easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

solaveramusque

unplagued

unifacial

weightiest

servas

demonology

oppressereque

peltry

armatured

peragiebatisque

scurvied

anthozoan

rabbited

repatriation

photofinishing

methoxychlor

semioxidated

perspecta


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: sollicitatisque
cipher variations:
tpmmjdjubujtrvf uqnnkekvcvkuswg vroolflwdwlvtxh wsppmgmxexmwuyi xtqqnhnyfynxvzj
yurroiozgzoywak zvsspjpahapzxbl awttqkqbibqaycm bxuurlrcjcrbzdn cyvvsmsdkdscaeo
dzwwtnteletdbfp eaxxuoufmfuecgq fbyyvpvgngvfdhr gczzwqwhohwgeis hdaaxrxipixhfjt
iebbysyjqjyigku jfccztzkrkzjhlv kgddaualslakimw lheebvbmtmbljnx miffcwcnuncmkoy
njggdxdovodnlpz okhheyepwpeomqa pliifzfqxqfpnrb qmjjgagryrgqosc rnkkhbhszshrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: sollicitatisque
Cipher: hloorxrgzgrhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: sollicitatisque
Cipher: BAAAB ABBAB ABABA ABABA ABAAA AAABA ABAAA BAABA AAAAA BAABA ABAAA BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: sollicitatisque
cipher variations:
tpmmjdjubujtrvfdriizhzgbgzdxjnnteeplpsbspndxvxvaafpfebefxjldhxwwvtvqbqvhpzlrzsslxlcbclrvntldkkrfrabarlhpjvfgghjhmbmhvndr
fhccxnxybyxftrzpjyynrnkbknpzfhzluudvdwbwdzftpjnqqtztibitjlhxuqnnkekvcvkuswgesjjaiahchaeykoouffqmqtctqoeywywbbgqgfcfgykme
iyxxwuwrcrwiqamsattmymdcdmswoumellsgsbcbsmiqkwghhikincniwoesgiddyoyzczygusaqkzzosolcloqagiamvvewexcxeaguqkorruaujcjukmiy
vroolflwdwlvtxhftkkbjbidibfzlppvggrnrudurpfzxzxcchrhgdghzlnfjzyyxvxsdsxjrbntbuunznedentxpvnfmmthtcdctnjrlxhiijljodojxpft
hjeezpzadazhvtbrlaaptpmdmprbhjbnwwfxfydyfbhvrlpssvbvkdkvlnjzwsppmgmxexmwuyigullckcjejcgamqqwhhsosvevsqgayayddisihehiamog
kazzywytetykscoucvvoaofefouyqwognnuiudeduoksmyijjkmkpepkyqguikffaqabebaiwucsmbbquqnenqscikcoxxgygzezgciwsmqttwcwlelwmoka
xtqqnhnyfynxvzjhvmmdldkfkdhbnrrxiitptwfwtrhbzbzeejtjifijbnphlbaazxzufuzltdpvdwwpbpgfgpvzrxphoovjvefevpltnzjkklnlqfqlzrhv
jlggbrbcfcbjxvdtnccrvrofortdjldpyyhzhafahdjxtnruuxdxmfmxnplbyurroiozgzoywakiwnnemelgleicossyjjuquxgxusicacaffkukjgjkcoqi
mcbbayavgvamueqwexxqcqhghqwasyqippwkwfgfwqmuoakllmomrgrmasiwkmhhcscdgdckyweuoddswspgpsuekmeqzziaibgbiekyuosvvyeyngnyoqmc
zvsspjpahapzxbljxoofnfmhmfjdpttzkkvrvyhyvtjdbdbgglvlkhkldprjndccbzbwhwbnvfrxfyyrdrihirxbtzrjqqxlxghgxrnvpblmmnpnshsnbtjx
lniidtdehedlzxfvpeetxtqhqtvflnfraajbjchcjflzvptwwzfzohozprndawttqkqbibqaycmkyppgogningkequuallwswzizwukecechhmwmlilmeqsk
oeddcacxixcowgsygzzsesjijsycuaskrrymyhihysowqcmnnoqotitocukymojjeuefifemaygwqffuyuriruwgmogsbbkckdidkgmawquxxagapipaqsoe
bxuurlrcjcrbzdnlzqqhphojohlfrvvbmmxtxajaxvlfdfdiinxnmjmnfrtlpfeedbdyjydpxhtzhaatftkjktzdvbtlssznzijiztpxrdnooprpujupdvlz
npkkfvfgjgfnbzhxrggvzvsjsvxhnphtccldlejelhnbxrvyybhbqjqbrtpfcyvvsmsdkdscaeomarriqipkpimgswwcnnyuybkbywmgegejjoyonknogsum
qgffecezkzeqyiuaibbugulkluaewcumttaoajkjauqyseoppqsqvkvqewmaoqllgwghkhgocaiyshhwawtktwyioqiuddmemfkfmiocyswzzcicrkrcsuqg
dzwwtnteletdbfpnbssjrjqlqjnhtxxdoozvzclczxnhfhfkkpzpolophtvnrhggfdfalafrzjvbjccvhvmlmvbfxdvnuubpbklkbvrztfpqqrtrwlwrfxnb
