easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

bbusse

orgonasova

millonario

ancepsque

infirmatio

circumoral

canoewood

catamountain

beblooding

stoze

pseudomonas

torpors

reactivities

anteocular

gregos

settles

goalmouth

laafb


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: sollicitoque
cipher variations:
tpmmjdjuprvf uqnnkekvqswg vroolflwrtxh wsppmgmxsuyi xtqqnhnytvzj
yurroiozuwak zvsspjpavxbl awttqkqbwycm bxuurlrcxzdn cyvvsmsdyaeo
dzwwtntezbfp eaxxuoufacgq fbyyvpvgbdhr gczzwqwhceis hdaaxrxidfjt
iebbysyjegku jfccztzkfhlv kgddaualgimw lheebvbmhjnx miffcwcnikoy
njggdxdojlpz okhheyepkmqa pliifzfqlnrb qmjjgagrmosc rnkkhbhsnptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: sollicitoque
Cipher: hloorxrgljfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: sollicitoque
Cipher: BAAAB ABBAB ABABA ABABA ABAAA AAABA ABAAA BAABA ABBAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: sollicitoque
cipher variations:
tpmmjdjuprvfdriizhzgrxjnnteeplpstdxvxvaafpfevjldhxwwvtvqxpzlrzsslxlczvntldkkrfradhpjvfgghjhmfndr
fhccxnxyhtrzpjyynrnkjzfhzluudvdwlftpjnqqtztinlhxuqnnkekvqswgesjjaiahsykoouffqmqtueywywbbgqgfwkme
iyxxwuwryqamsattmymdawoumellsgsbeiqkwghhikingoesgiddyoyziusaqkzzosolkagiamvvewexmguqkorruaujomiy
vroolflwrtxhftkkbjbitzlppvggrnruvfzxzxcchrhgxlnfjzyyxvxszrbntbuunznebxpvnfmmthtcfjrlxhiijljohpft
hjeezpzajvtbrlaaptpmlbhjbnwwfxfynhvrlpssvbvkpnjzwsppmgmxsuyigullckcjuamqqwhhsosvwgayayddisihymog
kazzywytascoucvvoaofcyqwognnuiudgksmyijjkmkpiqguikffaqabkwucsmbbquqnmcikcoxxgygzoiwsmqttwcwlqoka
xtqqnhnytvzjhvmmdldkvbnrrxiitptwxhbzbzeejtjiznphlbaazxzubtdpvdwwpbpgdzrxphoovjvehltnzjkklnlqjrhv
jlggbrbclxvdtnccrvrondjldpyyhzhapjxtnruuxdxmrplbyurroiozuwakiwnnemelwcossyjjuquxyicacaffkukjaoqi
mcbbayavcueqwexxqcqheasyqippwkwfimuoakllmomrksiwkmhhcscdmyweuoddswspoekmeqzziaibqkyuosvvyeynsqmc
zvsspjpavxbljxoofnfmxdpttzkkvrvyzjdbdbgglvlkbprjndccbzbwdvfrxfyyrdrifbtzrjqqxlxgjnvpblmmnpnsltjx
lniidtdenzxfvpeetxtqpflnfraajbjcrlzvptwwzfzotrndawttqkqbwycmkyppgognyequuallwswzakecechhmwmlcqsk
oeddcacxewgsygzzsesjgcuaskrrymyhkowqcmnnoqotmukymojjeuefoaygwqffuyurqgmogsbbkckdsmawquxxagapusoe
bxuurlrcxzdnlzqqhphozfrvvbmmxtxablfdfdiinxnmdrtlpfeedbdyfxhtzhaatftkhdvbtlssznzilpxrdnooprpunvlz
npkkfvfgpbzhxrggvzvsrhnphtccldletnbxrvyybhbqvtpfcyvvsmsdyaeomarriqipagswwcnnyuybcmgegejjoyonesum
qgffecezgyiuaibbuguliewcumttaoajmqyseoppqsqvowmaoqllgwghqcaiyshhwawtsioqiuddmemfuocyswzzcicrwuqg
dzwwtntezbfpnbssjrjqbhtxxdoozvzcdnhfhfkkpzpoftvnrhggfdfahzjvbjccvhvmjfxdvnuubpbknrztfpqqrtrwpxnb
prmmhxhirdbjztiixbxutjprjveenfngvpdztxaadjdsxvrheaxxuoufacgqocttkskrciuyyeppawadeoigigllqaqpguwo
sihhgegbiakwckddwiwnkgyewovvcqclosaugqrrsusxqyocqsnniyijseckaujjycyvukqskwffogohwqeauybbeketywsi
fbyyvpvgbdhrpduultlsdjvzzfqqbxbefpjhjhmmrbrqhvxptjiihfhcjblxdleexjxolhzfxpwwdrdmptbvhrsstvtyrzpd
rtoojzjktfdlbvkkzdzwvlrtlxggphpixrfbvzccflfuzxtjgczzwqwhceisqevvmumtekwaagrrcycfgqkikinnscsriwyq
ukjjigidkcmyemffykypmiagyqxxesenqucwisttuwuzsaqesuppkaklugemcwllaeaxwmsumyhhqiqjysgcwaddgmgvayuk
hdaaxrxidfjtrfwwnvnuflxbbhssdzdghrljljootdtsjxzrvlkkjhjeldnzfnggzlzqnjbhzryyftforvdxjtuuvxvatbrf
tvqqlblmvhfndxmmbfbyxntvnziirjrkzthdxbeehnhwbzvliebbysyjegkusgxxowovgmyccitteaehismkmkppueutkyas
wmllkikfmeoagohhamarokciaszzgugpsweykuvvwywbucsguwrrmcmnwigoeynncgczyouwoajjskslauieycffioixcawm
jfccztzkfhlvthyypxpwhnzddjuufbfijtnlnlqqvfvulzbtxnmmljlgnfpbhpiibnbspldjbtaahvhqtxfzlvwwxzxcvdth
vxssndnoxjhpfzoodhdazpvxpbkktltmbvjfzdggjpjydbxnkgddaualgimwuizzqyqxioaeekvvgcgjkuomomrrwgwvmacu
yonnmkmhogqciqjjcoctqmekcubbiwiruygamwxxyaydweuiwyttoeopykiqgappeiebaqwyqcllumuncwkgaehhkqkzecyo
lheebvbmhjnxvjaarzryjpbfflwwhdhklvpnpnssxhxwnbdvzpoonlniphrdjrkkdpdurnfldvccjxjsvzhbnxyyzbzexfvj
xzuupfpqzljrhbqqfjfcbrxzrdmmvnvodxlhbfiilrlafdzpmiffcwcnikoywkbbsaszkqcggmxxieilmwqoqottyiyxocew
aqppomojqisekslleqevsogmewddkyktwaicoyzzacafygwkyavvqgqramksicrrgkgdcsyasennwowpeymicgjjmsmbgeaq
njggdxdojlpzxlcctbtalrdhhnyyjfjmnxrprpuuzjzypdfxbrqqpnpkrjtfltmmfrfwtphnfxeelzluxbjdpzaabdbgzhxl
zbwwrhrsbnltjdsshlhedtzbtfooxpxqfznjdhkkntnchfbrokhheyepkmqaymdducubmseiiozzkgknoysqsqvvakazqegy
csrrqoqlskugmunngsgxuqiogyffmamvyckeqabbcechaiymacxxsistcomukettimifeuacugppyqyrgaokeillouodigcs
pliifzfqlnrbzneevdvcntfjjpaalhlopztrtrwwblbarfhzdtssrprmtlvhnvoohthyvrjphzggnbnwzdlfrbccdfdibjzn
bdyytjtudpnvlfuujnjgfvbdvhqqzrzshbplfjmmpvpejhdtqmjjgagrmoscaoffwewdougkkqbbmimpqaususxxcmcbsgia
euttsqsnumwiowppiuizwskqiahhocoxaemgscddegejckaocezzukuveqowmgvvkokhgwcewirrasaticqmgknnqwqfkieu
rnkkhbhsnptdbpggxfxepvhllrccnjnqrbvtvtyydndcthjbfvuutrtovnxjpxqqjvjaxtlrjbiipdpybfnhtdeefhfkdlbp
dfaavlvwfrpxnhwwlplihxdfxjssbtbujdrnhloorxrgljfvsollicitoquecqhhygyfqwimmsddokorscwuwuzzeoeduikc
gwvvusupwoykqyrrkwkbyumskcjjqeqzcgoiueffgiglemcqegbbwmwxgsqyoixxmqmjiyegykttcucvkesoimppsyshmkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: sollicitoque
Cipher: fbyyvpvgbdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: sollicitoque
Cipher: 344313134231424443145451

Extended Methods:
Method #1

Plaintext: sollicitoque
method variations:
xtqqohoytvzkcyvvtntdyaephdaaysyidfkuniffdxdoilpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s o l l i c i t o q u e 
3 4 1 1 4 3 4 4 4 1 5 5 
4 3 3 3 2 1 2 4 3 4 4 1 
They are then read out in rows:
341143444155433321243441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: sollicitoque
Cipher: saotdzonbrsd

Read more ...
Method #3

Plaintext: sollicitoque
method variations:
tccsmqrtcyyl ccsmqrtcyylt csmqrtcyyltc
smqrtcyyltcc mqrtcyyltccs qrtcyyltccsm
rtcyyltccsmq tcyyltccsmqr cyyltccsmqrt
yyltccsmqrtc yltccsmqrtcy ltccsmqrtcyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: sollicitoque

