easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

swheele

depigment

bathochromatic

apologize

extorsion

augsb

dosimetrist

jenufa

bicallis

lyonesse

astringes

jellison

shaye

extispicy

sementes

caterpillarlike

creatores

doublesprings


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: soskin
cipher variations:
tptljo uqumkp vrvnlq wswomr xtxpns
yuyqot zvzrpu awasqv bxbtrw cycusx
dzdvty eaewuz fbfxva gcgywb hdhzxc
ieiayd jfjbze kgkcaf lhldbg mimech
njnfdi okogej plphfk qmqigl rnrjhm

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: soskin
Cipher: hlhprm

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: soskin
Cipher: BAAAB ABBAB BAAAB ABAAB ABAAA ABBAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: soskin
cipher variations:
tptljodrdfzontnzpoxvxtfohxhnvorzrhloldlvrovfvpho
fhfjxopjpdnozlzxdojnjrtouqumkpesegapouoaqpywyugp
iyiowpsasimpmemwspwgwqipgigkypqkqeopamayepkoksup
vrvnlqftfhbqpvpbrqzxzvhqjzjpxqtbtjnqnfnxtqxhxrjq
hjhlzqrlrfpqbnbzfqlpltvqwswomrgugicrqwqcsrayawir
kakqyrucukorogoyuryiyskrikimarsmsgqrcocagrmqmuwr
xtxpnshvhjdsrxrdtsbzbxjslblrzsvdvlpsphpzvszjztls
jljnbstnthrsdpdbhsnrnvxsyuyqotiwiketsyseutcacykt
mcmsatwewmqtqiqawtakaumtkmkoctuouisteqecitosowyt
zvzrpujxjlfutztfvudbdzlundntbuxfxnrurjrbxublbvnu
lnlpduvpvjtufrfdjuptpxzuawasqvkykmgvuaugwveceamv
oeoucvygyosvskscyvcmcwovmomqevwqwkuvgsgekvquqyav
bxbtrwlzlnhwvbvhxwfdfbnwpfpvdwzhzptwtltdzwdndxpw
npnrfwxrxlvwhthflwrvrzbwcycusxmamoixwcwiyxgegcox
qgqwexaiaquxumueaxeoeyqxoqosgxysymwxiuigmxswsacx
dzdvtynbnpjyxdxjzyhfhdpyrhrxfybjbrvyvnvfbyfpfzry
prpthyztznxyjvjhnytxtbdyeaewuzocoqkzyeykazigieqz
sisygzckcswzwowgczgqgaszqsquizauaoyzkwkiozuyucez
fbfxvapdprlazfzlbajhjfratjtzhadldtxaxpxhdahrhbta
rtrvjabvbpzalxljpavzvdfagcgywbqeqsmbagamcbkikgsb
ukuaibemeuybyqyiebisicubsuswkbcwcqabmymkqbwawegb
hdhzxcrfrtncbhbndcljlhtcvlvbjcfnfvzczrzjfcjtjdvc
tvtxlcdxdrbcnznlrcxbxfhcieiaydsgsuodcicoedmkmiud
wmwckdgogwadasakgdkukewduwuymdeyescdoaomsdycygid
jfjbzethtvpedjdpfenlnjvexnxdlehphxbebtblhelvlfxe
vxvznefzftdepbpntezdzhjekgkcafuiuwqfekeqgfomokwf
yoyemfiqiycfcucmifmwmgyfwywaofgaguefqcqoufaeaikf
lhldbgvjvxrgflfrhgpnplxgzpzfngjrjzdgdvdnjgnxnhzg
xzxbpghbhvfgrdrpvgbfbjlgmimechwkwyshgmgsihqoqmyh
aqagohkskaeheweokhoyoiahyaycqhiciwghsesqwhcgckmh
njnfdixlxztihnhtjirprnzibrbhpiltlbfifxfplipzpjbi
zbzdrijdjxhitftrxidhdlniokogejymyaujioiukjsqsoaj
csciqjmumcgjgygqmjqaqkcjacaesjkekyijugusyjeiemoj
plphfkznzbvkjpjvlktrtpbkdtdjrknvndhkhzhrnkrbrldk
bdbftklflzjkvhvtzkfjfnpkqmqiglaoacwlkqkwmlusuqcl
euekslowoeiliaisolscsmelcecgulmgmaklwiwualgkgoql
rnrjhmbpbdxmlrlxnmvtvrdmfvfltmpxpfjmjbjtpmtdtnfm
dfdhvmnhnblmxjxvbmhlhprmsoskincqceynmsmyonwuwsen
gwgmunqyqgknkckuqnueuognegeiwnoiocmnykywcnimiqsn