prmmhxhilihpdbjztiixbxuluxzjprjveenfnglgnjpdztxaadjdslsdtvrheaxxuoufmfuecgqocttkskrmrkoiuyyeppawadmdayoigigllqaqpmpqiuwo
sihhgegbmbgsakwckddwiwnmnwcgyewovvcqclmlcwsaugqrrsusxmxsgyocqsnniyijmjiqeckaujjycyvmvyakqskwffogohmhokqeauybbeketmteuwsi
fbyyvpvgngvfdhrpduultlsnslpjvzzfqqbxbenebzpjhjhmmrbrqnqrjvxptjiihfhcnchtblxdleexjxonoxdhzfxpwwdrdmnmdxtbvhrsstvtynythzpd
rtoojzjknkjrfdlbvkkzdzwnwzblrtlxggphpiniplrfbvzccflfunufvxtjgczzwqwhohwgeisqevvmumtotmqkwaagrrcycfofcaqkikinnscsrorskwyq
ukjjigidodiucmyemffykypopyeiagyqxxesenoneyucwisttuwuzozuiaqesuppkaklolksgemcwllaeaxoxacmsumyhhqiqjojqmsgcwaddgmgvovgwyuk
hdaaxrxipixhfjtrfwwnvnupunrlxbbhssdzdgpgdbrljljootdtspstlxzrvlkkjhjepejvdnzfnggzlzqpqzfjbhzryyftfopofzvdxjtuuvxvapavjbrf
tvqqlblmpmlthfndxmmbfbypybdntvnziirjrkpkrnthdxbeehnhwpwhxzvliebbysyjqjyigkusgxxowovqvosmyccitteaehqhecsmkmkppueutqtumyas
wmllkikfqfkweoagohhamarqragkciaszzgugpqpgaweykuvvwywbqbwkcsguwrrmcmnqnmuigoeynncgczqzceouwoajjskslqlsouieycffioixqxiyawm
jfccztzkrkzjhlvthyypxpwrwptnzddjuufbfirifdtnlnlqqvfvuruvnzbtxnmmljlgrglxfpbhpiibnbsrsbhldjbtaahvhqrqhbxfzlvwwxzxcrcxldth
vxssndnoronvjhpfzoodhdaradfpvxpbkktltmrmtpvjfzdggjpjyryjzbxnkgddaualslakimwuizzqyqxsxquoaeekvvgcgjsjgeuomomrrwgwvsvwoacu
yonnmkmhshmygqciqjjcoctstcimekcubbiwirsricygamwxxyaydsdymeuiwyttoeopspowkiqgappeiebsbegqwyqcllumunsnuqwkgaehhkqkzszkacyo
lheebvbmtmbljnxvjaarzrytyrvpbfflwwhdhktkhfvpnpnssxhxwtwxpbdvzpoonlnitinzhrdjrkkdpdutudjnfldvccjxjstsjdzhbnxyyzbzeteznfvj
xzuupfpqtqpxljrhbqqfjfctcfhrxzrdmmvnvotovrxlhbfiilrlatalbdzpmiffcwcnuncmkoywkbbsaszuzswqcggmxxieiluligwqoqottyiyxuxyqcew
aqppomojujoaisekslleqevuvekogmewddkyktutkeaicoyzzacafufaogwkyavvqgqrurqymksicrrgkgdudgisyasennwowpupwsymicgjjmsmbubmceaq
njggdxdovodnlpzxlcctbtavatxrdhhnyyjfjmvmjhxrprpuuzjzyvyzrdfxbrqqpnpkvkpbjtfltmmfrfwvwflphnfxeelzluvulfbjdpzaabdbgvgbphxl
zbwwrhrsvsrznltjdsshlhevehjtzbtfooxpxqvqxtznjdhkkntncvcndfbrokhheyepwpeomqaymdducubwbuyseiiozzkgknwnkiysqsqvvakazwzasegy
csrrqoqlwlqckugmunngsgxwxgmqiogyffmamvwvmgckeqabbcechwhcqiymacxxsistwtsaomukettimifwfikuacugppyqyrwryuaokeillouodwdoegcs
pliifzfqxqfpnrbzneevdvcxcvztfjjpaalhloxoljztrtrwwblbaxabtfhzdtssrprmxmrdlvhnvoohthyxyhnrjphzggnbnwxwnhdlfrbccdfdixidrjzn
bdyytjtuxutbpnvlfuujnjgxgjlvbdvhqqzrzsxszvbplfjmmpvpexepfhdtqmjjgagryrgqoscaoffwewdydwaugkkqbbmimpypmkaususxxcmcbybcugia
euttsqsnynsemwiowppiuizyzioskqiahhocoxyxoiemgscddegejyjeskaocezzukuvyvucqowmgvvkokhyhkmwcewirrasatytawcqmgknnqwqfyfqgieu
rnkkhbhszshrptdbpggxfxezexbvhllrccnjnqzqnlbvtvtyydndczcdvhjbfvuutrtozotfnxjpxqqjvjazajptlrjbiipdpyzypjfnhtdeefhfkzkftlbp
dfaavlvwzwvdrpxnhwwlplizilnxdfxjssbtbuzubxdrnhloorxrgzgrhjfvsollicitatisquecqhhygyfafycwimmsddokoraromcwuwuzzeoedadewikc
gwvvusupapugoykqyrrkwkbabkqumskcjjqeqzazqkgoiueffgiglalgumcqegbbwmwxaxwesqyoixxmqmjajmoyegykttcucvavcyesoimppsyshahsikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: sollicitatisque
Cipher: fbyyvpvgngvfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: sollicitatisque
Cipher: 344313134231424411444234145451