first 5040 cipher variations(475687488 total)
sollicitoque sollicitoqeu sollicitouqe sollicitoueq sollicitoeuq sollicitoequ sollicitqoue sollicitqoeu sollicitquoe
sollicitqueo sollicitqeuo sollicitqeou sollicituqoe sollicituqeo sollicituoqe sollicituoeq sollicitueoq sollicitueqo
sollicitequo solliciteqou solliciteuqo solliciteuoq solliciteouq solliciteoqu solliciotque solliciotqeu solliciotuqe
solliciotueq sollicioteuq solliciotequ sollicioqtue sollicioqteu sollicioqute sollicioquet sollicioqeut sollicioqetu
solliciouqte solliciouqet sollicioutqe solliciouteq solliciouetq sollicioueqt sollicioequt sollicioeqtu sollicioeuqt
sollicioeutq sollicioetuq sollicioetqu solliciqotue solliciqoteu solliciqoute solliciqouet solliciqoeut solliciqoetu
solliciqtoue solliciqtoeu solliciqtuoe solliciqtueo solliciqteuo solliciqteou solliciqutoe solliciquteo solliciquote
solliciquoet solliciqueot solliciqueto solliciqetuo solliciqetou solliciqeuto solliciqeuot solliciqeout solliciqeotu
solliciuoqte solliciuoqet solliciuotqe solliciuoteq solliciuoetq solliciuoeqt solliciuqote solliciuqoet solliciuqtoe
solliciuqteo solliciuqeto solliciuqeot solliciutqoe solliciutqeo solliciutoqe solliciutoeq solliciuteoq solliciuteqo
solliciueqto solliciueqot solliciuetqo solliciuetoq solliciueotq solliciueoqt sollicieoqut sollicieoqtu sollicieouqt
sollicieoutq sollicieotuq sollicieotqu sollicieqout sollicieqotu solliciequot solliciequto sollicieqtuo sollicieqtou
sollicieuqot sollicieuqto sollicieuoqt sollicieuotq sollicieutoq sollicieutqo sollicietquo sollicietqou sollicietuqo
sollicietuoq sollicietouq sollicietoqu sollictioque sollictioqeu sollictiouqe sollictioueq sollictioeuq sollictioequ
sollictiqoue sollictiqoeu sollictiquoe sollictiqueo sollictiqeuo sollictiqeou sollictiuqoe sollictiuqeo sollictiuoqe
sollictiuoeq sollictiueoq sollictiueqo sollictiequo sollictieqou sollictieuqo sollictieuoq sollictieouq sollictieoqu
sollictoique sollictoiqeu sollictoiuqe sollictoiueq sollictoieuq sollictoiequ sollictoqiue sollictoqieu sollictoquie
sollictoquei sollictoqeui sollictoqeiu sollictouqie sollictouqei sollictouiqe sollictouieq sollictoueiq sollictoueqi
sollictoequi sollictoeqiu sollictoeuqi sollictoeuiq sollictoeiuq sollictoeiqu sollictqoiue sollictqoieu sollictqouie
sollictqouei sollictqoeui sollictqoeiu sollictqioue sollictqioeu sollictqiuoe sollictqiueo sollictqieuo sollictqieou
sollictquioe sollictquieo sollictquoie sollictquoei sollictqueoi sollictqueio sollictqeiuo sollictqeiou sollictqeuio
sollictqeuoi sollictqeoui sollictqeoiu sollictuoqie sollictuoqei sollictuoiqe sollictuoieq sollictuoeiq sollictuoeqi
sollictuqoie sollictuqoei sollictuqioe sollictuqieo sollictuqeio sollictuqeoi sollictuiqoe sollictuiqeo sollictuioqe
sollictuioeq sollictuieoq sollictuieqo sollictueqio sollictueqoi sollictueiqo sollictueioq sollictueoiq sollictueoqi
sollicteoqui sollicteoqiu sollicteouqi sollicteouiq sollicteoiuq sollicteoiqu sollicteqoui sollicteqoiu sollictequoi
sollictequio sollicteqiuo sollicteqiou sollicteuqoi sollicteuqio sollicteuoqi sollicteuoiq sollicteuioq sollicteuiqo
sollicteiquo sollicteiqou sollicteiuqo sollicteiuoq sollicteiouq sollicteioqu sollicotique sollicotiqeu sollicotiuqe
sollicotiueq sollicotieuq sollicotiequ sollicotqiue sollicotqieu sollicotquie sollicotquei sollicotqeui sollicotqeiu
sollicotuqie sollicotuqei sollicotuiqe sollicotuieq sollicotueiq sollicotueqi sollicotequi sollicoteqiu sollicoteuqi
sollicoteuiq sollicoteiuq sollicoteiqu sollicoitque sollicoitqeu sollicoituqe sollicoitueq sollicoiteuq sollicoitequ
sollicoiqtue sollicoiqteu sollicoiqute sollicoiquet sollicoiqeut sollicoiqetu sollicoiuqte sollicoiuqet sollicoiutqe
sollicoiuteq sollicoiuetq sollicoiueqt sollicoiequt sollicoieqtu sollicoieuqt sollicoieutq sollicoietuq sollicoietqu
sollicoqitue sollicoqiteu sollicoqiute sollicoqiuet sollicoqieut sollicoqietu sollicoqtiue sollicoqtieu sollicoqtuie
sollicoqtuei sollicoqteui sollicoqteiu sollicoqutie sollicoqutei sollicoquite sollicoquiet sollicoqueit sollicoqueti
sollicoqetui sollicoqetiu sollicoqeuti sollicoqeuit sollicoqeiut sollicoqeitu sollicouiqte sollicouiqet sollicouitqe
sollicouiteq sollicouietq sollicouieqt sollicouqite sollicouqiet sollicouqtie sollicouqtei sollicouqeti sollicouqeit
sollicoutqie sollicoutqei sollicoutiqe sollicoutieq sollicouteiq sollicouteqi sollicoueqti sollicoueqit sollicouetqi
sollicouetiq sollicoueitq sollicoueiqt sollicoeiqut sollicoeiqtu sollicoeiuqt sollicoeiutq sollicoeituq sollicoeitqu
sollicoeqiut sollicoeqitu sollicoequit sollicoequti sollicoeqtui sollicoeqtiu sollicoeuqit sollicoeuqti sollicoeuiqt
sollicoeuitq sollicoeutiq sollicoeutqi sollicoetqui sollicoetqiu sollicoetuqi sollicoetuiq sollicoetiuq sollicoetiqu
sollicqtoiue sollicqtoieu sollicqtouie sollicqtouei sollicqtoeui sollicqtoeiu sollicqtioue sollicqtioeu sollicqtiuoe
sollicqtiueo sollicqtieuo sollicqtieou sollicqtuioe sollicqtuieo sollicqtuoie sollicqtuoei sollicqtueoi sollicqtueio
sollicqteiuo sollicqteiou sollicqteuio sollicqteuoi sollicqteoui sollicqteoiu sollicqotiue sollicqotieu sollicqotuie
sollicqotuei sollicqoteui sollicqoteiu sollicqoitue sollicqoiteu sollicqoiute sollicqoiuet sollicqoieut sollicqoietu
sollicqouite sollicqouiet sollicqoutie sollicqoutei sollicqoueti sollicqoueit sollicqoeiut sollicqoeitu sollicqoeuit
sollicqoeuti sollicqoetui sollicqoetiu sollicqiotue sollicqioteu sollicqioute sollicqiouet sollicqioeut sollicqioetu
sollicqitoue sollicqitoeu sollicqituoe sollicqitueo sollicqiteuo sollicqiteou sollicqiutoe sollicqiuteo sollicqiuote
sollicqiuoet sollicqiueot sollicqiueto sollicqietuo sollicqietou sollicqieuto sollicqieuot sollicqieout sollicqieotu
sollicquoite sollicquoiet sollicquotie sollicquotei sollicquoeti sollicquoeit sollicquiote sollicquioet sollicquitoe
sollicquiteo sollicquieto sollicquieot sollicqutioe sollicqutieo sollicqutoie sollicqutoei sollicquteoi sollicquteio
sollicqueito sollicqueiot sollicquetio sollicquetoi sollicqueoti sollicqueoit sollicqeoiut sollicqeoitu sollicqeouit
sollicqeouti sollicqeotui sollicqeotiu sollicqeiout sollicqeiotu sollicqeiuot sollicqeiuto sollicqeituo sollicqeitou
sollicqeuiot sollicqeuito sollicqeuoit sollicqeuoti sollicqeutoi sollicqeutio sollicqetiuo sollicqetiou sollicqetuio
sollicqetuoi sollicqetoui sollicqetoiu sollicutoqie sollicutoqei sollicutoiqe sollicutoieq sollicutoeiq sollicutoeqi
sollicutqoie sollicutqoei sollicutqioe sollicutqieo sollicutqeio sollicutqeoi sollicutiqoe sollicutiqeo sollicutioqe
sollicutioeq sollicutieoq sollicutieqo sollicuteqio sollicuteqoi sollicuteiqo sollicuteioq sollicuteoiq sollicuteoqi
sollicuotqie sollicuotqei sollicuotiqe sollicuotieq sollicuoteiq sollicuoteqi sollicuoqtie sollicuoqtei sollicuoqite
sollicuoqiet sollicuoqeit sollicuoqeti sollicuoiqte sollicuoiqet sollicuoitqe sollicuoiteq sollicuoietq sollicuoieqt
sollicuoeqit sollicuoeqti sollicuoeiqt sollicuoeitq sollicuoetiq sollicuoetqi sollicuqotie sollicuqotei sollicuqoite
sollicuqoiet sollicuqoeit sollicuqoeti sollicuqtoie sollicuqtoei sollicuqtioe sollicuqtieo sollicuqteio sollicuqteoi
sollicuqitoe sollicuqiteo sollicuqiote sollicuqioet sollicuqieot sollicuqieto sollicuqetio sollicuqetoi sollicuqeito
sollicuqeiot sollicuqeoit sollicuqeoti sollicuioqte sollicuioqet sollicuiotqe sollicuioteq sollicuioetq sollicuioeqt
sollicuiqote sollicuiqoet sollicuiqtoe sollicuiqteo sollicuiqeto sollicuiqeot sollicuitqoe sollicuitqeo sollicuitoqe
sollicuitoeq sollicuiteoq sollicuiteqo sollicuieqto sollicuieqot sollicuietqo sollicuietoq sollicuieotq sollicuieoqt
sollicueoqit sollicueoqti sollicueoiqt sollicueoitq sollicueotiq sollicueotqi sollicueqoit sollicueqoti sollicueqiot
sollicueqito sollicueqtio sollicueqtoi sollicueiqot sollicueiqto sollicueioqt sollicueiotq sollicueitoq sollicueitqo
sollicuetqio sollicuetqoi sollicuetiqo sollicuetioq sollicuetoiq sollicuetoqi sollicetoqui sollicetoqiu sollicetouqi
sollicetouiq sollicetoiuq sollicetoiqu sollicetqoui sollicetqoiu sollicetquoi sollicetquio sollicetqiuo sollicetqiou
sollicetuqoi sollicetuqio sollicetuoqi sollicetuoiq sollicetuioq sollicetuiqo sollicetiquo sollicetiqou sollicetiuqo
sollicetiuoq sollicetiouq sollicetioqu solliceotqui solliceotqiu solliceotuqi solliceotuiq solliceotiuq solliceotiqu
solliceoqtui solliceoqtiu solliceoquti solliceoquit solliceoqiut solliceoqitu solliceouqti solliceouqit solliceoutqi
solliceoutiq solliceouitq solliceouiqt solliceoiqut solliceoiqtu solliceoiuqt solliceoiutq solliceoituq solliceoitqu
solliceqotui solliceqotiu solliceqouti solliceqouit solliceqoiut solliceqoitu solliceqtoui solliceqtoiu solliceqtuoi
solliceqtuio solliceqtiuo solliceqtiou sollicequtoi sollicequtio sollicequoti sollicequoit sollicequiot sollicequito
solliceqituo solliceqitou solliceqiuto solliceqiuot solliceqiout solliceqiotu solliceuoqti solliceuoqit solliceuotqi
solliceuotiq solliceuoitq solliceuoiqt solliceuqoti solliceuqoit solliceuqtoi solliceuqtio solliceuqito solliceuqiot
solliceutqoi solliceutqio solliceutoqi solliceutoiq solliceutioq solliceutiqo solliceuiqto solliceuiqot solliceuitqo
solliceuitoq solliceuiotq solliceuioqt solliceioqut solliceioqtu solliceiouqt solliceioutq solliceiotuq solliceiotqu
solliceiqout solliceiqotu solliceiquot solliceiquto solliceiqtuo solliceiqtou solliceiuqot solliceiuqto solliceiuoqt
solliceiuotq solliceiutoq solliceiutqo solliceitquo solliceitqou solliceituqo solliceituoq solliceitouq solliceitoqu
