psiirti psiirit pisriti pisriit pisrtii pisrtii pisriti pisriit pisirti
pisirit pisitri pisitir pisiitr pisiirt pistiri pistiir pistrii pistrii pistiri pistiir
pisiitr pisiirt pisitir pisitri pisirti pisirit pirsiti pirsiit pirstii pirstii pirsiti
pirsiit piristi pirisit piritsi piritis piriits piriist pirtisi pirtiis pirtsii pirtsii
pirtisi pirtiis piriits piriist piritis piritsi piristi pirisit piirsti piirsit piirtsi
piirtis piirits piirist piisrti piisrit piistri piistir piisitr piisirt piitsri piitsir
piitrsi piitris piitirs piitisr piiistr piiisrt piiitsr piiitrs piiirts piiirst pitrisi
pitriis pitrsii pitrsii pitrisi pitriis pitirsi pitiris pitisri pitisir pitiisr pitiirs
pitsiri pitsiir pitsrii pitsrii pitsiri pitsiir pitiisr pitiirs pitisir pitisri pitirsi
pitiris piirits piirist piirtis piirtsi piirsti piirsit piiirts piiirst piiitrs piiitsr
piiistr piiisrt piitirs piitisr piitris piitrsi piitsri piitsir piisitr piisirt piistir
piistri piisrti piisrit prisiti prisiit pristii pristii prisiti prisiit priisti priisit
priitsi priitis priiits priiist pritisi pritiis pritsii pritsii pritisi pritiis priiits
priiist priitis priitsi priisti priisit prsiiti prsiiit prsitii prsitii prsiiti prsiiit
prsiiti prsiiit prsitii prsitii prsiiti prsiiit prstiii prstiii prstiii prstiii prstiii
prstiii prsiiti prsiiit prsitii prsitii prsiiti prsiiit prisiti prisiit pristii pristii
prisiti prisiit priisti priisit priitsi priitis priiits priiist pritisi pritiis pritsii
pritsii pritisi pritiis priiits priiist priitis priitsi priisti priisit prtsiii prtsiii
prtsiii prtsiii prtsiii prtsiii prtisii prtisii prtiisi prtiiis prtiiis prtiisi prtiisi
prtiiis prtisii prtisii prtiisi prtiiis prtiiis prtiisi prtiiis prtiisi prtisii prtisii
prisiti prisiit pristii pristii prisiti prisiit priisti priisit priitsi priitis priiits
priiist pritisi pritiis pritsii pritsii pritisi pritiis priiits priiist priitis priitsi
priisti priisit piirsti piirsit piirtsi piirtis piirits piirist piisrti piisrit piistri
piistir piisitr piisirt piitsri piitsir piitrsi piitris piitirs piitisr piiistr piiisrt
piiitsr piiitrs piiirts piiirst piristi pirisit piritsi piritis piriits piriist pirsiti
pirsiit pirstii pirstii pirsiti pirsiit pirtsii pirtsii pirtisi pirtiis pirtiis pirtisi
piristi pirisit piritsi piritis piriits piriist pisriti pisriit pisrtii pisrtii pisriti
pisriit pisirti pisirit pisitri pisitir pisiitr pisiirt pistiri pistiir pistrii pistrii
pistiri pistiir pisiitr pisiirt pisitir pisitri pisirti pisirit pitrsii pitrsii pitrisi
pitriis pitriis pitrisi pitsrii pitsrii pitsiri pitsiir pitsiir pitsiri pitisri pitisir
pitirsi pitiris pitiirs pitiisr pitisir pitisri pitiisr pitiirs pitiris pitirsi piirsti
piirsit piirtsi piirtis piirits piirist piisrti piisrit piistri piistir piisitr piisirt
piitsri piitsir piitrsi piitris piitirs piitisr piiistr piiisrt piiitsr piiitrs piiirts
piiirst ptirisi ptiriis ptirsii ptirsii ptirisi ptiriis ptiirsi ptiiris ptiisri ptiisir
ptiiisr ptiiirs ptisiri ptisiir ptisrii ptisrii ptisiri ptisiir ptiiisr ptiiirs ptiisir
ptiisri ptiirsi ptiiris ptriisi ptriiis ptrisii ptrisii ptriisi ptriiis ptriisi ptriiis
ptrisii ptrisii ptriisi ptriiis ptrsiii ptrsiii ptrsiii ptrsiii ptrsiii ptrsiii ptriisi
ptriiis ptrisii ptrisii ptriisi ptriiis ptirisi ptiriis ptirsii ptirsii ptirisi ptiriis
ptiirsi ptiiris ptiisri ptiisir ptiiisr ptiiirs ptisiri ptisiir ptisrii ptisrii ptisiri
ptisiir ptiiisr ptiiirs ptiisir ptiisri ptiirsi ptiiris ptsriii ptsriii ptsriii ptsriii
ptsriii ptsriii ptsirii ptsirii ptsiiri ptsiiir ptsiiir ptsiiri ptsiiri ptsiiir ptsirii
ptsirii ptsiiri ptsiiir ptsiiir ptsiiri ptsiiir ptsiiri ptsirii ptsirii ptirisi ptiriis
ptirsii ptirsii ptirisi ptiriis ptiirsi ptiiris ptiisri ptiisir ptiiisr ptiiirs ptisiri
ptisiir ptisrii ptisrii ptisiri ptisiir ptiiisr ptiiirs ptiisir ptiisri ptiirsi ptiiris
piirits piirist piirtis piirtsi piirsti piirsit piiirts piiirst piiitrs piiitsr piiistr
piiisrt piitirs piitisr piitris piitrsi piitsri piitsir piisitr piisirt piistir piistri
piisrti piisrit piriits piriist piritis piritsi piristi pirisit piriits piriist piritis
piritsi piristi pirisit pirtiis pirtisi pirtiis pirtisi pirtsii pirtsii pirsiti pirsiit