Extended Methods:
Method #1

Plaintext: sollicitatisque
method variations:
xtqqohoyfyoxvzkcyvvtntdldtcaephdaaysyiqiyhfkuniffdxdovodnlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s o l l i c i t a t i s q u e 
3 4 1 1 4 3 4 4 1 4 4 3 1 5 5 
4 3 3 3 2 1 2 4 1 4 2 4 4 4 1 
They are then read out in rows:
341143441443155433321241424441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: sollicitatisque
Cipher: saotqovunhfditd

Read more ...
Method #3

Plaintext: sollicitatisque
method variations:
tccsmqrdqtmdyyl ccsmqrdqtmdyylt csmqrdqtmdyyltc
smqrdqtmdyyltcc mqrdqtmdyyltccs qrdqtmdyyltccsm
rdqtmdyyltccsmq dqtmdyyltccsmqr qtmdyyltccsmqrd
tmdyyltccsmqrdq mdyyltccsmqrdqt dyyltccsmqrdqtm
yyltccsmqrdqtmd yltccsmqrdqtmdy ltccsmqrdqtmdyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: sollicitatisque

first 5040 cipher variations(1300430725494 total)
sollicitatisque sollicitatisqeu sollicitatisuqe sollicitatisueq sollicitatiseuq sollicitatisequ sollicitatiqsue
sollicitatiqseu sollicitatiquse sollicitatiques sollicitatiqeus sollicitatiqesu sollicitatiuqse sollicitatiuqes
sollicitatiusqe sollicitatiuseq sollicitatiuesq sollicitatiueqs sollicitatiequs sollicitatieqsu sollicitatieuqs
sollicitatieusq sollicitatiesuq sollicitatiesqu sollicitatsique sollicitatsiqeu sollicitatsiuqe sollicitatsiueq
sollicitatsieuq sollicitatsiequ sollicitatsqiue sollicitatsqieu sollicitatsquie sollicitatsquei sollicitatsqeui
sollicitatsqeiu sollicitatsuqie sollicitatsuqei sollicitatsuiqe sollicitatsuieq sollicitatsueiq sollicitatsueqi
sollicitatsequi sollicitatseqiu sollicitatseuqi sollicitatseuiq sollicitatseiuq sollicitatseiqu sollicitatqsiue
sollicitatqsieu sollicitatqsuie sollicitatqsuei sollicitatqseui sollicitatqseiu sollicitatqisue sollicitatqiseu
sollicitatqiuse sollicitatqiues sollicitatqieus sollicitatqiesu sollicitatquise sollicitatquies sollicitatqusie
sollicitatqusei sollicitatquesi sollicitatqueis sollicitatqeius sollicitatqeisu sollicitatqeuis sollicitatqeusi
sollicitatqesui sollicitatqesiu sollicitatusqie sollicitatusqei sollicitatusiqe sollicitatusieq sollicitatuseiq
sollicitatuseqi sollicitatuqsie sollicitatuqsei sollicitatuqise sollicitatuqies sollicitatuqeis sollicitatuqesi
sollicitatuiqse sollicitatuiqes sollicitatuisqe sollicitatuiseq sollicitatuiesq sollicitatuieqs sollicitatueqis
sollicitatueqsi sollicitatueiqs sollicitatueisq sollicitatuesiq sollicitatuesqi sollicitatesqui sollicitatesqiu
sollicitatesuqi sollicitatesuiq sollicitatesiuq sollicitatesiqu sollicitateqsui sollicitateqsiu sollicitatequsi
sollicitatequis sollicitateqius sollicitateqisu sollicitateuqsi sollicitateuqis sollicitateusqi sollicitateusiq
sollicitateuisq sollicitateuiqs sollicitateiqus sollicitateiqsu sollicitateiuqs sollicitateiusq sollicitateisuq
sollicitateisqu sollicitaitsque sollicitaitsqeu sollicitaitsuqe sollicitaitsueq sollicitaitseuq sollicitaitsequ
sollicitaitqsue sollicitaitqseu sollicitaitquse sollicitaitques sollicitaitqeus sollicitaitqesu sollicitaituqse
sollicitaituqes sollicitaitusqe sollicitaituseq sollicitaituesq sollicitaitueqs sollicitaitequs sollicitaiteqsu
sollicitaiteuqs sollicitaiteusq sollicitaitesuq sollicitaitesqu sollicitaistque sollicitaistqeu sollicitaistuqe
sollicitaistueq sollicitaisteuq sollicitaistequ sollicitaisqtue sollicitaisqteu sollicitaisqute sollicitaisquet
sollicitaisqeut sollicitaisqetu sollicitaisuqte sollicitaisuqet sollicitaisutqe sollicitaisuteq sollicitaisuetq
sollicitaisueqt sollicitaisequt sollicitaiseqtu sollicitaiseuqt sollicitaiseutq sollicitaisetuq sollicitaisetqu
sollicitaiqstue sollicitaiqsteu sollicitaiqsute sollicitaiqsuet sollicitaiqseut sollicitaiqsetu sollicitaiqtsue
sollicitaiqtseu sollicitaiqtuse sollicitaiqtues sollicitaiqteus sollicitaiqtesu sollicitaiqutse sollicitaiqutes
sollicitaiquste sollicitaiquset sollicitaiquest sollicitaiquets sollicitaiqetus sollicitaiqetsu sollicitaiqeuts
sollicitaiqeust sollicitaiqesut sollicitaiqestu sollicitaiusqte sollicitaiusqet sollicitaiustqe sollicitaiusteq
sollicitaiusetq sollicitaiuseqt sollicitaiuqste sollicitaiuqset sollicitaiuqtse sollicitaiuqtes sollicitaiuqets
sollicitaiuqest sollicitaiutqse sollicitaiutqes sollicitaiutsqe sollicitaiutseq sollicitaiutesq sollicitaiuteqs
sollicitaiueqts sollicitaiueqst sollicitaiuetqs sollicitaiuetsq sollicitaiuestq sollicitaiuesqt sollicitaiesqut
sollicitaiesqtu sollicitaiesuqt sollicitaiesutq sollicitaiestuq sollicitaiestqu sollicitaieqsut sollicitaieqstu
sollicitaiequst sollicitaiequts sollicitaieqtus sollicitaieqtsu sollicitaieuqst sollicitaieuqts sollicitaieusqt
sollicitaieustq sollicitaieutsq sollicitaieutqs sollicitaietqus sollicitaietqsu sollicitaietuqs sollicitaietusq