solliictoque solliictoqeu solliictouqe solliictoueq solliictoeuq solliictoequ solliictqoue solliictqoeu solliictquoe
solliictqueo solliictqeuo solliictqeou solliictuqoe solliictuqeo solliictuoqe solliictuoeq solliictueoq solliictueqo
solliictequo solliicteqou solliicteuqo solliicteuoq solliicteouq solliicteoqu solliicotque solliicotqeu solliicotuqe
solliicotueq solliicoteuq solliicotequ solliicoqtue solliicoqteu solliicoqute solliicoquet solliicoqeut solliicoqetu
solliicouqte solliicouqet solliicoutqe solliicouteq solliicouetq solliicoueqt solliicoequt solliicoeqtu solliicoeuqt
solliicoeutq solliicoetuq solliicoetqu solliicqotue solliicqoteu solliicqoute solliicqouet solliicqoeut solliicqoetu
solliicqtoue solliicqtoeu solliicqtuoe solliicqtueo solliicqteuo solliicqteou solliicqutoe solliicquteo solliicquote
solliicquoet solliicqueot solliicqueto solliicqetuo solliicqetou solliicqeuto solliicqeuot solliicqeout solliicqeotu
solliicuoqte solliicuoqet solliicuotqe solliicuoteq solliicuoetq solliicuoeqt solliicuqote solliicuqoet solliicuqtoe
solliicuqteo solliicuqeto solliicuqeot solliicutqoe solliicutqeo solliicutoqe solliicutoeq solliicuteoq solliicuteqo
solliicueqto solliicueqot solliicuetqo solliicuetoq solliicueotq solliicueoqt solliiceoqut solliiceoqtu solliiceouqt
solliiceoutq solliiceotuq solliiceotqu solliiceqout solliiceqotu solliicequot solliicequto solliiceqtuo solliiceqtou
solliiceuqot solliiceuqto solliiceuoqt solliiceuotq solliiceutoq solliiceutqo solliicetquo solliicetqou solliicetuqo
solliicetuoq solliicetouq solliicetoqu solliitcoque solliitcoqeu solliitcouqe solliitcoueq solliitcoeuq solliitcoequ
solliitcqoue solliitcqoeu solliitcquoe solliitcqueo solliitcqeuo solliitcqeou solliitcuqoe solliitcuqeo solliitcuoqe
solliitcuoeq solliitcueoq solliitcueqo solliitcequo solliitceqou solliitceuqo solliitceuoq solliitceouq solliitceoqu
solliitocque solliitocqeu solliitocuqe solliitocueq solliitoceuq solliitocequ solliitoqcue solliitoqceu solliitoquce
solliitoquec solliitoqeuc solliitoqecu solliitouqce solliitouqec solliitoucqe solliitouceq solliitouecq solliitoueqc
solliitoequc solliitoeqcu solliitoeuqc solliitoeucq solliitoecuq solliitoecqu solliitqocue solliitqoceu solliitqouce
solliitqouec solliitqoeuc solliitqoecu solliitqcoue solliitqcoeu solliitqcuoe solliitqcueo solliitqceuo solliitqceou
solliitqucoe solliitquceo solliitquoce solliitquoec solliitqueoc solliitqueco solliitqecuo solliitqecou solliitqeuco
solliitqeuoc solliitqeouc solliitqeocu solliituoqce solliituoqec solliituocqe solliituoceq solliituoecq solliituoeqc
solliituqoce solliituqoec solliituqcoe solliituqceo solliituqeco solliituqeoc solliitucqoe solliitucqeo solliitucoqe
solliitucoeq solliituceoq solliituceqo solliitueqco solliitueqoc solliituecqo solliituecoq solliitueocq solliitueoqc
solliiteoquc solliiteoqcu solliiteouqc solliiteoucq solliiteocuq solliiteocqu solliiteqouc solliiteqocu solliitequoc
solliitequco solliiteqcuo solliiteqcou solliiteuqoc solliiteuqco solliiteuoqc solliiteuocq solliiteucoq solliiteucqo
solliitecquo solliitecqou solliitecuqo solliitecuoq solliitecouq solliitecoqu solliiotcque solliiotcqeu solliiotcuqe
solliiotcueq solliiotceuq solliiotcequ solliiotqcue solliiotqceu solliiotquce solliiotquec solliiotqeuc solliiotqecu
solliiotuqce solliiotuqec solliiotucqe solliiotuceq solliiotuecq solliiotueqc solliiotequc solliioteqcu solliioteuqc
solliioteucq solliiotecuq solliiotecqu solliioctque solliioctqeu solliioctuqe solliioctueq solliiocteuq solliioctequ
solliiocqtue solliiocqteu solliiocqute solliiocquet solliiocqeut solliiocqetu solliiocuqte solliiocuqet solliiocutqe
solliiocuteq solliiocuetq solliiocueqt solliiocequt solliioceqtu solliioceuqt solliioceutq solliiocetuq solliiocetqu
solliioqctue solliioqcteu solliioqcute solliioqcuet solliioqceut solliioqcetu solliioqtcue solliioqtceu solliioqtuce
solliioqtuec solliioqteuc solliioqtecu solliioqutce solliioqutec solliioqucte solliioqucet solliioquect solliioquetc
solliioqetuc solliioqetcu solliioqeutc solliioqeuct solliioqecut solliioqectu solliioucqte solliioucqet solliiouctqe
solliioucteq solliioucetq solliiouceqt solliiouqcte solliiouqcet solliiouqtce solliiouqtec solliiouqetc solliiouqect
solliioutqce solliioutqec solliioutcqe solliioutceq solliioutecq solliiouteqc solliioueqtc solliioueqct solliiouetqc
solliiouetcq solliiouectq solliiouecqt solliioecqut solliioecqtu solliioecuqt solliioecutq solliioectuq solliioectqu
solliioeqcut solliioeqctu solliioequct solliioequtc solliioeqtuc solliioeqtcu solliioeuqct solliioeuqtc solliioeucqt
solliioeuctq solliioeutcq solliioeutqc solliioetquc solliioetqcu solliioetuqc solliioetucq solliioetcuq solliioetcqu
solliiqtocue solliiqtoceu solliiqtouce solliiqtouec solliiqtoeuc solliiqtoecu solliiqtcoue solliiqtcoeu solliiqtcuoe
solliiqtcueo solliiqtceuo solliiqtceou solliiqtucoe solliiqtuceo solliiqtuoce solliiqtuoec solliiqtueoc solliiqtueco
solliiqtecuo solliiqtecou solliiqteuco solliiqteuoc solliiqteouc solliiqteocu solliiqotcue solliiqotceu solliiqotuce
solliiqotuec solliiqoteuc solliiqotecu solliiqoctue solliiqocteu solliiqocute solliiqocuet solliiqoceut solliiqocetu
solliiqoucte solliiqoucet solliiqoutce solliiqoutec solliiqouetc solliiqouect solliiqoecut solliiqoectu solliiqoeuct
solliiqoeutc solliiqoetuc solliiqoetcu solliiqcotue solliiqcoteu solliiqcoute solliiqcouet solliiqcoeut solliiqcoetu
solliiqctoue solliiqctoeu solliiqctuoe solliiqctueo solliiqcteuo solliiqcteou solliiqcutoe solliiqcuteo solliiqcuote
solliiqcuoet solliiqcueot solliiqcueto solliiqcetuo solliiqcetou solliiqceuto solliiqceuot solliiqceout solliiqceotu
solliiquocte solliiquocet solliiquotce solliiquotec solliiquoetc solliiquoect solliiqucote solliiqucoet solliiquctoe
solliiqucteo solliiquceto solliiquceot solliiqutcoe solliiqutceo solliiqutoce solliiqutoec solliiquteoc solliiquteco
solliiquecto solliiquecot solliiquetco solliiquetoc solliiqueotc solliiqueoct solliiqeocut solliiqeoctu solliiqeouct
solliiqeoutc solliiqeotuc solliiqeotcu solliiqecout solliiqecotu solliiqecuot solliiqecuto solliiqectuo solliiqectou
solliiqeucot solliiqeucto solliiqeuoct solliiqeuotc solliiqeutoc solliiqeutco solliiqetcuo solliiqetcou solliiqetuco
solliiqetuoc solliiqetouc solliiqetocu solliiutoqce solliiutoqec solliiutocqe solliiutoceq solliiutoecq solliiutoeqc
solliiutqoce solliiutqoec solliiutqcoe solliiutqceo solliiutqeco solliiutqeoc solliiutcqoe solliiutcqeo solliiutcoqe
solliiutcoeq solliiutceoq solliiutceqo solliiuteqco solliiuteqoc solliiutecqo solliiutecoq solliiuteocq solliiuteoqc
solliiuotqce solliiuotqec solliiuotcqe solliiuotceq solliiuotecq solliiuoteqc solliiuoqtce solliiuoqtec solliiuoqcte
solliiuoqcet solliiuoqect solliiuoqetc solliiuocqte solliiuocqet solliiuoctqe solliiuocteq solliiuocetq solliiuoceqt
solliiuoeqct solliiuoeqtc solliiuoecqt solliiuoectq solliiuoetcq solliiuoetqc solliiuqotce solliiuqotec solliiuqocte
solliiuqocet solliiuqoect solliiuqoetc solliiuqtoce solliiuqtoec solliiuqtcoe solliiuqtceo solliiuqteco solliiuqteoc
solliiuqctoe solliiuqcteo solliiuqcote solliiuqcoet solliiuqceot solliiuqceto solliiuqetco solliiuqetoc solliiuqecto
solliiuqecot solliiuqeoct solliiuqeotc solliiucoqte solliiucoqet solliiucotqe solliiucoteq solliiucoetq solliiucoeqt
solliiucqote solliiucqoet solliiucqtoe solliiucqteo solliiucqeto solliiucqeot solliiuctqoe solliiuctqeo solliiuctoqe
solliiuctoeq solliiucteoq solliiucteqo solliiuceqto solliiuceqot solliiucetqo solliiucetoq solliiuceotq solliiuceoqt
solliiueoqct solliiueoqtc solliiueocqt solliiueoctq solliiueotcq solliiueotqc solliiueqoct solliiueqotc solliiueqcot
solliiueqcto solliiueqtco solliiueqtoc solliiuecqot solliiuecqto solliiuecoqt solliiuecotq solliiuectoq solliiuectqo
solliiuetqco solliiuetqoc solliiuetcqo solliiuetcoq solliiuetocq solliiuetoqc solliietoquc solliietoqcu solliietouqc
solliietoucq solliietocuq solliietocqu solliietqouc solliietqocu solliietquoc solliietquco solliietqcuo solliietqcou
solliietuqoc solliietuqco solliietuoqc solliietuocq solliietucoq solliietucqo solliietcquo solliietcqou solliietcuqo
solliietcuoq solliietcouq solliietcoqu solliieotquc solliieotqcu solliieotuqc solliieotucq solliieotcuq solliieotcqu
solliieoqtuc solliieoqtcu solliieoqutc solliieoquct solliieoqcut solliieoqctu solliieouqtc solliieouqct solliieoutqc
solliieoutcq solliieouctq solliieoucqt solliieocqut solliieocqtu solliieocuqt solliieocutq solliieoctuq solliieoctqu
solliieqotuc solliieqotcu solliieqoutc solliieqouct solliieqocut solliieqoctu solliieqtouc solliieqtocu solliieqtuoc
solliieqtuco solliieqtcuo solliieqtcou solliiequtoc solliiequtco solliiequotc solliiequoct solliiequcot solliiequcto
solliieqctuo solliieqctou solliieqcuto solliieqcuot solliieqcout solliieqcotu solliieuoqtc solliieuoqct solliieuotqc
solliieuotcq solliieuoctq solliieuocqt solliieuqotc solliieuqoct solliieuqtoc solliieuqtco solliieuqcto solliieuqcot
solliieutqoc solliieutqco solliieutoqc solliieutocq solliieutcoq solliieutcqo solliieucqto solliieucqot solliieuctqo
solliieuctoq solliieucotq solliieucoqt solliiecoqut solliiecoqtu solliiecouqt solliiecoutq solliiecotuq solliiecotqu
solliiecqout solliiecqotu solliiecquot solliiecquto solliiecqtuo solliiecqtou solliiecuqot solliiecuqto solliiecuoqt
solliiecuotq solliiecutoq solliiecutqo solliiectquo solliiectqou solliiectuqo solliiectuoq solliiectouq solliiectoqu