pirstii pirstii pirsiti pirsiit piirits piirist piirtis piirtsi piirsti piirsit piiirts
piiirst piiitrs piiitsr piiistr piiisrt piitirs piitisr piitris piitrsi piitsri piitsir
piisitr piisirt piistir piistri piisrti piisrit pitriis pitrisi pitriis pitrisi pitrsii
pitrsii pitiris pitirsi pitiirs pitiisr pitisir pitisri pitiirs pitiisr pitiris pitirsi
pitisri pitisir pitsiir pitsiri pitsiir pitsiri pitsrii pitsrii pisriti pisriit pisrtii
pisrtii pisriti pisriit pisirti pisirit pisitri pisitir pisiitr pisiirt pistiri pistiir
pistrii pistrii pistiri pistiir pisiitr pisiirt pisitir pisitri pisirti pisirit ipsriti
ipsriit ipsrtii ipsrtii ipsriti ipsriit ipsirti ipsirit ipsitri ipsitir ipsiitr ipsiirt
ipstiri ipstiir ipstrii ipstrii ipstiri ipstiir ipsiitr ipsiirt ipsitir ipsitri ipsirti
ipsirit iprsiti iprsiit iprstii iprstii iprsiti iprsiit ipristi iprisit ipritsi ipritis
ipriits ipriist iprtisi iprtiis iprtsii iprtsii iprtisi iprtiis ipriits ipriist ipritis
ipritsi ipristi iprisit ipirsti ipirsit ipirtsi ipirtis ipirits ipirist ipisrti ipisrit
ipistri ipistir ipisitr ipisirt ipitsri ipitsir ipitrsi ipitris ipitirs ipitisr ipiistr
ipiisrt ipiitsr ipiitrs ipiirts ipiirst iptrisi iptriis iptrsii iptrsii iptrisi iptriis
iptirsi iptiris iptisri iptisir iptiisr iptiirs iptsiri iptsiir iptsrii iptsrii iptsiri
iptsiir iptiisr iptiirs iptisir iptisri iptirsi iptiris ipirits ipirist ipirtis ipirtsi
ipirsti ipirsit ipiirts ipiirst ipiitrs ipiitsr ipiistr ipiisrt ipitirs ipitisr ipitris
ipitrsi ipitsri ipitsir ipisitr ipisirt ipistir ipistri ipisrti ipisrit ispriti ispriit
isprtii isprtii ispriti ispriit ispirti ispirit ispitri ispitir ispiitr ispiirt isptiri
isptiir isptrii isptrii isptiri isptiir ispiitr ispiirt ispitir ispitri ispirti ispirit
isrpiti isrpiit isrptii isrptii isrpiti isrpiit isripti isripit isritpi isritip isriitp
isriipt isrtipi isrtiip isrtpii isrtpii isrtipi isrtiip isriitp isriipt isritip isritpi
isripti isripit isirpti isirpit isirtpi isirtip isiritp isiript isiprti isiprit isiptri
isiptir isipitr isipirt isitpri isitpir isitrpi isitrip isitirp isitipr isiiptr isiiprt
isiitpr isiitrp isiirtp isiirpt istripi istriip istrpii istrpii istripi istriip istirpi
istirip istipri istipir istiipr istiirp istpiri istpiir istprii istprii istpiri istpiir
istiipr istiirp istipir istipri istirpi istirip isiritp isiript isirtip isirtpi isirpti
isirpit isiirtp isiirpt isiitrp isiitpr isiiptr isiiprt isitirp isitipr isitrip isitrpi
isitpri isitpir isipitr isipirt isiptir isiptri isiprti isiprit irspiti irspiit irsptii
irsptii irspiti irspiit irsipti irsipit irsitpi irsitip irsiitp irsiipt irstipi irstiip
irstpii irstpii irstipi irstiip irsiitp irsiipt irsitip irsitpi irsipti irsipit irpsiti
irpsiit irpstii irpstii irpsiti irpsiit irpisti irpisit irpitsi irpitis irpiits irpiist
irptisi irptiis irptsii irptsii irptisi irptiis irpiits irpiist irpitis irpitsi irpisti
irpisit iripsti iripsit iriptsi iriptis iripits iripist irispti irispit iristpi iristip
irisitp irisipt iritspi iritsip iritpsi iritpis iritips iritisp iriistp iriispt iriitsp
iriitps iriipts iriipst irtpisi irtpiis irtpsii irtpsii irtpisi irtpiis irtipsi irtipis
irtispi irtisip irtiisp irtiips irtsipi irtsiip irtspii irtspii irtsipi irtsiip irtiisp
irtiips irtisip irtispi irtipsi irtipis iripits iripist iriptis iriptsi iripsti iripsit
iriipts iriipst iriitps iriitsp iriistp iriispt iritips iritisp iritpis iritpsi iritspi
iritsip irisitp irisipt iristip iristpi irispti irispit iisrpti iisrpit iisrtpi iisrtip
iisritp iisript iisprti iisprit iisptri iisptir iispitr iispirt iistpri iistpir iistrpi
iistrip iistirp iistipr iisiptr iisiprt iisitpr iisitrp iisirtp iisirpt iirspti iirspit
iirstpi iirstip iirsitp iirsipt iirpsti iirpsit iirptsi iirptis iirpits iirpist iirtpsi
iirtpis iirtspi iirtsip iirtisp iirtips iiripts iiripst iiritps iiritsp iiristp iirispt
iiprsti iiprsit iiprtsi iiprtis iiprits iiprist iipsrti iipsrit iipstri iipstir iipsitr
iipsirt iiptsri iiptsir iiptrsi iiptris iiptirs iiptisr iipistr iipisrt iipitsr iipitrs
iipirts iipirst iitrpsi iitrpis iitrspi iitrsip iitrisp iitrips iitprsi iitpris iitpsri
iitpsir iitpisr iitpirs iitspri iitspir iitsrpi iitsrip iitsirp iitsipr iitipsr iitiprs