sollicitaietsuq sollicitaietsqu sollicitasitque sollicitasitqeu sollicitasituqe sollicitasitueq sollicitasiteuq
sollicitasitequ sollicitasiqtue sollicitasiqteu sollicitasiqute sollicitasiquet sollicitasiqeut sollicitasiqetu
sollicitasiuqte sollicitasiuqet sollicitasiutqe sollicitasiuteq sollicitasiuetq sollicitasiueqt sollicitasiequt
sollicitasieqtu sollicitasieuqt sollicitasieutq sollicitasietuq sollicitasietqu sollicitastique sollicitastiqeu
sollicitastiuqe sollicitastiueq sollicitastieuq sollicitastiequ sollicitastqiue sollicitastqieu sollicitastquie
sollicitastquei sollicitastqeui sollicitastqeiu sollicitastuqie sollicitastuqei sollicitastuiqe sollicitastuieq
sollicitastueiq sollicitastueqi sollicitastequi sollicitasteqiu sollicitasteuqi sollicitasteuiq sollicitasteiuq
sollicitasteiqu sollicitasqtiue sollicitasqtieu sollicitasqtuie sollicitasqtuei sollicitasqteui sollicitasqteiu
sollicitasqitue sollicitasqiteu sollicitasqiute sollicitasqiuet sollicitasqieut sollicitasqietu sollicitasquite
sollicitasquiet sollicitasqutie sollicitasqutei sollicitasqueti sollicitasqueit sollicitasqeiut sollicitasqeitu
sollicitasqeuit sollicitasqeuti sollicitasqetui sollicitasqetiu sollicitasutqie sollicitasutqei sollicitasutiqe
sollicitasutieq sollicitasuteiq sollicitasuteqi sollicitasuqtie sollicitasuqtei sollicitasuqite sollicitasuqiet
sollicitasuqeit sollicitasuqeti sollicitasuiqte sollicitasuiqet sollicitasuitqe sollicitasuiteq sollicitasuietq
sollicitasuieqt sollicitasueqit sollicitasueqti sollicitasueiqt sollicitasueitq sollicitasuetiq sollicitasuetqi
sollicitasetqui sollicitasetqiu sollicitasetuqi sollicitasetuiq sollicitasetiuq sollicitasetiqu sollicitaseqtui
sollicitaseqtiu sollicitasequti sollicitasequit sollicitaseqiut sollicitaseqitu sollicitaseuqti sollicitaseuqit
sollicitaseutqi sollicitaseutiq sollicitaseuitq sollicitaseuiqt sollicitaseiqut sollicitaseiqtu sollicitaseiuqt
sollicitaseiutq sollicitaseituq sollicitaseitqu sollicitaqistue sollicitaqisteu sollicitaqisute sollicitaqisuet
sollicitaqiseut sollicitaqisetu sollicitaqitsue sollicitaqitseu sollicitaqituse sollicitaqitues sollicitaqiteus
sollicitaqitesu sollicitaqiutse sollicitaqiutes sollicitaqiuste sollicitaqiuset sollicitaqiuest sollicitaqiuets
sollicitaqietus sollicitaqietsu sollicitaqieuts sollicitaqieust sollicitaqiesut sollicitaqiestu sollicitaqsitue
sollicitaqsiteu sollicitaqsiute sollicitaqsiuet sollicitaqsieut sollicitaqsietu sollicitaqstiue sollicitaqstieu
sollicitaqstuie sollicitaqstuei sollicitaqsteui sollicitaqsteiu sollicitaqsutie sollicitaqsutei sollicitaqsuite
sollicitaqsuiet sollicitaqsueit sollicitaqsueti sollicitaqsetui sollicitaqsetiu sollicitaqseuti sollicitaqseuit
sollicitaqseiut sollicitaqseitu sollicitaqtsiue sollicitaqtsieu sollicitaqtsuie sollicitaqtsuei sollicitaqtseui
sollicitaqtseiu sollicitaqtisue sollicitaqtiseu sollicitaqtiuse sollicitaqtiues sollicitaqtieus sollicitaqtiesu
sollicitaqtuise sollicitaqtuies sollicitaqtusie sollicitaqtusei sollicitaqtuesi sollicitaqtueis sollicitaqteius
sollicitaqteisu sollicitaqteuis sollicitaqteusi sollicitaqtesui sollicitaqtesiu sollicitaqustie sollicitaqustei
sollicitaqusite sollicitaqusiet sollicitaquseit sollicitaquseti sollicitaqutsie sollicitaqutsei sollicitaqutise
sollicitaquties sollicitaquteis sollicitaqutesi sollicitaquitse sollicitaquites sollicitaquiste sollicitaquiset
sollicitaquiest sollicitaquiets sollicitaquetis sollicitaquetsi sollicitaqueits sollicitaqueist sollicitaquesit
sollicitaquesti sollicitaqestui sollicitaqestiu sollicitaqesuti sollicitaqesuit sollicitaqesiut sollicitaqesitu
sollicitaqetsui sollicitaqetsiu sollicitaqetusi sollicitaqetuis sollicitaqetius sollicitaqetisu sollicitaqeutsi
sollicitaqeutis sollicitaqeusti sollicitaqeusit sollicitaqeuist sollicitaqeuits sollicitaqeitus sollicitaqeitsu
sollicitaqeiuts sollicitaqeiust sollicitaqeisut sollicitaqeistu sollicitauisqte sollicitauisqet sollicitauistqe
sollicitauisteq sollicitauisetq sollicitauiseqt sollicitauiqste sollicitauiqset sollicitauiqtse sollicitauiqtes
sollicitauiqets sollicitauiqest sollicitauitqse sollicitauitqes sollicitauitsqe sollicitauitseq sollicitauitesq
sollicitauiteqs sollicitauieqts sollicitauieqst sollicitauietqs sollicitauietsq sollicitauiestq sollicitauiesqt
sollicitausiqte sollicitausiqet sollicitausitqe sollicitausiteq sollicitausietq sollicitausieqt sollicitausqite
sollicitausqiet sollicitausqtie sollicitausqtei sollicitausqeti sollicitausqeit sollicitaustqie sollicitaustqei
sollicitaustiqe sollicitaustieq sollicitausteiq sollicitausteqi sollicitauseqti sollicitauseqit sollicitausetqi