solliticoque solliticoqeu solliticouqe solliticoueq solliticoeuq solliticoequ solliticqoue solliticqoeu solliticquoe
solliticqueo solliticqeuo solliticqeou solliticuqoe solliticuqeo solliticuoqe solliticuoeq solliticueoq solliticueqo
solliticequo solliticeqou solliticeuqo solliticeuoq solliticeouq solliticeoqu sollitiocque sollitiocqeu sollitiocuqe
sollitiocueq sollitioceuq sollitiocequ sollitioqcue sollitioqceu sollitioquce sollitioquec sollitioqeuc sollitioqecu
sollitiouqce sollitiouqec sollitioucqe sollitiouceq sollitiouecq sollitioueqc sollitioequc sollitioeqcu sollitioeuqc
sollitioeucq sollitioecuq sollitioecqu sollitiqocue sollitiqoceu sollitiqouce sollitiqouec sollitiqoeuc sollitiqoecu
sollitiqcoue sollitiqcoeu sollitiqcuoe sollitiqcueo sollitiqceuo sollitiqceou sollitiqucoe sollitiquceo sollitiquoce
sollitiquoec sollitiqueoc sollitiqueco sollitiqecuo sollitiqecou sollitiqeuco sollitiqeuoc sollitiqeouc sollitiqeocu
sollitiuoqce sollitiuoqec sollitiuocqe sollitiuoceq sollitiuoecq sollitiuoeqc sollitiuqoce sollitiuqoec sollitiuqcoe
sollitiuqceo sollitiuqeco sollitiuqeoc sollitiucqoe sollitiucqeo sollitiucoqe sollitiucoeq sollitiuceoq sollitiuceqo
sollitiueqco sollitiueqoc sollitiuecqo sollitiuecoq sollitiueocq sollitiueoqc sollitieoquc sollitieoqcu sollitieouqc
sollitieoucq sollitieocuq sollitieocqu sollitieqouc sollitieqocu sollitiequoc sollitiequco sollitieqcuo sollitieqcou
sollitieuqoc sollitieuqco sollitieuoqc sollitieuocq sollitieucoq sollitieucqo sollitiecquo sollitiecqou sollitiecuqo
sollitiecuoq sollitiecouq sollitiecoqu sollitcioque sollitcioqeu sollitciouqe sollitcioueq sollitcioeuq sollitcioequ
sollitciqoue sollitciqoeu sollitciquoe sollitciqueo sollitciqeuo sollitciqeou sollitciuqoe sollitciuqeo sollitciuoqe
sollitciuoeq sollitciueoq sollitciueqo sollitciequo sollitcieqou sollitcieuqo sollitcieuoq sollitcieouq sollitcieoqu
sollitcoique sollitcoiqeu sollitcoiuqe sollitcoiueq sollitcoieuq sollitcoiequ sollitcoqiue sollitcoqieu sollitcoquie
sollitcoquei sollitcoqeui sollitcoqeiu sollitcouqie sollitcouqei sollitcouiqe sollitcouieq sollitcoueiq sollitcoueqi
sollitcoequi sollitcoeqiu sollitcoeuqi sollitcoeuiq sollitcoeiuq sollitcoeiqu sollitcqoiue sollitcqoieu sollitcqouie
sollitcqouei sollitcqoeui sollitcqoeiu sollitcqioue sollitcqioeu sollitcqiuoe sollitcqiueo sollitcqieuo sollitcqieou
sollitcquioe sollitcquieo sollitcquoie sollitcquoei sollitcqueoi sollitcqueio sollitcqeiuo sollitcqeiou sollitcqeuio
sollitcqeuoi sollitcqeoui sollitcqeoiu sollitcuoqie sollitcuoqei sollitcuoiqe sollitcuoieq sollitcuoeiq sollitcuoeqi
sollitcuqoie sollitcuqoei sollitcuqioe sollitcuqieo sollitcuqeio sollitcuqeoi sollitcuiqoe sollitcuiqeo sollitcuioqe
sollitcuioeq sollitcuieoq sollitcuieqo sollitcueqio sollitcueqoi sollitcueiqo sollitcueioq sollitcueoiq sollitcueoqi
sollitceoqui sollitceoqiu sollitceouqi sollitceouiq sollitceoiuq sollitceoiqu sollitceqoui sollitceqoiu sollitcequoi
sollitcequio sollitceqiuo sollitceqiou sollitceuqoi sollitceuqio sollitceuoqi sollitceuoiq sollitceuioq sollitceuiqo
sollitceiquo sollitceiqou sollitceiuqo sollitceiuoq sollitceiouq sollitceioqu sollitocique sollitociqeu sollitociuqe
sollitociueq sollitocieuq sollitociequ sollitocqiue sollitocqieu sollitocquie sollitocquei sollitocqeui sollitocqeiu
sollitocuqie sollitocuqei sollitocuiqe sollitocuieq sollitocueiq sollitocueqi sollitocequi sollitoceqiu sollitoceuqi
sollitoceuiq sollitoceiuq sollitoceiqu sollitoicque sollitoicqeu sollitoicuqe sollitoicueq sollitoiceuq sollitoicequ
sollitoiqcue sollitoiqceu sollitoiquce sollitoiquec sollitoiqeuc sollitoiqecu sollitoiuqce sollitoiuqec sollitoiucqe
sollitoiuceq sollitoiuecq sollitoiueqc sollitoiequc sollitoieqcu sollitoieuqc sollitoieucq sollitoiecuq sollitoiecqu
sollitoqicue sollitoqiceu sollitoqiuce sollitoqiuec sollitoqieuc sollitoqiecu sollitoqciue sollitoqcieu sollitoqcuie
sollitoqcuei sollitoqceui sollitoqceiu sollitoqucie sollitoqucei sollitoquice sollitoquiec sollitoqueic sollitoqueci
sollitoqecui sollitoqeciu sollitoqeuci sollitoqeuic sollitoqeiuc sollitoqeicu sollitouiqce sollitouiqec sollitouicqe
sollitouiceq sollitouiecq sollitouieqc sollitouqice sollitouqiec sollitouqcie sollitouqcei sollitouqeci sollitouqeic
sollitoucqie sollitoucqei sollitouciqe sollitoucieq sollitouceiq sollitouceqi sollitoueqci sollitoueqic sollitouecqi
sollitoueciq sollitoueicq sollitoueiqc sollitoeiquc sollitoeiqcu sollitoeiuqc sollitoeiucq sollitoeicuq sollitoeicqu
sollitoeqiuc sollitoeqicu sollitoequic sollitoequci sollitoeqcui sollitoeqciu sollitoeuqic sollitoeuqci sollitoeuiqc
sollitoeuicq sollitoeuciq sollitoeucqi sollitoecqui sollitoecqiu sollitoecuqi sollitoecuiq sollitoeciuq sollitoeciqu
sollitqcoiue sollitqcoieu sollitqcouie sollitqcouei sollitqcoeui sollitqcoeiu sollitqcioue sollitqcioeu sollitqciuoe
sollitqciueo sollitqcieuo sollitqcieou sollitqcuioe sollitqcuieo sollitqcuoie sollitqcuoei sollitqcueoi sollitqcueio
sollitqceiuo sollitqceiou sollitqceuio sollitqceuoi sollitqceoui sollitqceoiu sollitqociue sollitqocieu sollitqocuie
sollitqocuei sollitqoceui sollitqoceiu sollitqoicue sollitqoiceu sollitqoiuce sollitqoiuec sollitqoieuc sollitqoiecu
sollitqouice sollitqouiec sollitqoucie sollitqoucei sollitqoueci sollitqoueic sollitqoeiuc sollitqoeicu sollitqoeuic
sollitqoeuci sollitqoecui sollitqoeciu sollitqiocue sollitqioceu sollitqiouce sollitqiouec sollitqioeuc sollitqioecu
sollitqicoue sollitqicoeu sollitqicuoe sollitqicueo sollitqiceuo sollitqiceou sollitqiucoe sollitqiuceo sollitqiuoce
sollitqiuoec sollitqiueoc sollitqiueco sollitqiecuo sollitqiecou sollitqieuco sollitqieuoc sollitqieouc sollitqieocu
sollitquoice sollitquoiec sollitquocie sollitquocei sollitquoeci sollitquoeic sollitquioce sollitquioec sollitquicoe
sollitquiceo sollitquieco sollitquieoc sollitqucioe sollitqucieo sollitqucoie sollitqucoei sollitquceoi sollitquceio
sollitqueico sollitqueioc sollitquecio sollitquecoi sollitqueoci sollitqueoic sollitqeoiuc sollitqeoicu sollitqeouic
sollitqeouci sollitqeocui sollitqeociu sollitqeiouc sollitqeiocu sollitqeiuoc sollitqeiuco sollitqeicuo sollitqeicou
sollitqeuioc sollitqeuico sollitqeuoic sollitqeuoci sollitqeucoi sollitqeucio sollitqeciuo sollitqeciou sollitqecuio
sollitqecuoi sollitqecoui sollitqecoiu sollitucoqie sollitucoqei sollitucoiqe sollitucoieq sollitucoeiq sollitucoeqi
sollitucqoie sollitucqoei sollitucqioe sollitucqieo sollitucqeio sollitucqeoi sollituciqoe sollituciqeo sollitucioqe
sollitucioeq sollitucieoq sollitucieqo sollituceqio sollituceqoi sollituceiqo sollituceioq sollituceoiq sollituceoqi
sollituocqie sollituocqei sollituociqe sollituocieq sollituoceiq sollituoceqi sollituoqcie sollituoqcei sollituoqice
sollituoqiec sollituoqeic sollituoqeci sollituoiqce sollituoiqec sollituoicqe sollituoiceq sollituoiecq sollituoieqc
sollituoeqic sollituoeqci sollituoeiqc sollituoeicq sollituoeciq sollituoecqi sollituqocie sollituqocei sollituqoice
sollituqoiec sollituqoeic sollituqoeci sollituqcoie sollituqcoei sollituqcioe sollituqcieo sollituqceio sollituqceoi
sollituqicoe sollituqiceo sollituqioce sollituqioec sollituqieoc sollituqieco sollituqecio sollituqecoi sollituqeico
sollituqeioc sollituqeoic sollituqeoci sollituioqce sollituioqec sollituiocqe sollituioceq sollituioecq sollituioeqc
sollituiqoce sollituiqoec sollituiqcoe sollituiqceo sollituiqeco sollituiqeoc sollituicqoe sollituicqeo sollituicoqe
sollituicoeq sollituiceoq sollituiceqo sollituieqco sollituieqoc sollituiecqo sollituiecoq sollituieocq sollituieoqc
sollitueoqic sollitueoqci sollitueoiqc sollitueoicq sollitueociq sollitueocqi sollitueqoic sollitueqoci sollitueqioc
sollitueqico sollitueqcio sollitueqcoi sollitueiqoc sollitueiqco sollitueioqc sollitueiocq sollitueicoq sollitueicqo
sollituecqio sollituecqoi sollitueciqo sollituecioq sollituecoiq sollituecoqi sollitecoqui sollitecoqiu sollitecouqi
sollitecouiq sollitecoiuq sollitecoiqu sollitecqoui sollitecqoiu sollitecquoi sollitecquio sollitecqiuo sollitecqiou
sollitecuqoi sollitecuqio sollitecuoqi sollitecuoiq sollitecuioq sollitecuiqo solliteciquo solliteciqou solliteciuqo
solliteciuoq solliteciouq sollitecioqu solliteocqui solliteocqiu solliteocuqi solliteocuiq solliteociuq solliteociqu
solliteoqcui solliteoqciu solliteoquci solliteoquic solliteoqiuc solliteoqicu solliteouqci solliteouqic solliteoucqi
solliteouciq solliteouicq solliteouiqc solliteoiquc solliteoiqcu solliteoiuqc solliteoiucq solliteoicuq solliteoicqu
solliteqocui solliteqociu solliteqouci solliteqouic solliteqoiuc solliteqoicu solliteqcoui solliteqcoiu solliteqcuoi
solliteqcuio solliteqciuo solliteqciou sollitequcoi sollitequcio sollitequoci sollitequoic sollitequioc sollitequico
solliteqicuo solliteqicou solliteqiuco solliteqiuoc solliteqiouc solliteqiocu solliteuoqci solliteuoqic solliteuocqi
solliteuociq solliteuoicq solliteuoiqc solliteuqoci solliteuqoic solliteuqcoi solliteuqcio solliteuqico solliteuqioc
solliteucqoi solliteucqio solliteucoqi solliteucoiq solliteucioq solliteuciqo solliteuiqco solliteuiqoc solliteuicqo
solliteuicoq solliteuiocq solliteuioqc solliteioquc solliteioqcu solliteiouqc solliteioucq solliteiocuq solliteiocqu
solliteiqouc solliteiqocu solliteiquoc solliteiquco solliteiqcuo solliteiqcou solliteiuqoc solliteiuqco solliteiuoqc
solliteiuocq solliteiucoq solliteiucqo solliteicquo solliteicqou solliteicuqo solliteicuoq solliteicouq solliteicoqu