iitispr iitisrp iitirsp iitirps iiirpts iiirpst iiirtps iiirtsp iiirstp iiirspt iiiprts
iiiprst iiiptrs iiiptsr iiipstr iiipsrt iiitprs iiitpsr iiitrps iiitrsp iiitsrp iiitspr
iiisptr iiisprt iiistpr iiistrp iiisrtp iiisrpt itsripi itsriip itsrpii itsrpii itsripi
itsriip itsirpi itsirip itsipri itsipir itsiipr itsiirp itspiri itspiir itsprii itsprii
itspiri itspiir itsiipr itsiirp itsipir itsipri itsirpi itsirip itrsipi itrsiip itrspii
itrspii itrsipi itrsiip itrispi itrisip itripsi itripis itriips itriisp itrpisi itrpiis
itrpsii itrpsii itrpisi itrpiis itriips itriisp itripis itripsi itrispi itrisip itirspi
itirsip itirpsi itirpis itirips itirisp itisrpi itisrip itispri itispir itisipr itisirp
itipsri itipsir itiprsi itipris itipirs itipisr itiispr itiisrp itiipsr itiiprs itiirps
itiirsp itprisi itpriis itprsii itprsii itprisi itpriis itpirsi itpiris itpisri itpisir
itpiisr itpiirs itpsiri itpsiir itpsrii itpsrii itpsiri itpsiir itpiisr itpiirs itpisir
itpisri itpirsi itpiris itirips itirisp itirpis itirpsi itirspi itirsip itiirps itiirsp
itiiprs itiipsr itiispr itiisrp itipirs itipisr itipris itiprsi itipsri itipsir itisipr
itisirp itispir itispri itisrpi itisrip iisritp iisript iisrtip iisrtpi iisrpti iisrpit
iisirtp iisirpt iisitrp iisitpr iisiptr iisiprt iistirp iistipr iistrip iistrpi iistpri
iistpir iispitr iispirt iisptir iisptri iisprti iisprit iirsitp iirsipt iirstip iirstpi
iirspti iirspit iiristp iirispt iiritsp iiritps iiripts iiripst iirtisp iirtips iirtsip
iirtspi iirtpsi iirtpis iirpits iirpist iirptis iirptsi iirpsti iirpsit iiirstp iiirspt
iiirtsp iiirtps iiirpts iiirpst iiisrtp iiisrpt iiistrp iiistpr iiisptr iiisprt iiitsrp
iiitspr iiitrsp iiitrps iiitprs iiitpsr iiipstr iiipsrt iiiptsr iiiptrs iiiprts iiiprst
iitrisp iitrips iitrsip iitrspi iitrpsi iitrpis iitirsp iitirps iitisrp iitispr iitipsr
iitiprs iitsirp iitsipr iitsrip iitsrpi iitspri iitspir iitpisr iitpirs iitpsir iitpsri
iitprsi iitpris iiprits iiprist iiprtis iiprtsi iiprsti iiprsit iipirts iipirst iipitrs
iipitsr iipistr iipisrt iiptirs iiptisr iiptris iiptrsi iiptsri iiptsir iipsitr iipsirt
iipstir iipstri iipsrti iipsrit rpisiti rpisiit rpistii rpistii rpisiti rpisiit rpiisti
rpiisit rpiitsi rpiitis rpiiits rpiiist rpitisi rpitiis rpitsii rpitsii rpitisi rpitiis
rpiiits rpiiist rpiitis rpiitsi rpiisti rpiisit rpsiiti rpsiiit rpsitii rpsitii rpsiiti
rpsiiit rpsiiti rpsiiit rpsitii rpsitii rpsiiti rpsiiit rpstiii rpstiii rpstiii rpstiii
rpstiii rpstiii rpsiiti rpsiiit rpsitii rpsitii rpsiiti rpsiiit rpisiti rpisiit rpistii
rpistii rpisiti rpisiit rpiisti rpiisit rpiitsi rpiitis rpiiits rpiiist rpitisi rpitiis
rpitsii rpitsii rpitisi rpitiis rpiiits rpiiist rpiitis rpiitsi rpiisti rpiisit rptsiii
rptsiii rptsiii rptsiii rptsiii rptsiii rptisii rptisii rptiisi rptiiis rptiiis rptiisi
rptiisi rptiiis rptisii rptisii rptiisi rptiiis rptiiis rptiisi rptiiis rptiisi rptisii
rptisii rpisiti rpisiit rpistii rpistii rpisiti rpisiit rpiisti rpiisit rpiitsi rpiitis
rpiiits rpiiist rpitisi rpitiis rpitsii rpitsii rpitisi rpitiis rpiiits rpiiist rpiitis
rpiitsi rpiisti rpiisit ripsiti ripsiit ripstii ripstii ripsiti ripsiit ripisti ripisit
ripitsi ripitis ripiits ripiist riptisi riptiis riptsii riptsii riptisi riptiis ripiits
ripiist ripitis ripitsi ripisti ripisit rispiti rispiit risptii risptii rispiti rispiit
risipti risipit risitpi risitip risiitp risiipt ristipi ristiip ristpii ristpii ristipi
ristiip risiitp risiipt risitip risitpi risipti risipit riispti riispit riistpi riistip
riisitp riisipt riipsti riipsit riiptsi riiptis riipits riipist riitpsi riitpis riitspi
riitsip riitisp riitips riiipts riiipst riiitps riiitsp riiistp riiispt ritsipi ritsiip
ritspii ritspii ritsipi ritsiip ritispi ritisip ritipsi ritipis ritiips ritiisp ritpisi
ritpiis ritpsii ritpsii ritpisi ritpiis ritiips ritiisp ritipis ritipsi ritispi ritisip
riisitp riisipt riistip riistpi riispti riispit riiistp riiispt riiitsp riiitps riiipts
riiipst riitisp riitips riitsip riitspi riitpsi riitpis riipits riipist riiptis riiptsi
riipsti riipsit rsipiti rsipiit rsiptii rsiptii rsipiti rsipiit rsiipti rsiipit rsiitpi
rsiitip rsiiitp rsiiipt rsitipi rsitiip rsitpii rsitpii rsitipi rsitiip rsiiitp rsiiipt