sollicitausetiq sollicitauseitq sollicitauseiqt sollicitauqsite sollicitauqsiet sollicitauqstie sollicitauqstei
sollicitauqseti sollicitauqseit sollicitauqiste sollicitauqiset sollicitauqitse sollicitauqites sollicitauqiets
sollicitauqiest sollicitauqtise sollicitauqties sollicitauqtsie sollicitauqtsei sollicitauqtesi sollicitauqteis
sollicitauqeits sollicitauqeist sollicitauqetis sollicitauqetsi sollicitauqesti sollicitauqesit sollicitautsqie
sollicitautsqei sollicitautsiqe sollicitautsieq sollicitautseiq sollicitautseqi sollicitautqsie sollicitautqsei
sollicitautqise sollicitautqies sollicitautqeis sollicitautqesi sollicitautiqse sollicitautiqes sollicitautisqe
sollicitautiseq sollicitautiesq sollicitautieqs sollicitauteqis sollicitauteqsi sollicitauteiqs sollicitauteisq
sollicitautesiq sollicitautesqi sollicitauesqti sollicitauesqit sollicitauestqi sollicitauestiq sollicitauesitq
sollicitauesiqt sollicitaueqsti sollicitaueqsit sollicitaueqtsi sollicitaueqtis sollicitaueqits sollicitaueqist
sollicitauetqsi sollicitauetqis sollicitauetsqi sollicitauetsiq sollicitauetisq sollicitauetiqs sollicitaueiqts
sollicitaueiqst sollicitaueitqs sollicitaueitsq sollicitaueistq sollicitaueisqt sollicitaeisqut sollicitaeisqtu
sollicitaeisuqt sollicitaeisutq sollicitaeistuq sollicitaeistqu sollicitaeiqsut sollicitaeiqstu sollicitaeiqust
sollicitaeiquts sollicitaeiqtus sollicitaeiqtsu sollicitaeiuqst sollicitaeiuqts sollicitaeiusqt sollicitaeiustq
sollicitaeiutsq sollicitaeiutqs sollicitaeitqus sollicitaeitqsu sollicitaeituqs sollicitaeitusq sollicitaeitsuq
sollicitaeitsqu sollicitaesiqut sollicitaesiqtu sollicitaesiuqt sollicitaesiutq sollicitaesituq sollicitaesitqu
sollicitaesqiut sollicitaesqitu sollicitaesquit sollicitaesquti sollicitaesqtui sollicitaesqtiu sollicitaesuqit
sollicitaesuqti sollicitaesuiqt sollicitaesuitq sollicitaesutiq sollicitaesutqi sollicitaestqui sollicitaestqiu
sollicitaestuqi sollicitaestuiq sollicitaestiuq sollicitaestiqu sollicitaeqsiut sollicitaeqsitu sollicitaeqsuit
sollicitaeqsuti sollicitaeqstui sollicitaeqstiu sollicitaeqisut sollicitaeqistu sollicitaeqiust sollicitaeqiuts
sollicitaeqitus sollicitaeqitsu sollicitaequist sollicitaequits sollicitaequsit sollicitaequsti sollicitaequtsi
sollicitaequtis sollicitaeqtius sollicitaeqtisu sollicitaeqtuis sollicitaeqtusi sollicitaeqtsui sollicitaeqtsiu
sollicitaeusqit sollicitaeusqti sollicitaeusiqt sollicitaeusitq sollicitaeustiq sollicitaeustqi sollicitaeuqsit
sollicitaeuqsti sollicitaeuqist sollicitaeuqits sollicitaeuqtis sollicitaeuqtsi sollicitaeuiqst sollicitaeuiqts
sollicitaeuisqt sollicitaeuistq sollicitaeuitsq sollicitaeuitqs sollicitaeutqis sollicitaeutqsi sollicitaeutiqs
sollicitaeutisq sollicitaeutsiq sollicitaeutsqi sollicitaetsqui sollicitaetsqiu sollicitaetsuqi sollicitaetsuiq
sollicitaetsiuq sollicitaetsiqu sollicitaetqsui sollicitaetqsiu sollicitaetqusi sollicitaetquis sollicitaetqius
sollicitaetqisu sollicitaetuqsi sollicitaetuqis sollicitaetusqi sollicitaetusiq sollicitaetuisq sollicitaetuiqs
sollicitaetiqus sollicitaetiqsu sollicitaetiuqs sollicitaetiusq sollicitaetisuq sollicitaetisqu sollicittaisque
sollicittaisqeu sollicittaisuqe sollicittaisueq sollicittaiseuq sollicittaisequ sollicittaiqsue sollicittaiqseu
sollicittaiquse sollicittaiques sollicittaiqeus sollicittaiqesu sollicittaiuqse sollicittaiuqes sollicittaiusqe
sollicittaiuseq sollicittaiuesq sollicittaiueqs sollicittaiequs sollicittaieqsu sollicittaieuqs sollicittaieusq
sollicittaiesuq sollicittaiesqu sollicittasique sollicittasiqeu sollicittasiuqe sollicittasiueq sollicittasieuq
sollicittasiequ sollicittasqiue sollicittasqieu sollicittasquie sollicittasquei sollicittasqeui sollicittasqeiu
sollicittasuqie sollicittasuqei sollicittasuiqe sollicittasuieq sollicittasueiq sollicittasueqi sollicittasequi
sollicittaseqiu sollicittaseuqi sollicittaseuiq sollicittaseiuq sollicittaseiqu sollicittaqsiue sollicittaqsieu
sollicittaqsuie sollicittaqsuei sollicittaqseui sollicittaqseiu sollicittaqisue sollicittaqiseu sollicittaqiuse
sollicittaqiues sollicittaqieus sollicittaqiesu sollicittaquise sollicittaquies sollicittaqusie sollicittaqusei
sollicittaquesi sollicittaqueis sollicittaqeius sollicittaqeisu sollicittaqeuis sollicittaqeusi sollicittaqesui
sollicittaqesiu sollicittausqie sollicittausqei sollicittausiqe sollicittausieq sollicittauseiq sollicittauseqi
sollicittauqsie sollicittauqsei sollicittauqise sollicittauqies sollicittauqeis sollicittauqesi sollicittauiqse
sollicittauiqes sollicittauisqe sollicittauiseq sollicittauiesq sollicittauieqs sollicittaueqis sollicittaueqsi