sollioitcque sollioitcqeu sollioitcuqe sollioitcueq sollioitceuq sollioitcequ sollioitqcue sollioitqceu sollioitquce
sollioitquec sollioitqeuc sollioitqecu sollioituqce sollioituqec sollioitucqe sollioituceq sollioituecq sollioitueqc
sollioitequc sollioiteqcu sollioiteuqc sollioiteucq sollioitecuq sollioitecqu sollioictque sollioictqeu sollioictuqe
sollioictueq sollioicteuq sollioictequ sollioicqtue sollioicqteu sollioicqute sollioicquet sollioicqeut sollioicqetu
sollioicuqte sollioicuqet sollioicutqe sollioicuteq sollioicuetq sollioicueqt sollioicequt sollioiceqtu sollioiceuqt
sollioiceutq sollioicetuq sollioicetqu sollioiqctue sollioiqcteu sollioiqcute sollioiqcuet sollioiqceut sollioiqcetu
sollioiqtcue sollioiqtceu sollioiqtuce sollioiqtuec sollioiqteuc sollioiqtecu sollioiqutce sollioiqutec sollioiqucte
sollioiqucet sollioiquect sollioiquetc sollioiqetuc sollioiqetcu sollioiqeutc sollioiqeuct sollioiqecut sollioiqectu
sollioiucqte sollioiucqet sollioiuctqe sollioiucteq sollioiucetq sollioiuceqt sollioiuqcte sollioiuqcet sollioiuqtce
sollioiuqtec sollioiuqetc sollioiuqect sollioiutqce sollioiutqec sollioiutcqe sollioiutceq sollioiutecq sollioiuteqc
sollioiueqtc sollioiueqct sollioiuetqc sollioiuetcq sollioiuectq sollioiuecqt sollioiecqut sollioiecqtu sollioiecuqt
sollioiecutq sollioiectuq sollioiectqu sollioieqcut sollioieqctu sollioiequct sollioiequtc sollioieqtuc sollioieqtcu
sollioieuqct sollioieuqtc sollioieucqt sollioieuctq sollioieutcq sollioieutqc sollioietquc sollioietqcu sollioietuqc
sollioietucq sollioietcuq sollioietcqu sollioticque sollioticqeu sollioticuqe sollioticueq sollioticeuq sollioticequ
solliotiqcue solliotiqceu solliotiquce solliotiquec solliotiqeuc solliotiqecu solliotiuqce solliotiuqec solliotiucqe
solliotiuceq solliotiuecq solliotiueqc solliotiequc solliotieqcu solliotieuqc solliotieucq solliotiecuq solliotiecqu
solliotcique solliotciqeu solliotciuqe solliotciueq solliotcieuq solliotciequ solliotcqiue solliotcqieu solliotcquie
solliotcquei solliotcqeui solliotcqeiu solliotcuqie solliotcuqei solliotcuiqe solliotcuieq solliotcueiq solliotcueqi
solliotcequi solliotceqiu solliotceuqi solliotceuiq solliotceiuq solliotceiqu solliotqciue solliotqcieu solliotqcuie
solliotqcuei solliotqceui solliotqceiu solliotqicue solliotqiceu solliotqiuce solliotqiuec solliotqieuc solliotqiecu
solliotquice solliotquiec solliotqucie solliotqucei solliotqueci solliotqueic solliotqeiuc solliotqeicu solliotqeuic
solliotqeuci solliotqecui solliotqeciu solliotucqie solliotucqei solliotuciqe solliotucieq solliotuceiq solliotuceqi
solliotuqcie solliotuqcei solliotuqice solliotuqiec solliotuqeic solliotuqeci solliotuiqce solliotuiqec solliotuicqe
solliotuiceq solliotuiecq solliotuieqc solliotueqic solliotueqci solliotueiqc solliotueicq solliotueciq solliotuecqi
solliotecqui solliotecqiu solliotecuqi solliotecuiq sollioteciuq sollioteciqu sollioteqcui sollioteqciu solliotequci
solliotequic sollioteqiuc sollioteqicu sollioteuqci sollioteuqic sollioteucqi sollioteuciq sollioteuicq sollioteuiqc
sollioteiquc sollioteiqcu sollioteiuqc sollioteiucq sollioteicuq sollioteicqu sollioctique sollioctiqeu sollioctiuqe
sollioctiueq sollioctieuq sollioctiequ sollioctqiue sollioctqieu sollioctquie sollioctquei sollioctqeui sollioctqeiu
sollioctuqie sollioctuqei sollioctuiqe sollioctuieq sollioctueiq sollioctueqi sollioctequi solliocteqiu solliocteuqi
solliocteuiq solliocteiuq solliocteiqu solliocitque solliocitqeu solliocituqe solliocitueq solliociteuq solliocitequ
solliociqtue solliociqteu solliociqute solliociquet solliociqeut solliociqetu solliociuqte solliociuqet solliociutqe
solliociuteq solliociuetq solliociueqt solliociequt solliocieqtu solliocieuqt solliocieutq solliocietuq solliocietqu
solliocqitue solliocqiteu solliocqiute solliocqiuet solliocqieut solliocqietu solliocqtiue solliocqtieu solliocqtuie
solliocqtuei solliocqteui solliocqteiu solliocqutie solliocqutei solliocquite solliocquiet solliocqueit solliocqueti
solliocqetui solliocqetiu solliocqeuti solliocqeuit solliocqeiut solliocqeitu solliocuiqte solliocuiqet solliocuitqe
solliocuiteq solliocuietq solliocuieqt solliocuqite solliocuqiet solliocuqtie solliocuqtei solliocuqeti solliocuqeit
solliocutqie solliocutqei solliocutiqe solliocutieq solliocuteiq solliocuteqi solliocueqti solliocueqit solliocuetqi
solliocuetiq solliocueitq solliocueiqt sollioceiqut sollioceiqtu sollioceiuqt sollioceiutq sollioceituq sollioceitqu
sollioceqiut sollioceqitu solliocequit solliocequti sollioceqtui sollioceqtiu sollioceuqit sollioceuqti sollioceuiqt
sollioceuitq sollioceutiq sollioceutqi solliocetqui solliocetqiu solliocetuqi solliocetuiq solliocetiuq solliocetiqu
sollioqtciue sollioqtcieu sollioqtcuie sollioqtcuei sollioqtceui sollioqtceiu sollioqticue sollioqticeu sollioqtiuce
sollioqtiuec sollioqtieuc sollioqtiecu sollioqtuice sollioqtuiec sollioqtucie sollioqtucei sollioqtueci sollioqtueic
sollioqteiuc sollioqteicu sollioqteuic sollioqteuci sollioqtecui sollioqteciu sollioqctiue sollioqctieu sollioqctuie
sollioqctuei sollioqcteui sollioqcteiu sollioqcitue sollioqciteu sollioqciute sollioqciuet sollioqcieut sollioqcietu
sollioqcuite sollioqcuiet sollioqcutie sollioqcutei sollioqcueti sollioqcueit sollioqceiut sollioqceitu sollioqceuit
sollioqceuti sollioqcetui sollioqcetiu sollioqictue sollioqicteu sollioqicute sollioqicuet sollioqiceut sollioqicetu
sollioqitcue sollioqitceu sollioqituce sollioqituec sollioqiteuc sollioqitecu sollioqiutce sollioqiutec sollioqiucte
sollioqiucet sollioqiuect sollioqiuetc sollioqietuc sollioqietcu sollioqieutc sollioqieuct sollioqiecut sollioqiectu
sollioqucite sollioquciet sollioquctie sollioquctei sollioquceti sollioquceit sollioquicte sollioquicet sollioquitce
sollioquitec sollioquietc sollioquiect sollioqutice sollioqutiec sollioqutcie sollioqutcei sollioquteci sollioquteic
sollioqueitc sollioqueict sollioquetic sollioquetci sollioquecti sollioquecit sollioqeciut sollioqecitu sollioqecuit
sollioqecuti sollioqectui sollioqectiu sollioqeicut sollioqeictu sollioqeiuct sollioqeiutc sollioqeituc sollioqeitcu
sollioqeuict sollioqeuitc sollioqeucit sollioqeucti sollioqeutci sollioqeutic sollioqetiuc sollioqeticu sollioqetuic
sollioqetuci sollioqetcui sollioqetciu sollioutcqie sollioutcqei sollioutciqe sollioutcieq sollioutceiq sollioutceqi
sollioutqcie sollioutqcei sollioutqice sollioutqiec sollioutqeic sollioutqeci sollioutiqce sollioutiqec solliouticqe
solliouticeq sollioutiecq sollioutieqc solliouteqic solliouteqci solliouteiqc solliouteicq solliouteciq sollioutecqi
solliouctqie solliouctqei solliouctiqe solliouctieq sollioucteiq sollioucteqi sollioucqtie sollioucqtei sollioucqite
sollioucqiet sollioucqeit sollioucqeti solliouciqte solliouciqet sollioucitqe solliouciteq sollioucietq sollioucieqt
solliouceqit solliouceqti solliouceiqt solliouceitq sollioucetiq sollioucetqi solliouqctie solliouqctei solliouqcite
solliouqciet solliouqceit solliouqceti solliouqtcie solliouqtcei solliouqtice solliouqtiec solliouqteic solliouqteci
solliouqitce solliouqitec solliouqicte solliouqicet solliouqiect solliouqietc solliouqetic solliouqetci solliouqeitc
solliouqeict solliouqecit solliouqecti solliouicqte solliouicqet solliouictqe solliouicteq solliouicetq solliouiceqt
solliouiqcte solliouiqcet solliouiqtce solliouiqtec solliouiqetc solliouiqect solliouitqce solliouitqec solliouitcqe
solliouitceq solliouitecq solliouiteqc solliouieqtc solliouieqct solliouietqc solliouietcq solliouiectq solliouiecqt
solliouecqit solliouecqti sollioueciqt solliouecitq solliouectiq solliouectqi sollioueqcit sollioueqcti sollioueqict
sollioueqitc sollioueqtic sollioueqtci sollioueiqct sollioueiqtc sollioueicqt sollioueictq sollioueitcq sollioueitqc
solliouetqic solliouetqci solliouetiqc sollioueticq solliouetciq solliouetcqi sollioetcqui sollioetcqiu sollioetcuqi
sollioetcuiq sollioetciuq sollioetciqu sollioetqcui sollioetqciu sollioetquci sollioetquic sollioetqiuc sollioetqicu
sollioetuqci sollioetuqic sollioetucqi sollioetuciq sollioetuicq sollioetuiqc sollioetiquc sollioetiqcu sollioetiuqc
sollioetiucq sollioeticuq sollioeticqu sollioectqui sollioectqiu sollioectuqi sollioectuiq sollioectiuq sollioectiqu
sollioecqtui sollioecqtiu sollioecquti sollioecquit sollioecqiut sollioecqitu sollioecuqti sollioecuqit sollioecutqi
sollioecutiq sollioecuitq sollioecuiqt sollioeciqut sollioeciqtu sollioeciuqt sollioeciutq sollioecituq sollioecitqu
sollioeqctui sollioeqctiu sollioeqcuti sollioeqcuit sollioeqciut sollioeqcitu sollioeqtcui sollioeqtciu sollioeqtuci
sollioeqtuic sollioeqtiuc sollioeqticu sollioequtci sollioequtic sollioequcti sollioequcit sollioequict sollioequitc
sollioeqituc sollioeqitcu sollioeqiutc sollioeqiuct sollioeqicut sollioeqictu sollioeucqti sollioeucqit sollioeuctqi
sollioeuctiq sollioeucitq sollioeuciqt sollioeuqcti sollioeuqcit sollioeuqtci sollioeuqtic sollioeuqitc sollioeuqict
sollioeutqci sollioeutqic sollioeutcqi sollioeutciq sollioeuticq sollioeutiqc sollioeuiqtc sollioeuiqct sollioeuitqc
sollioeuitcq sollioeuictq sollioeuicqt sollioeicqut sollioeicqtu sollioeicuqt sollioeicutq sollioeictuq sollioeictqu
sollioeiqcut sollioeiqctu sollioeiquct sollioeiqutc sollioeiqtuc sollioeiqtcu sollioeiuqct sollioeiuqtc sollioeiucqt
sollioeiuctq sollioeiutcq sollioeiutqc sollioeitquc sollioeitqcu sollioeituqc sollioeitucq sollioeitcuq sollioeitcqu