rsiitip rsiitpi rsiipti rsiipit rspiiti rspiiit rspitii rspitii rspiiti rspiiit rspiiti
rspiiit rspitii rspitii rspiiti rspiiit rsptiii rsptiii rsptiii rsptiii rsptiii rsptiii
rspiiti rspiiit rspitii rspitii rspiiti rspiiit rsipiti rsipiit rsiptii rsiptii rsipiti
rsipiit rsiipti rsiipit rsiitpi rsiitip rsiiitp rsiiipt rsitipi rsitiip rsitpii rsitpii
rsitipi rsitiip rsiiitp rsiiipt rsiitip rsiitpi rsiipti rsiipit rstpiii rstpiii rstpiii
rstpiii rstpiii rstpiii rstipii rstipii rstiipi rstiiip rstiiip rstiipi rstiipi rstiiip
rstipii rstipii rstiipi rstiiip rstiiip rstiipi rstiiip rstiipi rstipii rstipii rsipiti
rsipiit rsiptii rsiptii rsipiti rsipiit rsiipti rsiipit rsiitpi rsiitip rsiiitp rsiiipt
rsitipi rsitiip rsitpii rsitpii rsitipi rsitiip rsiiitp rsiiipt rsiitip rsiitpi rsiipti
rsiipit riispti riispit riistpi riistip riisitp riisipt riipsti riipsit riiptsi riiptis
riipits riipist riitpsi riitpis riitspi riitsip riitisp riitips riiipts riiipst riiitps
riiitsp riiistp riiispt risipti risipit risitpi risitip risiitp risiipt rispiti rispiit
risptii risptii rispiti rispiit ristpii ristpii ristipi ristiip ristiip ristipi risipti
risipit risitpi risitip risiitp risiipt ripsiti ripsiit ripstii ripstii ripsiti ripsiit
ripisti ripisit ripitsi ripitis ripiits ripiist riptisi riptiis riptsii riptsii riptisi
riptiis ripiits ripiist ripitis ripitsi ripisti ripisit ritspii ritspii ritsipi ritsiip
ritsiip ritsipi ritpsii ritpsii ritpisi ritpiis ritpiis ritpisi ritipsi ritipis ritispi
ritisip ritiisp ritiips ritipis ritipsi ritiips ritiisp ritisip ritispi riispti riispit
riistpi riistip riisitp riisipt riipsti riipsit riiptsi riiptis riipits riipist riitpsi
riitpis riitspi riitsip riitisp riitips riiipts riiipst riiitps riiitsp riiistp riiispt
rtisipi rtisiip rtispii rtispii rtisipi rtisiip rtiispi rtiisip rtiipsi rtiipis rtiiips
rtiiisp rtipisi rtipiis rtipsii rtipsii rtipisi rtipiis rtiiips rtiiisp rtiipis rtiipsi
rtiispi rtiisip rtsiipi rtsiiip rtsipii rtsipii rtsiipi rtsiiip rtsiipi rtsiiip rtsipii
rtsipii rtsiipi rtsiiip rtspiii rtspiii rtspiii rtspiii rtspiii rtspiii rtsiipi rtsiiip
rtsipii rtsipii rtsiipi rtsiiip rtisipi rtisiip rtispii rtispii rtisipi rtisiip rtiispi
rtiisip rtiipsi rtiipis rtiiips rtiiisp rtipisi rtipiis rtipsii rtipsii rtipisi rtipiis
rtiiips rtiiisp rtiipis rtiipsi rtiispi rtiisip rtpsiii rtpsiii rtpsiii rtpsiii rtpsiii
rtpsiii rtpisii rtpisii rtpiisi rtpiiis rtpiiis rtpiisi rtpiisi rtpiiis rtpisii rtpisii
rtpiisi rtpiiis rtpiiis rtpiisi rtpiiis rtpiisi rtpisii rtpisii rtisipi rtisiip rtispii
rtispii rtisipi rtisiip rtiispi rtiisip rtiipsi rtiipis rtiiips rtiiisp rtipisi rtipiis
rtipsii rtipsii rtipisi rtipiis rtiiips rtiiisp rtiipis rtiipsi rtiispi rtiisip riisitp
riisipt riistip riistpi riispti riispit riiistp riiispt riiitsp riiitps riiipts riiipst
riitisp riitips riitsip riitspi riitpsi riitpis riipits riipist riiptis riiptsi riipsti
riipsit risiitp risiipt risitip risitpi risipti risipit risiitp risiipt risitip risitpi
risipti risipit ristiip ristipi ristiip ristipi ristpii ristpii rispiti rispiit risptii
risptii rispiti rispiit riisitp riisipt riistip riistpi riispti riispit riiistp riiispt
riiitsp riiitps riiipts riiipst riitisp riitips riitsip riitspi riitpsi riitpis riipits
riipist riiptis riiptsi riipsti riipsit ritsiip ritsipi ritsiip ritsipi ritspii ritspii
ritisip ritispi ritiisp ritiips ritipis ritipsi ritiisp ritiips ritisip ritispi ritipsi
ritipis ritpiis ritpisi ritpiis ritpisi ritpsii ritpsii ripsiti ripsiit ripstii ripstii
ripsiti ripsiit ripisti ripisit ripitsi ripitis ripiits ripiist riptisi riptiis riptsii
riptsii riptisi riptiis ripiits ripiist ripitis ripitsi ripisti ripisit ipirsti ipirsit
ipirtsi ipirtis ipirits ipirist ipisrti ipisrit ipistri ipistir ipisitr ipisirt ipitsri
ipitsir ipitrsi ipitris ipitirs ipitisr ipiistr ipiisrt ipiitsr ipiitrs ipiirts ipiirst
ipristi iprisit ipritsi ipritis ipriits ipriist iprsiti iprsiit iprstii iprstii iprsiti
iprsiit iprtsii iprtsii iprtisi iprtiis iprtiis iprtisi ipristi iprisit ipritsi ipritis
ipriits ipriist ipsriti ipsriit ipsrtii ipsrtii ipsriti ipsriit ipsirti ipsirit ipsitri