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: soskin
Cipher: fbfxva

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: soskin
Cipher: 344334524233

Extended Methods:
Method #1

Plaintext: soskin
method variations:
xtxposcycutxhdhzycninedh

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s o s k i n 
3 4 3 5 4 3 
4 3 4 2 2 3 
They are then read out in rows:
343543434223
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: soskin
Cipher: sxooim

Read more ...
Method #3

Plaintext: soskin
method variations:
tnyrmn nyrmnt yrmntn
rmntny mntnyr ntnyrm

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: soskin

all 720 cipher variations:
soskin soskni sosikn sosink sosnik sosnki soksin soksni sokisn sokins soknis
soknsi soiksn soikns soiskn soisnk soinsk soinks sonkis sonksi soniks sonisk
sonsik sonski ssokin ssokni ssoikn ssoink ssonik ssonki sskoin sskoni sskion
sskino ssknio ssknoi ssikon ssikno ssiokn ssionk ssinok ssinko ssnkio ssnkoi
ssniko ssniok ssnoik ssnoki sksoin sksoni sksion sksino sksnio sksnoi skosin
skosni skoisn skoins skonis skonsi skiosn skions skison skisno skinso skinos
sknois sknosi sknios skniso sknsio sknsoi siskon siskno sisokn sisonk sisnok
sisnko sikson siksno sikosn sikons siknos siknso sioksn siokns sioskn siosnk
sionsk sionks sinkos sinkso sinoks sinosk sinsok sinsko snskio snskoi snsiko
snsiok snsoik snsoki snksio snksoi snkiso snkios snkois snkosi snikso snikos
snisko snisok sniosk snioks snokis snoksi snoiks snoisk snosik snoski osskin
osskni ossikn ossink ossnik ossnki osksin osksni oskisn oskins osknis osknsi
osiksn osikns osiskn osisnk osinsk osinks osnkis osnksi osniks osnisk osnsik
osnski osskin osskni ossikn ossink ossnik ossnki osksin osksni oskisn oskins
osknis osknsi osiksn osikns osiskn osisnk osinsk osinks osnkis osnksi osniks
osnisk osnsik osnski okssin okssni oksisn oksins oksnis oksnsi okssin okssni
oksisn oksins oksnis oksnsi okissn okisns okissn okisns okinss okinss oknsis
oknssi okniss okniss oknsis oknssi oisksn oiskns oisskn oissnk oisnsk oisnks
oikssn oiksns oikssn oiksns oiknss oiknss oisksn oiskns oisskn oissnk oisnsk
oisnks oinkss oinkss oinsks oinssk oinssk oinsks onskis onsksi onsiks onsisk
onssik onsski onksis onkssi onkiss onkiss onksis onkssi onikss onikss onisks
onissk onissk onisks onskis onsksi onsiks onsisk onssik onsski soskin soskni
sosikn sosink sosnik sosnki soksin soksni sokisn sokins soknis soknsi soiksn
soikns soiskn soisnk soinsk soinks sonkis sonksi soniks sonisk sonsik sonski
ssokin ssokni ssoikn ssoink ssonik ssonki sskoin sskoni sskion sskino ssknio
ssknoi ssikon ssikno ssiokn ssionk ssinok ssinko ssnkio ssnkoi ssniko ssniok
ssnoik ssnoki sksoin sksoni sksion sksino sksnio sksnoi skosin skosni skoisn
skoins skonis skonsi skiosn skions skison skisno skinso skinos sknois sknosi
sknios skniso sknsio sknsoi siskon siskno sisokn sisonk sisnok sisnko sikson