solliqitocue solliqitoceu solliqitouce solliqitouec solliqitoeuc solliqitoecu solliqitcoue solliqitcoeu solliqitcuoe
solliqitcueo solliqitceuo solliqitceou solliqitucoe solliqituceo solliqituoce solliqituoec solliqitueoc solliqitueco
solliqitecuo solliqitecou solliqiteuco solliqiteuoc solliqiteouc solliqiteocu solliqiotcue solliqiotceu solliqiotuce
solliqiotuec solliqioteuc solliqiotecu solliqioctue solliqiocteu solliqiocute solliqiocuet solliqioceut solliqiocetu
solliqioucte solliqioucet solliqioutce solliqioutec solliqiouetc solliqiouect solliqioecut solliqioectu solliqioeuct
solliqioeutc solliqioetuc solliqioetcu solliqicotue solliqicoteu solliqicoute solliqicouet solliqicoeut solliqicoetu
solliqictoue solliqictoeu solliqictuoe solliqictueo solliqicteuo solliqicteou solliqicutoe solliqicuteo solliqicuote
solliqicuoet solliqicueot solliqicueto solliqicetuo solliqicetou solliqiceuto solliqiceuot solliqiceout solliqiceotu
solliqiuocte solliqiuocet solliqiuotce solliqiuotec solliqiuoetc solliqiuoect solliqiucote solliqiucoet solliqiuctoe
solliqiucteo solliqiuceto solliqiuceot solliqiutcoe solliqiutceo solliqiutoce solliqiutoec solliqiuteoc solliqiuteco
solliqiuecto solliqiuecot solliqiuetco solliqiuetoc solliqiueotc solliqiueoct solliqieocut solliqieoctu solliqieouct
solliqieoutc solliqieotuc solliqieotcu solliqiecout solliqiecotu solliqiecuot solliqiecuto solliqiectuo solliqiectou
solliqieucot solliqieucto solliqieuoct solliqieuotc solliqieutoc solliqieutco solliqietcuo solliqietcou solliqietuco
solliqietuoc solliqietouc solliqietocu solliqtiocue solliqtioceu solliqtiouce solliqtiouec solliqtioeuc solliqtioecu
solliqticoue solliqticoeu solliqticuoe solliqticueo solliqticeuo solliqticeou solliqtiucoe solliqtiuceo solliqtiuoce
solliqtiuoec solliqtiueoc solliqtiueco solliqtiecuo solliqtiecou solliqtieuco solliqtieuoc solliqtieouc solliqtieocu
solliqtoicue solliqtoiceu solliqtoiuce solliqtoiuec solliqtoieuc solliqtoiecu solliqtociue solliqtocieu solliqtocuie
solliqtocuei solliqtoceui solliqtoceiu solliqtoucie solliqtoucei solliqtouice solliqtouiec solliqtoueic solliqtoueci
solliqtoecui solliqtoeciu solliqtoeuci solliqtoeuic solliqtoeiuc solliqtoeicu solliqtcoiue solliqtcoieu solliqtcouie
solliqtcouei solliqtcoeui solliqtcoeiu solliqtcioue solliqtcioeu solliqtciuoe solliqtciueo solliqtcieuo solliqtcieou
solliqtcuioe solliqtcuieo solliqtcuoie solliqtcuoei solliqtcueoi solliqtcueio solliqtceiuo solliqtceiou solliqtceuio
solliqtceuoi solliqtceoui solliqtceoiu solliqtuocie solliqtuocei solliqtuoice solliqtuoiec solliqtuoeic solliqtuoeci
solliqtucoie solliqtucoei solliqtucioe solliqtucieo solliqtuceio solliqtuceoi solliqtuicoe solliqtuiceo solliqtuioce
solliqtuioec solliqtuieoc solliqtuieco solliqtuecio solliqtuecoi solliqtueico solliqtueioc solliqtueoic solliqtueoci
solliqteocui solliqteociu solliqteouci solliqteouic solliqteoiuc solliqteoicu solliqtecoui solliqtecoiu solliqtecuoi
solliqtecuio solliqteciuo solliqteciou solliqteucoi solliqteucio solliqteuoci solliqteuoic solliqteuioc solliqteuico
solliqteicuo solliqteicou solliqteiuco solliqteiuoc solliqteiouc solliqteiocu solliqoticue solliqoticeu solliqotiuce
solliqotiuec solliqotieuc solliqotiecu solliqotciue solliqotcieu solliqotcuie solliqotcuei solliqotceui solliqotceiu
solliqotucie solliqotucei solliqotuice solliqotuiec solliqotueic solliqotueci solliqotecui solliqoteciu solliqoteuci
solliqoteuic solliqoteiuc solliqoteicu solliqoitcue solliqoitceu solliqoituce solliqoituec solliqoiteuc solliqoitecu
solliqoictue solliqoicteu solliqoicute solliqoicuet solliqoiceut solliqoicetu solliqoiucte solliqoiucet solliqoiutce
solliqoiutec solliqoiuetc solliqoiuect solliqoiecut solliqoiectu solliqoieuct solliqoieutc solliqoietuc solliqoietcu
solliqocitue solliqociteu solliqociute solliqociuet solliqocieut solliqocietu solliqoctiue solliqoctieu solliqoctuie
solliqoctuei solliqocteui solliqocteiu solliqocutie solliqocutei solliqocuite solliqocuiet solliqocueit solliqocueti
solliqocetui solliqocetiu solliqoceuti solliqoceuit solliqoceiut solliqoceitu solliqouicte solliqouicet solliqouitce
solliqouitec solliqouietc solliqouiect solliqoucite solliqouciet solliqouctie solliqouctei solliqouceti solliqouceit
solliqoutcie solliqoutcei solliqoutice solliqoutiec solliqouteic solliqouteci solliqouecti solliqouecit solliqouetci
solliqouetic solliqoueitc solliqoueict solliqoeicut solliqoeictu solliqoeiuct solliqoeiutc solliqoeituc solliqoeitcu
solliqoeciut solliqoecitu solliqoecuit solliqoecuti solliqoectui solliqoectiu solliqoeucit solliqoeucti solliqoeuict
solliqoeuitc solliqoeutic solliqoeutci solliqoetcui solliqoetciu solliqoetuci solliqoetuic solliqoetiuc solliqoeticu
solliqctoiue solliqctoieu solliqctouie solliqctouei solliqctoeui solliqctoeiu solliqctioue solliqctioeu solliqctiuoe
solliqctiueo solliqctieuo solliqctieou solliqctuioe solliqctuieo solliqctuoie solliqctuoei solliqctueoi solliqctueio
solliqcteiuo solliqcteiou solliqcteuio solliqcteuoi solliqcteoui solliqcteoiu solliqcotiue solliqcotieu solliqcotuie
solliqcotuei solliqcoteui solliqcoteiu solliqcoitue solliqcoiteu solliqcoiute solliqcoiuet solliqcoieut solliqcoietu
solliqcouite solliqcouiet solliqcoutie solliqcoutei solliqcoueti solliqcoueit solliqcoeiut solliqcoeitu solliqcoeuit
solliqcoeuti solliqcoetui solliqcoetiu solliqciotue solliqcioteu solliqcioute solliqciouet solliqcioeut solliqcioetu
solliqcitoue solliqcitoeu solliqcituoe solliqcitueo solliqciteuo solliqciteou solliqciutoe solliqciuteo solliqciuote
solliqciuoet solliqciueot solliqciueto solliqcietuo solliqcietou solliqcieuto solliqcieuot solliqcieout solliqcieotu
solliqcuoite solliqcuoiet solliqcuotie solliqcuotei solliqcuoeti solliqcuoeit solliqcuiote solliqcuioet solliqcuitoe
solliqcuiteo solliqcuieto solliqcuieot solliqcutioe solliqcutieo solliqcutoie solliqcutoei solliqcuteoi solliqcuteio
solliqcueito solliqcueiot solliqcuetio solliqcuetoi solliqcueoti solliqcueoit solliqceoiut solliqceoitu solliqceouit
solliqceouti solliqceotui solliqceotiu solliqceiout solliqceiotu solliqceiuot solliqceiuto solliqceituo solliqceitou
solliqceuiot solliqceuito solliqceuoit solliqceuoti solliqceutoi solliqceutio solliqcetiuo solliqcetiou solliqcetuio
solliqcetuoi solliqcetoui solliqcetoiu solliqutocie solliqutocei solliqutoice solliqutoiec solliqutoeic solliqutoeci
solliqutcoie solliqutcoei solliqutcioe solliqutcieo solliqutceio solliqutceoi solliquticoe solliquticeo solliqutioce
solliqutioec solliqutieoc solliqutieco solliqutecio solliqutecoi solliquteico solliquteioc solliquteoic solliquteoci
solliquotcie solliquotcei solliquotice solliquotiec solliquoteic solliquoteci solliquoctie solliquoctei solliquocite
solliquociet solliquoceit solliquoceti solliquoicte solliquoicet solliquoitce solliquoitec solliquoietc solliquoiect
solliquoecit solliquoecti solliquoeict solliquoeitc solliquoetic solliquoetci solliqucotie solliqucotei solliqucoite
solliqucoiet solliqucoeit solliqucoeti solliquctoie solliquctoei solliquctioe solliquctieo solliqucteio solliqucteoi
solliqucitoe solliquciteo solliquciote solliqucioet solliqucieot solliqucieto solliqucetio solliqucetoi solliquceito
solliquceiot solliquceoit solliquceoti solliquiocte solliquiocet solliquiotce solliquiotec solliquioetc solliquioect
solliquicote solliquicoet solliquictoe solliquicteo solliquiceto solliquiceot solliquitcoe solliquitceo solliquitoce
solliquitoec solliquiteoc solliquiteco solliquiecto solliquiecot solliquietco solliquietoc solliquieotc solliquieoct
solliqueocit solliqueocti solliqueoict solliqueoitc solliqueotic solliqueotci solliquecoit solliquecoti solliqueciot
solliquecito solliquectio solliquectoi solliqueicot solliqueicto solliqueioct solliqueiotc solliqueitoc solliqueitco
solliquetcio solliquetcoi solliquetico solliquetioc solliquetoic solliquetoci solliqetocui solliqetociu solliqetouci
solliqetouic solliqetoiuc solliqetoicu solliqetcoui solliqetcoiu solliqetcuoi solliqetcuio solliqetciuo solliqetciou
solliqetucoi solliqetucio solliqetuoci solliqetuoic solliqetuioc solliqetuico solliqeticuo solliqeticou solliqetiuco
solliqetiuoc solliqetiouc solliqetiocu solliqeotcui solliqeotciu solliqeotuci solliqeotuic solliqeotiuc solliqeoticu
solliqeoctui solliqeoctiu solliqeocuti solliqeocuit solliqeociut solliqeocitu solliqeoucti solliqeoucit solliqeoutci
solliqeoutic solliqeouitc solliqeouict solliqeoicut solliqeoictu solliqeoiuct solliqeoiutc solliqeoituc solliqeoitcu
solliqecotui solliqecotiu solliqecouti solliqecouit solliqecoiut solliqecoitu solliqectoui solliqectoiu solliqectuoi
solliqectuio solliqectiuo solliqectiou solliqecutoi solliqecutio solliqecuoti solliqecuoit solliqecuiot solliqecuito
solliqecituo solliqecitou solliqeciuto solliqeciuot solliqeciout solliqeciotu solliqeuocti solliqeuocit solliqeuotci
solliqeuotic solliqeuoitc solliqeuoict solliqeucoti solliqeucoit solliqeuctoi solliqeuctio solliqeucito solliqeuciot
solliqeutcoi solliqeutcio solliqeutoci solliqeutoic solliqeutioc solliqeutico solliqeuicto solliqeuicot solliqeuitco
solliqeuitoc solliqeuiotc solliqeuioct solliqeiocut solliqeioctu solliqeiouct solliqeioutc solliqeiotuc solliqeiotcu
solliqeicout solliqeicotu solliqeicuot solliqeicuto solliqeictuo solliqeictou solliqeiucot solliqeiucto solliqeiuoct
solliqeiuotc solliqeiutoc solliqeiutco solliqeitcuo solliqeitcou solliqeituco solliqeituoc solliqeitouc solliqeitocu