ipsitir ipsiitr ipsiirt ipstiri ipstiir ipstrii ipstrii ipstiri ipstiir ipsiitr ipsiirt
ipsitir ipsitri ipsirti ipsirit iptrsii iptrsii iptrisi iptriis iptriis iptrisi iptsrii
iptsrii iptsiri iptsiir iptsiir iptsiri iptisri iptisir iptirsi iptiris iptiirs iptiisr
iptisir iptisri iptiisr iptiirs iptiris iptirsi ipirsti ipirsit ipirtsi ipirtis ipirits
ipirist ipisrti ipisrit ipistri ipistir ipisitr ipisirt ipitsri ipitsir ipitrsi ipitris
ipitirs ipitisr ipiistr ipiisrt ipiitsr ipiitrs ipiirts ipiirst iiprsti iiprsit iiprtsi
iiprtis iiprits iiprist iipsrti iipsrit iipstri iipstir iipsitr iipsirt iiptsri iiptsir
iiptrsi iiptris iiptirs iiptisr iipistr iipisrt iipitsr iipitrs iipirts iipirst iirpsti
iirpsit iirptsi iirptis iirpits iirpist iirspti iirspit iirstpi iirstip iirsitp iirsipt
iirtspi iirtsip iirtpsi iirtpis iirtips iirtisp iiristp iirispt iiritsp iiritps iiripts
iiripst iisrpti iisrpit iisrtpi iisrtip iisritp iisript iisprti iisprit iisptri iisptir
iispitr iispirt iistpri iistpir iistrpi iistrip iistirp iistipr iisiptr iisiprt iisitpr
iisitrp iisirtp iisirpt iitrspi iitrsip iitrpsi iitrpis iitrips iitrisp iitsrpi iitsrip
iitspri iitspir iitsipr iitsirp iitpsri iitpsir iitprsi iitpris iitpirs iitpisr iitispr
iitisrp iitipsr iitiprs iitirps iitirsp iiirstp iiirspt iiirtsp iiirtps iiirpts iiirpst
iiisrtp iiisrpt iiistrp iiistpr iiisptr iiisprt iiitsrp iiitspr iiitrsp iiitrps iiitprs
iiitpsr iiipstr iiipsrt iiiptsr iiiptrs iiiprts iiiprst iripsti iripsit iriptsi iriptis
iripits iripist irispti irispit iristpi iristip irisitp irisipt iritspi iritsip iritpsi
iritpis iritips iritisp iriistp iriispt iriitsp iriitps iriipts iriipst irpisti irpisit
irpitsi irpitis irpiits irpiist irpsiti irpsiit irpstii irpstii irpsiti irpsiit irptsii
irptsii irptisi irptiis irptiis irptisi irpisti irpisit irpitsi irpitis irpiits irpiist
irspiti irspiit irsptii irsptii irspiti irspiit irsipti irsipit irsitpi irsitip irsiitp
irsiipt irstipi irstiip irstpii irstpii irstipi irstiip irsiitp irsiipt irsitip irsitpi
irsipti irsipit irtpsii irtpsii irtpisi irtpiis irtpiis irtpisi irtspii irtspii irtsipi
irtsiip irtsiip irtsipi irtispi irtisip irtipsi irtipis irtiips irtiisp irtisip irtispi
irtiisp irtiips irtipis irtipsi iripsti iripsit iriptsi iriptis iripits iripist irispti
irispit iristpi iristip irisitp irisipt iritspi iritsip iritpsi iritpis iritips iritisp
iriistp iriispt iriitsp iriitps iriipts iriipst isirpti isirpit isirtpi isirtip isiritp
isiript isiprti isiprit isiptri isiptir isipitr isipirt isitpri isitpir isitrpi isitrip
isitirp isitipr isiiptr isiiprt isiitpr isiitrp isiirtp isiirpt isripti isripit isritpi
isritip isriitp isriipt isrpiti isrpiit isrptii isrptii isrpiti isrpiit isrtpii isrtpii
isrtipi isrtiip isrtiip isrtipi isripti isripit isritpi isritip isriitp isriipt ispriti
ispriit isprtii isprtii ispriti ispriit ispirti ispirit ispitri ispitir ispiitr ispiirt
isptiri isptiir isptrii isptrii isptiri isptiir ispiitr ispiirt ispitir ispitri ispirti
ispirit istrpii istrpii istripi istriip istriip istripi istprii istprii istpiri istpiir
istpiir istpiri istipri istipir istirpi istirip istiirp istiipr istipir istipri istiipr
istiirp istirip istirpi isirpti isirpit isirtpi isirtip isiritp isiript isiprti isiprit
isiptri isiptir isipitr isipirt isitpri isitpir isitrpi isitrip isitirp isitipr isiiptr
isiiprt isiitpr isiitrp isiirtp isiirpt itirspi itirsip itirpsi itirpis itirips itirisp
itisrpi itisrip itispri itispir itisipr itisirp itipsri itipsir itiprsi itipris itipirs
itipisr itiispr itiisrp itiipsr itiiprs itiirps itiirsp itrispi itrisip itripsi itripis
itriips itriisp itrsipi itrsiip itrspii itrspii itrsipi itrsiip itrpsii itrpsii itrpisi
itrpiis itrpiis itrpisi itrispi itrisip itripsi itripis itriips itriisp itsripi itsriip
itsrpii itsrpii itsripi itsriip itsirpi itsirip itsipri itsipir itsiipr itsiirp itspiri
itspiir itsprii itsprii itspiri itspiir itsiipr itsiirp itsipir itsipri itsirpi itsirip
itprsii itprsii itprisi itpriis itpriis itprisi itpsrii itpsrii itpsiri itpsiir itpsiir
itpsiri itpisri itpisir itpirsi itpiris itpiirs itpiisr itpisir itpisri itpiisr itpiirs
itpiris itpirsi itirspi itirsip itirpsi itirpis itirips itirisp itisrpi itisrip itispri