sollicittaueiqs sollicittaueisq sollicittauesiq sollicittauesqi sollicittaesqui sollicittaesqiu sollicittaesuqi
sollicittaesuiq sollicittaesiuq sollicittaesiqu sollicittaeqsui sollicittaeqsiu sollicittaequsi sollicittaequis
sollicittaeqius sollicittaeqisu sollicittaeuqsi sollicittaeuqis sollicittaeusqi sollicittaeusiq sollicittaeuisq
sollicittaeuiqs sollicittaeiqus sollicittaeiqsu sollicittaeiuqs sollicittaeiusq sollicittaeisuq sollicittaeisqu
sollicittiasque sollicittiasqeu sollicittiasuqe sollicittiasueq sollicittiaseuq sollicittiasequ sollicittiaqsue
sollicittiaqseu sollicittiaquse sollicittiaques sollicittiaqeus sollicittiaqesu sollicittiauqse sollicittiauqes
sollicittiausqe sollicittiauseq sollicittiauesq sollicittiaueqs sollicittiaequs sollicittiaeqsu sollicittiaeuqs
sollicittiaeusq sollicittiaesuq sollicittiaesqu sollicittisaque sollicittisaqeu sollicittisauqe sollicittisaueq
sollicittisaeuq sollicittisaequ sollicittisqaue sollicittisqaeu sollicittisquae sollicittisquea sollicittisqeua
sollicittisqeau sollicittisuqae sollicittisuqea sollicittisuaqe sollicittisuaeq sollicittisueaq sollicittisueqa
sollicittisequa sollicittiseqau sollicittiseuqa sollicittiseuaq sollicittiseauq sollicittiseaqu sollicittiqsaue
sollicittiqsaeu sollicittiqsuae sollicittiqsuea sollicittiqseua sollicittiqseau sollicittiqasue sollicittiqaseu
sollicittiqause sollicittiqaues sollicittiqaeus sollicittiqaesu sollicittiquase sollicittiquaes sollicittiqusae
sollicittiqusea sollicittiquesa sollicittiqueas sollicittiqeaus sollicittiqeasu sollicittiqeuas sollicittiqeusa
sollicittiqesua sollicittiqesau sollicittiusqae sollicittiusqea sollicittiusaqe sollicittiusaeq sollicittiuseaq
sollicittiuseqa sollicittiuqsae sollicittiuqsea sollicittiuqase sollicittiuqaes sollicittiuqeas sollicittiuqesa
sollicittiuaqse sollicittiuaqes sollicittiuasqe sollicittiuaseq sollicittiuaesq sollicittiuaeqs sollicittiueqas
sollicittiueqsa sollicittiueaqs sollicittiueasq sollicittiuesaq sollicittiuesqa sollicittiesqua sollicittiesqau
sollicittiesuqa sollicittiesuaq sollicittiesauq sollicittiesaqu sollicittieqsua sollicittieqsau sollicittiequsa
sollicittiequas sollicittieqaus sollicittieqasu sollicittieuqsa sollicittieuqas sollicittieusqa sollicittieusaq
sollicittieuasq sollicittieuaqs sollicittieaqus sollicittieaqsu sollicittieauqs sollicittieausq sollicittieasuq
sollicittieasqu sollicittsiaque sollicittsiaqeu sollicittsiauqe sollicittsiaueq sollicittsiaeuq sollicittsiaequ
sollicittsiqaue sollicittsiqaeu sollicittsiquae sollicittsiquea sollicittsiqeua sollicittsiqeau sollicittsiuqae
sollicittsiuqea sollicittsiuaqe sollicittsiuaeq sollicittsiueaq sollicittsiueqa sollicittsiequa sollicittsieqau
sollicittsieuqa sollicittsieuaq sollicittsieauq sollicittsieaqu sollicittsaique sollicittsaiqeu sollicittsaiuqe
sollicittsaiueq sollicittsaieuq sollicittsaiequ sollicittsaqiue sollicittsaqieu sollicittsaquie sollicittsaquei
sollicittsaqeui sollicittsaqeiu sollicittsauqie sollicittsauqei sollicittsauiqe sollicittsauieq sollicittsaueiq
sollicittsaueqi sollicittsaequi sollicittsaeqiu sollicittsaeuqi sollicittsaeuiq sollicittsaeiuq sollicittsaeiqu
sollicittsqaiue sollicittsqaieu sollicittsqauie sollicittsqauei sollicittsqaeui sollicittsqaeiu sollicittsqiaue
sollicittsqiaeu sollicittsqiuae sollicittsqiuea sollicittsqieua sollicittsqieau sollicittsquiae sollicittsquiea
sollicittsquaie sollicittsquaei sollicittsqueai sollicittsqueia sollicittsqeiua sollicittsqeiau sollicittsqeuia
sollicittsqeuai sollicittsqeaui sollicittsqeaiu sollicittsuaqie sollicittsuaqei sollicittsuaiqe sollicittsuaieq
sollicittsuaeiq sollicittsuaeqi sollicittsuqaie sollicittsuqaei sollicittsuqiae sollicittsuqiea sollicittsuqeia
sollicittsuqeai sollicittsuiqae sollicittsuiqea sollicittsuiaqe sollicittsuiaeq sollicittsuieaq sollicittsuieqa
sollicittsueqia sollicittsueqai sollicittsueiqa sollicittsueiaq sollicittsueaiq sollicittsueaqi sollicittseaqui
sollicittseaqiu sollicittseauqi sollicittseauiq sollicittseaiuq sollicittseaiqu sollicittseqaui sollicittseqaiu
sollicittsequai sollicittsequia sollicittseqiua sollicittseqiau sollicittseuqai sollicittseuqia sollicittseuaqi
sollicittseuaiq sollicittseuiaq sollicittseuiqa sollicittseiqua sollicittseiqau sollicittseiuqa sollicittseiuaq
sollicittseiauq sollicittseiaqu sollicittqisaue sollicittqisaeu sollicittqisuae sollicittqisuea sollicittqiseua
sollicittqiseau sollicittqiasue sollicittqiaseu sollicittqiause sollicittqiaues sollicittqiaeus sollicittqiaesu
sollicittqiuase sollicittqiuaes sollicittqiusae sollicittqiusea sollicittqiuesa sollicittqiueas sollicittqieaus