solliuitoqce solliuitoqec solliuitocqe solliuitoceq solliuitoecq solliuitoeqc solliuitqoce solliuitqoec solliuitqcoe
solliuitqceo solliuitqeco solliuitqeoc solliuitcqoe solliuitcqeo solliuitcoqe solliuitcoeq solliuitceoq solliuitceqo
solliuiteqco solliuiteqoc solliuitecqo solliuitecoq solliuiteocq solliuiteoqc solliuiotqce solliuiotqec solliuiotcqe
solliuiotceq solliuiotecq solliuioteqc solliuioqtce solliuioqtec solliuioqcte solliuioqcet solliuioqect solliuioqetc
solliuiocqte solliuiocqet solliuioctqe solliuiocteq solliuiocetq solliuioceqt solliuioeqct solliuioeqtc solliuioecqt
solliuioectq solliuioetcq solliuioetqc solliuiqotce solliuiqotec solliuiqocte solliuiqocet solliuiqoect solliuiqoetc
solliuiqtoce solliuiqtoec solliuiqtcoe solliuiqtceo solliuiqteco solliuiqteoc solliuiqctoe solliuiqcteo solliuiqcote
solliuiqcoet solliuiqceot solliuiqceto solliuiqetco solliuiqetoc solliuiqecto solliuiqecot solliuiqeoct solliuiqeotc
solliuicoqte solliuicoqet solliuicotqe solliuicoteq solliuicoetq solliuicoeqt solliuicqote solliuicqoet solliuicqtoe
solliuicqteo solliuicqeto solliuicqeot solliuictqoe solliuictqeo solliuictoqe solliuictoeq solliuicteoq solliuicteqo
solliuiceqto solliuiceqot solliuicetqo solliuicetoq solliuiceotq solliuiceoqt solliuieoqct solliuieoqtc solliuieocqt
solliuieoctq solliuieotcq solliuieotqc solliuieqoct solliuieqotc solliuieqcot solliuieqcto solliuieqtco solliuieqtoc
solliuiecqot solliuiecqto solliuiecoqt solliuiecotq solliuiectoq solliuiectqo solliuietqco solliuietqoc solliuietcqo
solliuietcoq solliuietocq solliuietoqc solliutioqce solliutioqec solliutiocqe solliutioceq solliutioecq solliutioeqc
solliutiqoce solliutiqoec solliutiqcoe solliutiqceo solliutiqeco solliutiqeoc solliuticqoe solliuticqeo solliuticoqe
solliuticoeq solliuticeoq solliuticeqo solliutieqco solliutieqoc solliutiecqo solliutiecoq solliutieocq solliutieoqc
solliutoiqce solliutoiqec solliutoicqe solliutoiceq solliutoiecq solliutoieqc solliutoqice solliutoqiec solliutoqcie
solliutoqcei solliutoqeci solliutoqeic solliutocqie solliutocqei solliutociqe solliutocieq solliutoceiq solliutoceqi
solliutoeqci solliutoeqic solliutoecqi solliutoeciq solliutoeicq solliutoeiqc solliutqoice solliutqoiec solliutqocie
solliutqocei solliutqoeci solliutqoeic solliutqioce solliutqioec solliutqicoe solliutqiceo solliutqieco solliutqieoc
solliutqcioe solliutqcieo solliutqcoie solliutqcoei solliutqceoi solliutqceio solliutqeico solliutqeioc solliutqecio
solliutqecoi solliutqeoci solliutqeoic solliutcoqie solliutcoqei solliutcoiqe solliutcoieq solliutcoeiq solliutcoeqi
solliutcqoie solliutcqoei solliutcqioe solliutcqieo solliutcqeio solliutcqeoi solliutciqoe solliutciqeo solliutcioqe
solliutcioeq solliutcieoq solliutcieqo solliutceqio solliutceqoi solliutceiqo solliutceioq solliutceoiq solliutceoqi
solliuteoqci solliuteoqic solliuteocqi solliuteociq solliuteoicq solliuteoiqc solliuteqoci solliuteqoic solliuteqcoi
solliuteqcio solliuteqico solliuteqioc solliutecqoi solliutecqio solliutecoqi solliutecoiq solliutecioq solliuteciqo
solliuteiqco solliuteiqoc solliuteicqo solliuteicoq solliuteiocq solliuteioqc solliuotiqce solliuotiqec solliuoticqe
solliuoticeq solliuotiecq solliuotieqc solliuotqice solliuotqiec solliuotqcie solliuotqcei solliuotqeci solliuotqeic
solliuotcqie solliuotcqei solliuotciqe solliuotcieq solliuotceiq solliuotceqi solliuoteqci solliuoteqic solliuotecqi
solliuoteciq solliuoteicq solliuoteiqc solliuoitqce solliuoitqec solliuoitcqe solliuoitceq solliuoitecq solliuoiteqc
solliuoiqtce solliuoiqtec solliuoiqcte solliuoiqcet solliuoiqect solliuoiqetc solliuoicqte solliuoicqet solliuoictqe
solliuoicteq solliuoicetq solliuoiceqt solliuoieqct solliuoieqtc solliuoiecqt solliuoiectq solliuoietcq solliuoietqc
solliuoqitce solliuoqitec solliuoqicte solliuoqicet solliuoqiect solliuoqietc solliuoqtice solliuoqtiec solliuoqtcie
solliuoqtcei solliuoqteci solliuoqteic solliuoqctie solliuoqctei solliuoqcite solliuoqciet solliuoqceit solliuoqceti
solliuoqetci solliuoqetic solliuoqecti solliuoqecit solliuoqeict solliuoqeitc solliuociqte solliuociqet solliuocitqe
solliuociteq solliuocietq solliuocieqt solliuocqite solliuocqiet solliuocqtie solliuocqtei solliuocqeti solliuocqeit
solliuoctqie solliuoctqei solliuoctiqe solliuoctieq solliuocteiq solliuocteqi solliuoceqti solliuoceqit solliuocetqi
solliuocetiq solliuoceitq solliuoceiqt solliuoeiqct solliuoeiqtc solliuoeicqt solliuoeictq solliuoeitcq solliuoeitqc
solliuoeqict solliuoeqitc solliuoeqcit solliuoeqcti solliuoeqtci solliuoeqtic solliuoecqit solliuoecqti solliuoeciqt
solliuoecitq solliuoectiq solliuoectqi solliuoetqci solliuoetqic solliuoetcqi solliuoetciq solliuoeticq solliuoetiqc
solliuqtoice solliuqtoiec solliuqtocie solliuqtocei solliuqtoeci solliuqtoeic solliuqtioce solliuqtioec solliuqticoe
solliuqticeo solliuqtieco solliuqtieoc solliuqtcioe solliuqtcieo solliuqtcoie solliuqtcoei solliuqtceoi solliuqtceio
solliuqteico solliuqteioc solliuqtecio solliuqtecoi solliuqteoci solliuqteoic solliuqotice solliuqotiec solliuqotcie
solliuqotcei solliuqoteci solliuqoteic solliuqoitce solliuqoitec solliuqoicte solliuqoicet solliuqoiect solliuqoietc
solliuqocite solliuqociet solliuqoctie solliuqoctei solliuqoceti solliuqoceit solliuqoeict solliuqoeitc solliuqoecit
solliuqoecti solliuqoetci solliuqoetic solliuqiotce solliuqiotec solliuqiocte solliuqiocet solliuqioect solliuqioetc
solliuqitoce solliuqitoec solliuqitcoe solliuqitceo solliuqiteco solliuqiteoc solliuqictoe solliuqicteo solliuqicote
solliuqicoet solliuqiceot solliuqiceto solliuqietco solliuqietoc solliuqiecto solliuqiecot solliuqieoct solliuqieotc
solliuqcoite solliuqcoiet solliuqcotie solliuqcotei solliuqcoeti solliuqcoeit solliuqciote solliuqcioet solliuqcitoe
solliuqciteo solliuqcieto solliuqcieot solliuqctioe solliuqctieo solliuqctoie solliuqctoei solliuqcteoi solliuqcteio
solliuqceito solliuqceiot solliuqcetio solliuqcetoi solliuqceoti solliuqceoit solliuqeoict solliuqeoitc solliuqeocit
solliuqeocti solliuqeotci solliuqeotic solliuqeioct solliuqeiotc solliuqeicot solliuqeicto solliuqeitco solliuqeitoc
solliuqeciot solliuqecito solliuqecoit solliuqecoti solliuqectoi solliuqectio solliuqetico solliuqetioc solliuqetcio
solliuqetcoi solliuqetoci solliuqetoic solliuctoqie solliuctoqei solliuctoiqe solliuctoieq solliuctoeiq solliuctoeqi
solliuctqoie solliuctqoei solliuctqioe solliuctqieo solliuctqeio solliuctqeoi solliuctiqoe solliuctiqeo solliuctioqe
solliuctioeq solliuctieoq solliuctieqo solliucteqio solliucteqoi solliucteiqo solliucteioq solliucteoiq solliucteoqi
solliucotqie solliucotqei solliucotiqe solliucotieq solliucoteiq solliucoteqi solliucoqtie solliucoqtei solliucoqite
solliucoqiet solliucoqeit solliucoqeti solliucoiqte solliucoiqet solliucoitqe solliucoiteq solliucoietq solliucoieqt
solliucoeqit solliucoeqti solliucoeiqt solliucoeitq solliucoetiq solliucoetqi solliucqotie solliucqotei solliucqoite
solliucqoiet solliucqoeit solliucqoeti solliucqtoie solliucqtoei solliucqtioe solliucqtieo solliucqteio solliucqteoi
solliucqitoe solliucqiteo solliucqiote solliucqioet solliucqieot solliucqieto solliucqetio solliucqetoi solliucqeito
solliucqeiot solliucqeoit solliucqeoti solliucioqte solliucioqet solliuciotqe solliucioteq solliucioetq solliucioeqt
solliuciqote solliuciqoet solliuciqtoe solliuciqteo solliuciqeto solliuciqeot solliucitqoe solliucitqeo solliucitoqe
solliucitoeq solliuciteoq solliuciteqo solliucieqto solliucieqot solliucietqo solliucietoq solliucieotq solliucieoqt
solliuceoqit solliuceoqti solliuceoiqt solliuceoitq solliuceotiq solliuceotqi solliuceqoit solliuceqoti solliuceqiot
solliuceqito solliuceqtio solliuceqtoi solliuceiqot solliuceiqto solliuceioqt solliuceiotq solliuceitoq solliuceitqo
solliucetqio solliucetqoi solliucetiqo solliucetioq solliucetoiq solliucetoqi solliuetoqci solliuetoqic solliuetocqi
solliuetociq solliuetoicq solliuetoiqc solliuetqoci solliuetqoic solliuetqcoi solliuetqcio solliuetqico solliuetqioc
solliuetcqoi solliuetcqio solliuetcoqi solliuetcoiq solliuetcioq solliuetciqo solliuetiqco solliuetiqoc solliueticqo
solliueticoq solliuetiocq solliuetioqc solliueotqci solliueotqic solliueotcqi solliueotciq solliueoticq solliueotiqc
solliueoqtci solliueoqtic solliueoqcti solliueoqcit solliueoqict solliueoqitc solliueocqti solliueocqit solliueoctqi
solliueoctiq solliueocitq solliueociqt solliueoiqct solliueoiqtc solliueoicqt solliueoictq solliueoitcq solliueoitqc
solliueqotci solliueqotic solliueqocti solliueqocit solliueqoict solliueqoitc solliueqtoci solliueqtoic solliueqtcoi
solliueqtcio solliueqtico solliueqtioc solliueqctoi solliueqctio solliueqcoti solliueqcoit solliueqciot solliueqcito
solliueqitco solliueqitoc solliueqicto solliueqicot solliueqioct solliueqiotc solliuecoqti solliuecoqit solliuecotqi
solliuecotiq solliuecoitq solliuecoiqt solliuecqoti solliuecqoit solliuecqtoi solliuecqtio solliuecqito solliuecqiot
solliuectqoi solliuectqio solliuectoqi solliuectoiq solliuectioq solliuectiqo solliueciqto solliueciqot solliuecitqo
solliuecitoq solliueciotq solliuecioqt solliueioqct solliueioqtc solliueiocqt solliueioctq solliueiotcq solliueiotqc
solliueiqoct solliueiqotc solliueiqcot solliueiqcto solliueiqtco solliueiqtoc solliueicqot solliueicqto solliueicoqt
solliueicotq solliueictoq solliueictqo solliueitqco solliueitqoc solliueitcqo solliueitcoq solliueitocq solliueitoqc