itispir itisipr itisirp itipsri itipsir itiprsi itipris itipirs itipisr itiispr itiisrp
itiipsr itiiprs itiirps itiirsp iiirstp iiirspt iiirtsp iiirtps iiirpts iiirpst iiisrtp
iiisrpt iiistrp iiistpr iiisptr iiisprt iiitsrp iiitspr iiitrsp iiitrps iiitprs iiitpsr
iiipstr iiipsrt iiiptsr iiiptrs iiiprts iiiprst iiristp iirispt iiritsp iiritps iiripts
iiripst iirsitp iirsipt iirstip iirstpi iirspti iirspit iirtsip iirtspi iirtisp iirtips
iirtpis iirtpsi iirpsti iirpsit iirptsi iirptis iirpits iirpist iisritp iisript iisrtip
iisrtpi iisrpti iisrpit iisirtp iisirpt iisitrp iisitpr iisiptr iisiprt iistirp iistipr
iistrip iistrpi iistpri iistpir iispitr iispirt iisptir iisptri iisprti iisprit iitrsip
iitrspi iitrisp iitrips iitrpis iitrpsi iitsrip iitsrpi iitsirp iitsipr iitspir iitspri
iitisrp iitispr iitirsp iitirps iitiprs iitipsr iitpsir iitpsri iitpisr iitpirs iitpris
iitprsi iiprsti iiprsit iiprtsi iiprtis iiprits iiprist iipsrti iipsrit iipstri iipstir
iipsitr iipsirt iiptsri iiptsir iiptrsi iiptris iiptirs iiptisr iipistr iipisrt iipitsr
iipitrs iipirts iipirst tpirisi tpiriis tpirsii tpirsii tpirisi tpiriis tpiirsi tpiiris
tpiisri tpiisir tpiiisr tpiiirs tpisiri tpisiir tpisrii tpisrii tpisiri tpisiir tpiiisr
tpiiirs tpiisir tpiisri tpiirsi tpiiris tpriisi tpriiis tprisii tprisii tpriisi tpriiis
tpriisi tpriiis tprisii tprisii tpriisi tpriiis tprsiii tprsiii tprsiii tprsiii tprsiii
tprsiii tpriisi tpriiis tprisii tprisii tpriisi tpriiis tpirisi tpiriis tpirsii tpirsii
tpirisi tpiriis tpiirsi tpiiris tpiisri tpiisir tpiiisr tpiiirs tpisiri tpisiir tpisrii
tpisrii tpisiri tpisiir tpiiisr tpiiirs tpiisir tpiisri tpiirsi tpiiris tpsriii tpsriii
tpsriii tpsriii tpsriii tpsriii tpsirii tpsirii tpsiiri tpsiiir tpsiiir tpsiiri tpsiiri
tpsiiir tpsirii tpsirii tpsiiri tpsiiir tpsiiir tpsiiri tpsiiir tpsiiri tpsirii tpsirii
tpirisi tpiriis tpirsii tpirsii tpirisi tpiriis tpiirsi tpiiris tpiisri tpiisir tpiiisr
tpiiirs tpisiri tpisiir tpisrii tpisrii tpisiri tpisiir tpiiisr tpiiirs tpiisir tpiisri
tpiirsi tpiiris tiprisi tipriis tiprsii tiprsii tiprisi tipriis tipirsi tipiris tipisri
tipisir tipiisr tipiirs tipsiri tipsiir tipsrii tipsrii tipsiri tipsiir tipiisr tipiirs
tipisir tipisri tipirsi tipiris tirpisi tirpiis tirpsii tirpsii tirpisi tirpiis tiripsi
tiripis tirispi tirisip tiriisp tiriips tirsipi tirsiip tirspii tirspii tirsipi tirsiip
tiriisp tiriips tirisip tirispi tiripsi tiripis tiirpsi tiirpis tiirspi tiirsip tiirisp
tiirips tiiprsi tiipris tiipsri tiipsir tiipisr tiipirs tiispri tiispir tiisrpi tiisrip
tiisirp tiisipr tiiipsr tiiiprs tiiispr tiiisrp tiiirsp tiiirps tisripi tisriip tisrpii
tisrpii tisripi tisriip tisirpi tisirip tisipri tisipir tisiipr tisiirp tispiri tispiir
tisprii tisprii tispiri tispiir tisiipr tisiirp tisipir tisipri tisirpi tisirip tiirisp
tiirips tiirsip tiirspi tiirpsi tiirpis tiiirsp tiiirps tiiisrp tiiispr tiiipsr tiiiprs
tiisirp tiisipr tiisrip tiisrpi tiispri tiispir tiipisr tiipirs tiipsir tiipsri tiiprsi
tiipris tripisi tripiis tripsii tripsii tripisi tripiis triipsi triipis triispi triisip
triiisp triiips trisipi trisiip trispii trispii trisipi trisiip triiisp triiips triisip
triispi triipsi triipis trpiisi trpiiis trpisii trpisii trpiisi trpiiis trpiisi trpiiis
trpisii trpisii trpiisi trpiiis trpsiii trpsiii trpsiii trpsiii trpsiii trpsiii trpiisi
trpiiis trpisii trpisii trpiisi trpiiis tripisi tripiis tripsii tripsii tripisi tripiis
triipsi triipis triispi triisip triiisp triiips trisipi trisiip trispii trispii trisipi
trisiip triiisp triiips triisip triispi triipsi triipis trspiii trspiii trspiii trspiii
trspiii trspiii trsipii trsipii trsiipi trsiiip trsiiip trsiipi trsiipi trsiiip trsipii
trsipii trsiipi trsiiip trsiiip trsiipi trsiiip trsiipi trsipii trsipii tripisi tripiis
tripsii tripsii tripisi tripiis triipsi triipis triispi triisip triiisp triiips trisipi
trisiip trispii trispii trisipi trisiip triiisp triiips triisip triispi triipsi triipis
tiirpsi tiirpis tiirspi tiirsip tiirisp tiirips tiiprsi tiipris tiipsri tiipsir tiipisr
tiipirs tiispri tiispir tiisrpi tiisrip tiisirp tiisipr tiiipsr tiiiprs tiiispr tiiisrp
tiiirsp tiiirps tiripsi tiripis tirispi tirisip tiriisp tiriips tirpisi tirpiis tirpsii