sollicittqieasu sollicittqieuas sollicittqieusa sollicittqiesua sollicittqiesau sollicittqsiaue sollicittqsiaeu
sollicittqsiuae sollicittqsiuea sollicittqsieua sollicittqsieau sollicittqsaiue sollicittqsaieu sollicittqsauie
sollicittqsauei sollicittqsaeui sollicittqsaeiu sollicittqsuaie sollicittqsuaei sollicittqsuiae sollicittqsuiea
sollicittqsueia sollicittqsueai sollicittqseaui sollicittqseaiu sollicittqseuai sollicittqseuia sollicittqseiua
sollicittqseiau sollicittqasiue sollicittqasieu sollicittqasuie sollicittqasuei sollicittqaseui sollicittqaseiu
sollicittqaisue sollicittqaiseu sollicittqaiuse sollicittqaiues sollicittqaieus sollicittqaiesu sollicittqauise
sollicittqauies sollicittqausie sollicittqausei sollicittqauesi sollicittqaueis sollicittqaeius sollicittqaeisu
sollicittqaeuis sollicittqaeusi sollicittqaesui sollicittqaesiu sollicittqusaie sollicittqusaei sollicittqusiae
sollicittqusiea sollicittquseia sollicittquseai sollicittquasie sollicittquasei sollicittquaise sollicittquaies
sollicittquaeis sollicittquaesi sollicittquiase sollicittquiaes sollicittquisae sollicittquisea sollicittquiesa
sollicittquieas sollicittqueais sollicittqueasi sollicittqueias sollicittqueisa sollicittquesia sollicittquesai
sollicittqesaui sollicittqesaiu sollicittqesuai sollicittqesuia sollicittqesiua sollicittqesiau sollicittqeasui
sollicittqeasiu sollicittqeausi sollicittqeauis sollicittqeaius sollicittqeaisu sollicittqeuasi sollicittqeuais
sollicittqeusai sollicittqeusia sollicittqeuisa sollicittqeuias sollicittqeiaus sollicittqeiasu sollicittqeiuas
sollicittqeiusa sollicittqeisua sollicittqeisau sollicittuisqae sollicittuisqea sollicittuisaqe sollicittuisaeq
sollicittuiseaq sollicittuiseqa sollicittuiqsae sollicittuiqsea sollicittuiqase sollicittuiqaes sollicittuiqeas
sollicittuiqesa sollicittuiaqse sollicittuiaqes sollicittuiasqe sollicittuiaseq sollicittuiaesq sollicittuiaeqs
sollicittuieqas sollicittuieqsa sollicittuieaqs sollicittuieasq sollicittuiesaq sollicittuiesqa sollicittusiqae
sollicittusiqea sollicittusiaqe sollicittusiaeq sollicittusieaq sollicittusieqa sollicittusqiae sollicittusqiea
sollicittusqaie sollicittusqaei sollicittusqeai sollicittusqeia sollicittusaqie sollicittusaqei sollicittusaiqe
sollicittusaieq sollicittusaeiq sollicittusaeqi sollicittuseqai sollicittuseqia sollicittuseaqi sollicittuseaiq
sollicittuseiaq sollicittuseiqa sollicittuqsiae sollicittuqsiea sollicittuqsaie sollicittuqsaei sollicittuqseai
sollicittuqseia sollicittuqisae sollicittuqisea sollicittuqiase sollicittuqiaes sollicittuqieas sollicittuqiesa
sollicittuqaise sollicittuqaies sollicittuqasie sollicittuqasei sollicittuqaesi sollicittuqaeis sollicittuqeias
sollicittuqeisa sollicittuqeais sollicittuqeasi sollicittuqesai sollicittuqesia sollicittuasqie sollicittuasqei
sollicittuasiqe sollicittuasieq sollicittuaseiq sollicittuaseqi sollicittuaqsie sollicittuaqsei sollicittuaqise
sollicittuaqies sollicittuaqeis sollicittuaqesi sollicittuaiqse sollicittuaiqes sollicittuaisqe sollicittuaiseq
sollicittuaiesq sollicittuaieqs sollicittuaeqis sollicittuaeqsi sollicittuaeiqs sollicittuaeisq sollicittuaesiq
sollicittuaesqi sollicittuesqai sollicittuesqia sollicittuesaqi sollicittuesaiq sollicittuesiaq sollicittuesiqa
sollicittueqsai sollicittueqsia sollicittueqasi sollicittueqais sollicittueqias sollicittueqisa sollicittueaqsi
sollicittueaqis sollicittueasqi sollicittueasiq sollicittueaisq sollicittueaiqs sollicittueiqas sollicittueiqsa
sollicittueiaqs sollicittueiasq sollicittueisaq sollicittueisqa sollicitteisqua sollicitteisqau sollicitteisuqa
sollicitteisuaq sollicitteisauq sollicitteisaqu sollicitteiqsua sollicitteiqsau sollicitteiqusa sollicitteiquas
sollicitteiqaus sollicitteiqasu sollicitteiuqsa sollicitteiuqas sollicitteiusqa sollicitteiusaq sollicitteiuasq
sollicitteiuaqs sollicitteiaqus sollicitteiaqsu sollicitteiauqs sollicitteiausq sollicitteiasuq sollicitteiasqu
sollicittesiqua sollicittesiqau sollicittesiuqa sollicittesiuaq sollicittesiauq sollicittesiaqu sollicittesqiua
sollicittesqiau sollicittesquia sollicittesquai sollicittesqaui sollicittesqaiu sollicittesuqia sollicittesuqai
sollicittesuiqa sollicittesuiaq sollicittesuaiq sollicittesuaqi sollicittesaqui sollicittesaqiu sollicittesauqi
sollicittesauiq sollicittesaiuq sollicittesaiqu sollicitteqsiua sollicitteqsiau sollicitteqsuia sollicitteqsuai
sollicitteqsaui sollicitteqsaiu sollicitteqisua sollicitteqisau sollicitteqiusa sollicitteqiuas sollicitteqiaus
sollicitteqiasu sollicittequisa sollicittequias sollicittequsia sollicittequsai sollicittequasi sollicittequais
sollicitteqaius sollicitteqaisu sollicitteqauis sollicitteqausi sollicitteqasui sollicitteqasiu sollicitteusqia