sollieitoquc sollieitoqcu sollieitouqc sollieitoucq sollieitocuq sollieitocqu sollieitqouc sollieitqocu sollieitquoc
sollieitquco sollieitqcuo sollieitqcou sollieituqoc sollieituqco sollieituoqc sollieituocq sollieitucoq sollieitucqo
sollieitcquo sollieitcqou sollieitcuqo sollieitcuoq sollieitcouq sollieitcoqu sollieiotquc sollieiotqcu sollieiotuqc
sollieiotucq sollieiotcuq sollieiotcqu sollieioqtuc sollieioqtcu sollieioqutc sollieioquct sollieioqcut sollieioqctu
sollieiouqtc sollieiouqct sollieioutqc sollieioutcq sollieiouctq sollieioucqt sollieiocqut sollieiocqtu sollieiocuqt
sollieiocutq sollieioctuq sollieioctqu sollieiqotuc sollieiqotcu sollieiqoutc sollieiqouct sollieiqocut sollieiqoctu
sollieiqtouc sollieiqtocu sollieiqtuoc sollieiqtuco sollieiqtcuo sollieiqtcou sollieiqutoc sollieiqutco sollieiquotc
sollieiquoct sollieiqucot sollieiqucto sollieiqctuo sollieiqctou sollieiqcuto sollieiqcuot sollieiqcout sollieiqcotu
sollieiuoqtc sollieiuoqct sollieiuotqc sollieiuotcq sollieiuoctq sollieiuocqt sollieiuqotc sollieiuqoct sollieiuqtoc
sollieiuqtco sollieiuqcto sollieiuqcot sollieiutqoc sollieiutqco sollieiutoqc sollieiutocq sollieiutcoq sollieiutcqo
sollieiucqto sollieiucqot sollieiuctqo sollieiuctoq sollieiucotq sollieiucoqt sollieicoqut sollieicoqtu sollieicouqt
sollieicoutq sollieicotuq sollieicotqu sollieicqout sollieicqotu sollieicquot sollieicquto sollieicqtuo sollieicqtou
sollieicuqot sollieicuqto sollieicuoqt sollieicuotq sollieicutoq sollieicutqo sollieictquo sollieictqou sollieictuqo
sollieictuoq sollieictouq sollieictoqu sollietioquc sollietioqcu sollietiouqc sollietioucq sollietiocuq sollietiocqu
sollietiqouc sollietiqocu sollietiquoc sollietiquco sollietiqcuo sollietiqcou sollietiuqoc sollietiuqco sollietiuoqc
sollietiuocq sollietiucoq sollietiucqo sollieticquo sollieticqou sollieticuqo sollieticuoq sollieticouq sollieticoqu
sollietoiquc sollietoiqcu sollietoiuqc sollietoiucq sollietoicuq sollietoicqu sollietoqiuc sollietoqicu sollietoquic
sollietoquci sollietoqcui sollietoqciu sollietouqic sollietouqci sollietouiqc sollietouicq sollietouciq sollietoucqi
sollietocqui sollietocqiu sollietocuqi sollietocuiq sollietociuq sollietociqu sollietqoiuc sollietqoicu sollietqouic
sollietqouci sollietqocui sollietqociu sollietqiouc sollietqiocu sollietqiuoc sollietqiuco sollietqicuo sollietqicou
sollietquioc sollietquico sollietquoic sollietquoci sollietqucoi sollietqucio sollietqciuo sollietqciou sollietqcuio
sollietqcuoi sollietqcoui sollietqcoiu sollietuoqic sollietuoqci sollietuoiqc sollietuoicq sollietuociq sollietuocqi
sollietuqoic sollietuqoci sollietuqioc sollietuqico sollietuqcio sollietuqcoi sollietuiqoc sollietuiqco sollietuioqc
sollietuiocq sollietuicoq sollietuicqo sollietucqio sollietucqoi sollietuciqo sollietucioq sollietucoiq sollietucoqi
sollietcoqui sollietcoqiu sollietcouqi sollietcouiq sollietcoiuq sollietcoiqu sollietcqoui sollietcqoiu sollietcquoi
sollietcquio sollietcqiuo sollietcqiou sollietcuqoi sollietcuqio sollietcuoqi sollietcuoiq sollietcuioq sollietcuiqo
sollietciquo sollietciqou sollietciuqo sollietciuoq sollietciouq sollietcioqu sollieotiquc sollieotiqcu sollieotiuqc
sollieotiucq sollieoticuq sollieoticqu sollieotqiuc sollieotqicu sollieotquic sollieotquci sollieotqcui sollieotqciu
sollieotuqic sollieotuqci sollieotuiqc sollieotuicq sollieotuciq sollieotucqi sollieotcqui sollieotcqiu sollieotcuqi
sollieotcuiq sollieotciuq sollieotciqu sollieoitquc sollieoitqcu sollieoituqc sollieoitucq sollieoitcuq sollieoitcqu
sollieoiqtuc sollieoiqtcu sollieoiqutc sollieoiquct sollieoiqcut sollieoiqctu sollieoiuqtc sollieoiuqct sollieoiutqc
sollieoiutcq sollieoiuctq sollieoiucqt sollieoicqut sollieoicqtu sollieoicuqt sollieoicutq sollieoictuq sollieoictqu
sollieoqituc sollieoqitcu sollieoqiutc sollieoqiuct sollieoqicut sollieoqictu sollieoqtiuc sollieoqticu sollieoqtuic
sollieoqtuci sollieoqtcui sollieoqtciu sollieoqutic sollieoqutci sollieoquitc sollieoquict sollieoqucit sollieoqucti
sollieoqctui sollieoqctiu sollieoqcuti sollieoqcuit sollieoqciut sollieoqcitu sollieouiqtc sollieouiqct sollieouitqc
sollieouitcq sollieouictq sollieouicqt sollieouqitc sollieouqict sollieouqtic sollieouqtci sollieouqcti sollieouqcit
sollieoutqic sollieoutqci sollieoutiqc sollieouticq sollieoutciq sollieoutcqi sollieoucqti sollieoucqit sollieouctqi
sollieouctiq sollieoucitq sollieouciqt sollieociqut sollieociqtu sollieociuqt sollieociutq sollieocituq sollieocitqu
sollieocqiut sollieocqitu sollieocquit sollieocquti sollieocqtui sollieocqtiu sollieocuqit sollieocuqti sollieocuiqt
sollieocuitq sollieocutiq sollieocutqi sollieoctqui sollieoctqiu sollieoctuqi sollieoctuiq sollieoctiuq sollieoctiqu
sollieqtoiuc sollieqtoicu sollieqtouic sollieqtouci sollieqtocui sollieqtociu sollieqtiouc sollieqtiocu sollieqtiuoc
sollieqtiuco sollieqticuo sollieqticou sollieqtuioc sollieqtuico sollieqtuoic sollieqtuoci sollieqtucoi sollieqtucio
sollieqtciuo sollieqtciou sollieqtcuio sollieqtcuoi sollieqtcoui sollieqtcoiu sollieqotiuc sollieqoticu sollieqotuic
sollieqotuci sollieqotcui sollieqotciu sollieqoituc sollieqoitcu sollieqoiutc sollieqoiuct sollieqoicut sollieqoictu
sollieqouitc sollieqouict sollieqoutic sollieqoutci sollieqoucti sollieqoucit sollieqociut sollieqocitu sollieqocuit
sollieqocuti sollieqoctui sollieqoctiu sollieqiotuc sollieqiotcu sollieqioutc sollieqiouct sollieqiocut sollieqioctu
sollieqitouc sollieqitocu sollieqituoc sollieqituco sollieqitcuo sollieqitcou sollieqiutoc sollieqiutco sollieqiuotc
sollieqiuoct sollieqiucot sollieqiucto sollieqictuo sollieqictou sollieqicuto sollieqicuot sollieqicout sollieqicotu
solliequoitc solliequoict solliequotic solliequotci solliequocti solliequocit solliequiotc solliequioct solliequitoc
solliequitco solliequicto solliequicot solliequtioc solliequtico solliequtoic solliequtoci solliequtcoi solliequtcio
solliequcito solliequciot solliequctio solliequctoi solliequcoti solliequcoit sollieqcoiut sollieqcoitu sollieqcouit
sollieqcouti sollieqcotui sollieqcotiu sollieqciout sollieqciotu sollieqciuot sollieqciuto sollieqcituo sollieqcitou
sollieqcuiot sollieqcuito sollieqcuoit sollieqcuoti sollieqcutoi sollieqcutio sollieqctiuo sollieqctiou sollieqctuio
sollieqctuoi sollieqctoui sollieqctoiu sollieutoqic sollieutoqci sollieutoiqc sollieutoicq sollieutociq sollieutocqi
sollieutqoic sollieutqoci sollieutqioc sollieutqico sollieutqcio sollieutqcoi sollieutiqoc sollieutiqco sollieutioqc
sollieutiocq sollieuticoq sollieuticqo sollieutcqio sollieutcqoi sollieutciqo sollieutcioq sollieutcoiq sollieutcoqi
sollieuotqic sollieuotqci sollieuotiqc sollieuoticq sollieuotciq sollieuotcqi sollieuoqtic sollieuoqtci sollieuoqitc
sollieuoqict sollieuoqcit sollieuoqcti sollieuoiqtc sollieuoiqct sollieuoitqc sollieuoitcq sollieuoictq sollieuoicqt
sollieuocqit sollieuocqti sollieuociqt sollieuocitq sollieuoctiq sollieuoctqi sollieuqotic sollieuqotci sollieuqoitc
sollieuqoict sollieuqocit sollieuqocti sollieuqtoic sollieuqtoci sollieuqtioc sollieuqtico sollieuqtcio sollieuqtcoi
sollieuqitoc sollieuqitco sollieuqiotc sollieuqioct sollieuqicot sollieuqicto sollieuqctio sollieuqctoi sollieuqcito
sollieuqciot sollieuqcoit sollieuqcoti sollieuioqtc sollieuioqct sollieuiotqc sollieuiotcq sollieuioctq sollieuiocqt
sollieuiqotc sollieuiqoct sollieuiqtoc sollieuiqtco sollieuiqcto sollieuiqcot sollieuitqoc sollieuitqco sollieuitoqc
sollieuitocq sollieuitcoq sollieuitcqo sollieuicqto sollieuicqot sollieuictqo sollieuictoq sollieuicotq sollieuicoqt
sollieucoqit sollieucoqti sollieucoiqt sollieucoitq sollieucotiq sollieucotqi sollieucqoit sollieucqoti sollieucqiot
sollieucqito sollieucqtio sollieucqtoi sollieuciqot sollieuciqto sollieucioqt sollieuciotq sollieucitoq sollieucitqo
sollieuctqio sollieuctqoi sollieuctiqo sollieuctioq sollieuctoiq sollieuctoqi solliectoqui solliectoqiu solliectouqi
solliectouiq solliectoiuq solliectoiqu solliectqoui solliectqoiu solliectquoi solliectquio solliectqiuo solliectqiou
solliectuqoi solliectuqio solliectuoqi solliectuoiq solliectuioq solliectuiqo solliectiquo solliectiqou solliectiuqo
solliectiuoq solliectiouq solliectioqu solliecotqui solliecotqiu solliecotuqi solliecotuiq solliecotiuq solliecotiqu
solliecoqtui solliecoqtiu solliecoquti solliecoquit solliecoqiut solliecoqitu solliecouqti solliecouqit solliecoutqi
solliecoutiq solliecouitq solliecouiqt solliecoiqut solliecoiqtu solliecoiuqt solliecoiutq solliecoituq solliecoitqu
solliecqotui solliecqotiu solliecqouti solliecqouit solliecqoiut solliecqoitu solliecqtoui solliecqtoiu solliecqtuoi
solliecqtuio solliecqtiuo solliecqtiou solliecqutoi solliecqutio solliecquoti solliecquoit solliecquiot solliecquito
solliecqituo solliecqitou solliecqiuto solliecqiuot solliecqiout solliecqiotu solliecuoqti solliecuoqit solliecuotqi
solliecuotiq solliecuoitq solliecuoiqt solliecuqoti solliecuqoit solliecuqtoi solliecuqtio solliecuqito solliecuqiot
solliecutqoi solliecutqio solliecutoqi solliecutoiq solliecutioq solliecutiqo solliecuiqto solliecuiqot solliecuitqo
solliecuitoq solliecuiotq solliecuioqt solliecioqut solliecioqtu sollieciouqt solliecioutq sollieciotuq sollieciotqu
sollieciqout sollieciqotu sollieciquot sollieciquto sollieciqtuo sollieciqtou sollieciuqot sollieciuqto sollieciuoqt
sollieciuotq sollieciutoq sollieciutqo solliecitquo solliecitqou solliecituqo solliecituoq solliecitouq solliecitoqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us