tirpsii tirpisi tirpiis tirspii tirspii tirsipi tirsiip tirsiip tirsipi tiripsi tiripis
tirispi tirisip tiriisp tiriips tiprisi tipriis tiprsii tiprsii tiprisi tipriis tipirsi
tipiris tipisri tipisir tipiisr tipiirs tipsiri tipsiir tipsrii tipsrii tipsiri tipsiir
tipiisr tipiirs tipisir tipisri tipirsi tipiris tisrpii tisrpii tisripi tisriip tisriip
tisripi tisprii tisprii tispiri tispiir tispiir tispiri tisipri tisipir tisirpi tisirip
tisiirp tisiipr tisipir tisipri tisiipr tisiirp tisirip tisirpi tiirpsi tiirpis tiirspi
tiirsip tiirisp tiirips tiiprsi tiipris tiipsri tiipsir tiipisr tiipirs tiispri tiispir
tiisrpi tiisrip tiisirp tiisipr tiiipsr tiiiprs tiiispr tiiisrp tiiirsp tiiirps tsiripi
tsiriip tsirpii tsirpii tsiripi tsiriip tsiirpi tsiirip tsiipri tsiipir tsiiipr tsiiirp
tsipiri tsipiir tsiprii tsiprii tsipiri tsipiir tsiiipr tsiiirp tsiipir tsiipri tsiirpi
tsiirip tsriipi tsriiip tsripii tsripii tsriipi tsriiip tsriipi tsriiip tsripii tsripii
tsriipi tsriiip tsrpiii tsrpiii tsrpiii tsrpiii tsrpiii tsrpiii tsriipi tsriiip tsripii
tsripii tsriipi tsriiip tsiripi tsiriip tsirpii tsirpii tsiripi tsiriip tsiirpi tsiirip
tsiipri tsiipir tsiiipr tsiiirp tsipiri tsipiir tsiprii tsiprii tsipiri tsipiir tsiiipr
tsiiirp tsiipir tsiipri tsiirpi tsiirip tspriii tspriii tspriii tspriii tspriii tspriii
tspirii tspirii tspiiri tspiiir tspiiir tspiiri tspiiri tspiiir tspirii tspirii tspiiri
tspiiir tspiiir tspiiri tspiiir tspiiri tspirii tspirii tsiripi tsiriip tsirpii tsirpii
tsiripi tsiriip tsiirpi tsiirip tsiipri tsiipir tsiiipr tsiiirp tsipiri tsipiir tsiprii
tsiprii tsipiri tsipiir tsiiipr tsiiirp tsiipir tsiipri tsiirpi tsiirip tiirisp tiirips
tiirsip tiirspi tiirpsi tiirpis tiiirsp tiiirps tiiisrp tiiispr tiiipsr tiiiprs tiisirp
tiisipr tiisrip tiisrpi tiispri tiispir tiipisr tiipirs tiipsir tiipsri tiiprsi tiipris
tiriisp tiriips tirisip tirispi tiripsi tiripis tiriisp tiriips tirisip tirispi tiripsi
tiripis tirsiip tirsipi tirsiip tirsipi tirspii tirspii tirpisi tirpiis tirpsii tirpsii
tirpisi tirpiis tiirisp tiirips tiirsip tiirspi tiirpsi tiirpis tiiirsp tiiirps tiiisrp
tiiispr tiiipsr tiiiprs tiisirp tiisipr tiisrip tiisrpi tiispri tiispir tiipisr tiipirs
tiipsir tiipsri tiiprsi tiipris tisriip tisripi tisriip tisripi tisrpii tisrpii tisirip
tisirpi tisiirp tisiipr tisipir tisipri tisiirp tisiipr tisirip tisirpi tisipri tisipir
tispiir tispiri tispiir tispiri tisprii tisprii tiprisi tipriis tiprsii tiprsii tiprisi
tipriis tipirsi tipiris tipisri tipisir tipiisr tipiirs tipsiri tipsiir tipsrii tipsrii
tipsiri tipsiir tipiisr tipiirs tipisir tipisri tipirsi tipiris ipirits ipirist ipirtis
ipirtsi ipirsti ipirsit ipiirts ipiirst ipiitrs ipiitsr ipiistr ipiisrt ipitirs ipitisr
ipitris ipitrsi ipitsri ipitsir ipisitr ipisirt ipistir ipistri ipisrti ipisrit ipriits
ipriist ipritis ipritsi ipristi iprisit ipriits ipriist ipritis ipritsi ipristi iprisit
iprtiis iprtisi iprtiis iprtisi iprtsii iprtsii iprsiti iprsiit iprstii iprstii iprsiti
iprsiit ipirits ipirist ipirtis ipirtsi ipirsti ipirsit ipiirts ipiirst ipiitrs ipiitsr
ipiistr ipiisrt ipitirs ipitisr ipitris ipitrsi ipitsri ipitsir ipisitr ipisirt ipistir
ipistri ipisrti ipisrit iptriis iptrisi iptriis iptrisi iptrsii iptrsii iptiris iptirsi
iptiirs iptiisr iptisir iptisri iptiirs iptiisr iptiris iptirsi iptisri iptisir iptsiir
iptsiri iptsiir iptsiri iptsrii iptsrii ipsriti ipsriit ipsrtii ipsrtii ipsriti ipsriit
ipsirti ipsirit ipsitri ipsitir ipsiitr ipsiirt ipstiri ipstiir ipstrii ipstrii ipstiri
ipstiir ipsiitr ipsiirt ipsitir ipsitri ipsirti ipsirit iiprits iiprist iiprtis iiprtsi
iiprsti iiprsit iipirts iipirst iipitrs iipitsr iipistr iipisrt iiptirs iiptisr iiptris
iiptrsi iiptsri iiptsir iipsitr iipsirt iipstir iipstri iipsrti iipsrit iirpits iirpist
iirptis iirptsi iirpsti iirpsit iiripts iiripst iiritps iiritsp iiristp iirispt iirtips
iirtisp iirtpis iirtpsi iirtspi iirtsip iirsitp iirsipt iirstip iirstpi iirspti iirspit
iiirpts iiirpst iiirtps iiirtsp iiirstp iiirspt iiiprts iiiprst iiiptrs iiiptsr iiipstr
iiipsrt iiitprs iiitpsr iiitrps iiitrsp iiitsrp iiitspr iiisptr iiisprt iiistpr iiistrp
iiisrtp iiisrpt iitrips iitrisp iitrpis iitrpsi iitrspi iitrsip iitirps iitirsp iitiprs