siksno sikosn sikons siknos siknso sioksn siokns sioskn siosnk sionsk sionks
sinkos sinkso sinoks sinosk sinsok sinsko snskio snskoi snsiko snsiok snsoik
snsoki snksio snksoi snkiso snkios snkois snkosi snikso snikos snisko snisok
sniosk snioks snokis snoksi snoiks snoisk snosik snoski kossin kossni kosisn
kosins kosnis kosnsi kossin kossni kosisn kosins kosnis kosnsi koissn koisns
koissn koisns koinss koinss konsis konssi koniss koniss konsis konssi ksosin
ksosni ksoisn ksoins ksonis ksonsi kssoin kssoni kssion kssino kssnio kssnoi
ksison ksisno ksiosn ksions ksinos ksinso ksnsio ksnsoi ksniso ksnios ksnois
ksnosi kssoin kssoni kssion kssino kssnio kssnoi ksosin ksosni ksoisn ksoins
ksonis ksonsi ksiosn ksions ksison ksisno ksinso ksinos ksnois ksnosi ksnios
ksniso ksnsio ksnsoi kisson kissno kisosn kisons kisnos kisnso kisson kissno
kisosn kisons kisnos kisnso kiossn kiosns kiossn kiosns kionss kionss kinsos
kinsso kinoss kinoss kinsos kinsso knssio knssoi knsiso knsios knsois knsosi
knssio knssoi knsiso knsios knsois knsosi knisso knisos knisso knisos knioss
knioss knosis knossi knoiss knoiss knosis knossi iosksn ioskns iosskn iossnk
iosnsk iosnks iokssn ioksns iokssn ioksns ioknss ioknss iosksn ioskns iosskn
iossnk iosnsk iosnks ionkss ionkss ionsks ionssk ionssk ionsks isoksn isokns
isoskn isosnk isonsk isonks iskosn iskons iskson isksno isknso isknos isskon
isskno issokn issonk issnok issnko isnkso isnkos isnsko isnsok isnosk isnoks
iksosn iksons iksson ikssno iksnso iksnos ikossn ikosns ikossn ikosns ikonss
ikonss iksosn iksons iksson ikssno iksnso iksnos iknoss iknoss iknsos iknsso
iknsso iknsos isskon isskno issokn issonk issnok issnko iskson isksno iskosn
iskons isknos isknso isoksn isokns isoskn isosnk isonsk isonks isnkos isnkso
isnoks isnosk isnsok isnsko inskso inskos inssko inssok insosk insoks inksso
inksos inksso inksos inkoss inkoss inskso inskos inssko inssok insosk insoks
inokss inokss inosks inossk inossk inosks noskis nosksi nosiks nosisk nossik
nosski noksis nokssi nokiss nokiss noksis nokssi noikss noikss noisks noissk
noissk noisks noskis nosksi nosiks nosisk nossik nosski nsokis nsoksi nsoiks
nsoisk nsosik nsoski nskois nskosi nskios nskiso nsksio nsksoi nsikos nsikso
nsioks nsiosk nsisok nsisko nsskio nsskoi nssiko nssiok nssoik nssoki nksois
nksosi nksios nksiso nkssio nkssoi nkosis nkossi nkoiss nkoiss nkosis nkossi
nkioss nkioss nkisos nkisso nkisso nkisos nksois nksosi nksios nksiso nkssio
nkssoi niskos niskso nisoks nisosk nissok nissko niksos niksso nikoss nikoss
niksos niksso niokss niokss niosks niossk niossk niosks niskos niskso nisoks
nisosk nissok nissko nsskio nsskoi nssiko nssiok nssoik nssoki nsksio nsksoi
nskiso nskios nskois nskosi nsikso nsikos nsisko nsisok nsiosk nsioks nsokis
nsoksi nsoiks nsoisk nsosik nsoski

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us