iitipsr iitispr iitisrp iitpirs iitpisr iitpris iitprsi iitpsri iitpsir iitsipr iitsirp
iitspir iitspri iitsrpi iitsrip iisritp iisript iisrtip iisrtpi iisrpti iisrpit iisirtp
iisirpt iisitrp iisitpr iisiptr iisiprt iistirp iistipr iistrip iistrpi iistpri iistpir
iispitr iispirt iisptir iisptri iisprti iisprit iripits iripist iriptis iriptsi iripsti
iripsit iriipts iriipst iriitps iriitsp iriistp iriispt iritips iritisp iritpis iritpsi
iritspi iritsip irisitp irisipt iristip iristpi irispti irispit irpiits irpiist irpitis
irpitsi irpisti irpisit irpiits irpiist irpitis irpitsi irpisti irpisit irptiis irptisi
irptiis irptisi irptsii irptsii irpsiti irpsiit irpstii irpstii irpsiti irpsiit iripits
iripist iriptis iriptsi iripsti iripsit iriipts iriipst iriitps iriitsp iriistp iriispt
iritips iritisp iritpis iritpsi iritspi iritsip irisitp irisipt iristip iristpi irispti
irispit irtpiis irtpisi irtpiis irtpisi irtpsii irtpsii irtipis irtipsi irtiips irtiisp
irtisip irtispi irtiips irtiisp irtipis irtipsi irtispi irtisip irtsiip irtsipi irtsiip
irtsipi irtspii irtspii irspiti irspiit irsptii irsptii irspiti irspiit irsipti irsipit
irsitpi irsitip irsiitp irsiipt irstipi irstiip irstpii irstpii irstipi irstiip irsiitp
irsiipt irsitip irsitpi irsipti irsipit iiirpts iiirpst iiirtps iiirtsp iiirstp iiirspt
iiiprts iiiprst iiiptrs iiiptsr iiipstr iiipsrt iiitprs iiitpsr iiitrps iiitrsp iiitsrp
iiitspr iiisptr iiisprt iiistpr iiistrp iiisrtp iiisrpt iiripts iiripst iiritps iiritsp
iiristp iirispt iirpits iirpist iirptis iirptsi iirpsti iirpsit iirtpis iirtpsi iirtips
iirtisp iirtsip iirtspi iirspti iirspit iirstpi iirstip iirsitp iirsipt iiprits iiprist
iiprtis iiprtsi iiprsti iiprsit iipirts iipirst iipitrs iipitsr iipistr iipisrt iiptirs
iiptisr iiptris iiptrsi iiptsri iiptsir iipsitr iipsirt iipstir iipstri iipsrti iipsrit
iitrpis iitrpsi iitrips iitrisp iitrsip iitrspi iitpris iitprsi iitpirs iitpisr iitpsir
iitpsri iitiprs iitipsr iitirps iitirsp iitisrp iitispr iitspir iitspri iitsipr iitsirp
iitsrip iitsrpi iisrpti iisrpit iisrtpi iisrtip iisritp iisript iisprti iisprit iisptri
iisptir iispitr iispirt iistpri iistpir iistrpi iistrip iistirp iistipr iisiptr iisiprt
iisitpr iisitrp iisirtp iisirpt itirips itirisp itirpis itirpsi itirspi itirsip itiirps
itiirsp itiiprs itiipsr itiispr itiisrp itipirs itipisr itipris itiprsi itipsri itipsir
itisipr itisirp itispir itispri itisrpi itisrip itriips itriisp itripis itripsi itrispi
itrisip itriips itriisp itripis itripsi itrispi itrisip itrpiis itrpisi itrpiis itrpisi
itrpsii itrpsii itrsipi itrsiip itrspii itrspii itrsipi itrsiip itirips itirisp itirpis
itirpsi itirspi itirsip itiirps itiirsp itiiprs itiipsr itiispr itiisrp itipirs itipisr
itipris itiprsi itipsri itipsir itisipr itisirp itispir itispri itisrpi itisrip itpriis
itprisi itpriis itprisi itprsii itprsii itpiris itpirsi itpiirs itpiisr itpisir itpisri
itpiirs itpiisr itpiris itpirsi itpisri itpisir itpsiir itpsiri itpsiir itpsiri itpsrii
itpsrii itsripi itsriip itsrpii itsrpii itsripi itsriip itsirpi itsirip itsipri itsipir
itsiipr itsiirp itspiri itspiir itsprii itsprii itspiri itspiir itsiipr itsiirp itsipir
itsipri itsirpi itsirip isiritp isiript isirtip isirtpi isirpti isirpit isiirtp isiirpt
isiitrp isiitpr isiiptr isiiprt isitirp isitipr isitrip isitrpi isitpri isitpir isipitr
isipirt isiptir isiptri isiprti isiprit isriitp isriipt isritip isritpi isripti isripit
isriitp isriipt isritip isritpi isripti isripit isrtiip isrtipi isrtiip isrtipi isrtpii
isrtpii isrpiti isrpiit isrptii isrptii isrpiti isrpiit isiritp isiript isirtip isirtpi
isirpti isirpit isiirtp isiirpt isiitrp isiitpr isiiptr isiiprt isitirp isitipr isitrip
isitrpi isitpri isitpir isipitr isipirt isiptir isiptri isiprti isiprit istriip istripi
istriip istripi istrpii istrpii istirip istirpi istiirp istiipr istipir istipri istiirp
istiipr istirip istirpi istipri istipir istpiir istpiri istpiir istpiri istprii istprii
ispriti ispriit isprtii isprtii ispriti ispriit ispirti ispirit ispitri ispitir ispiitr
ispiirt isptiri isptiir isptrii isptrii isptiri isptiir ispiitr ispiirt ispitir ispitri
ispirti ispirit

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us