sollicitteusqai sollicitteusiqa sollicitteusiaq sollicitteusaiq sollicitteusaqi sollicitteuqsia sollicitteuqsai
sollicitteuqisa sollicitteuqias sollicitteuqais sollicitteuqasi sollicitteuiqsa sollicitteuiqas sollicitteuisqa
sollicitteuisaq sollicitteuiasq sollicitteuiaqs sollicitteuaqis sollicitteuaqsi sollicitteuaiqs sollicitteuaisq
sollicitteuasiq sollicitteuasqi sollicitteasqui sollicitteasqiu sollicitteasuqi sollicitteasuiq sollicitteasiuq
sollicitteasiqu sollicitteaqsui sollicitteaqsiu sollicitteaqusi sollicitteaquis sollicitteaqius sollicitteaqisu
sollicitteauqsi sollicitteauqis sollicitteausqi sollicitteausiq sollicitteauisq sollicitteauiqs sollicitteaiqus
sollicitteaiqsu sollicitteaiuqs sollicitteaiusq sollicitteaisuq sollicitteaisqu sollicititasque sollicititasqeu
sollicititasuqe sollicititasueq sollicititaseuq sollicititasequ sollicititaqsue sollicititaqseu sollicititaquse
sollicititaques sollicititaqeus sollicititaqesu sollicititauqse sollicititauqes sollicititausqe sollicititauseq
sollicititauesq sollicititaueqs sollicititaequs sollicititaeqsu sollicititaeuqs sollicititaeusq sollicititaesuq
sollicititaesqu sollicititsaque sollicititsaqeu sollicititsauqe sollicititsaueq sollicititsaeuq sollicititsaequ
sollicititsqaue sollicititsqaeu sollicititsquae sollicititsquea sollicititsqeua sollicititsqeau sollicititsuqae
sollicititsuqea sollicititsuaqe sollicititsuaeq sollicititsueaq sollicititsueqa sollicititsequa sollicititseqau
sollicititseuqa sollicititseuaq sollicititseauq sollicititseaqu sollicititqsaue sollicititqsaeu sollicititqsuae
sollicititqsuea sollicititqseua sollicititqseau sollicititqasue sollicititqaseu sollicititqause sollicititqaues
sollicititqaeus sollicititqaesu sollicititquase sollicititquaes sollicititqusae sollicititqusea sollicititquesa
sollicititqueas sollicititqeaus sollicititqeasu sollicititqeuas sollicititqeusa sollicititqesua sollicititqesau
sollicititusqae sollicititusqea sollicititusaqe sollicititusaeq sollicitituseaq sollicitituseqa sollicitituqsae
sollicitituqsea sollicitituqase sollicitituqaes sollicitituqeas sollicitituqesa sollicitituaqse sollicitituaqes
sollicitituasqe sollicitituaseq sollicitituaesq sollicitituaeqs sollicititueqas sollicititueqsa sollicititueaqs
sollicititueasq sollicitituesaq sollicitituesqa sollicititesqua sollicititesqau sollicititesuqa sollicititesuaq
sollicititesauq sollicititesaqu sollicititeqsua sollicititeqsau sollicititequsa sollicititequas sollicititeqaus
sollicititeqasu sollicititeuqsa sollicititeuqas sollicititeusqa sollicititeusaq sollicititeuasq sollicititeuaqs
sollicititeaqus sollicititeaqsu sollicititeauqs sollicititeausq sollicititeasuq sollicititeasqu sollicitiatsque
sollicitiatsqeu sollicitiatsuqe sollicitiatsueq sollicitiatseuq sollicitiatsequ sollicitiatqsue sollicitiatqseu
sollicitiatquse sollicitiatques sollicitiatqeus sollicitiatqesu sollicitiatuqse sollicitiatuqes sollicitiatusqe
sollicitiatuseq sollicitiatuesq sollicitiatueqs sollicitiatequs sollicitiateqsu sollicitiateuqs sollicitiateusq
sollicitiatesuq sollicitiatesqu sollicitiastque sollicitiastqeu sollicitiastuqe sollicitiastueq sollicitiasteuq
sollicitiastequ sollicitiasqtue sollicitiasqteu sollicitiasqute sollicitiasquet sollicitiasqeut sollicitiasqetu
sollicitiasuqte sollicitiasuqet sollicitiasutqe sollicitiasuteq sollicitiasuetq sollicitiasueqt sollicitiasequt
sollicitiaseqtu sollicitiaseuqt sollicitiaseutq sollicitiasetuq sollicitiasetqu sollicitiaqstue sollicitiaqsteu
sollicitiaqsute sollicitiaqsuet sollicitiaqseut sollicitiaqsetu sollicitiaqtsue sollicitiaqtseu sollicitiaqtuse
sollicitiaqtues sollicitiaqteus sollicitiaqtesu sollicitiaqutse sollicitiaqutes sollicitiaquste sollicitiaquset
sollicitiaquest sollicitiaquets sollicitiaqetus sollicitiaqetsu sollicitiaqeuts sollicitiaqeust sollicitiaqesut
sollicitiaqestu sollicitiausqte sollicitiausqet sollicitiaustqe sollicitiausteq sollicitiausetq sollicitiauseqt
sollicitiauqste sollicitiauqset sollicitiauqtse sollicitiauqtes sollicitiauqets sollicitiauqest sollicitiautqse
sollicitiautqes sollicitiautsqe sollicitiautseq sollicitiautesq sollicitiauteqs sollicitiaueqts sollicitiaueqst
sollicitiauetqs sollicitiauetsq sollicitiauestq sollicitiauesqt sollicitiaesqut sollicitiaesqtu sollicitiaesuqt
sollicitiaesutq sollicitiaestuq sollicitiaestqu sollicitiaeqsut sollicitiaeqstu sollicitiaequst sollicitiaequts
sollicitiaeqtus sollicitiaeqtsu sollicitiaeuqst sollicitiaeuqts sollicitiaeusqt sollicitiaeustq sollicitiaeutsq
sollicitiaeutqs sollicitiaetqus sollicitiaetqsu sollicitiaetuqs sollicitiaetusq sollicitiaetsuq sollicitiaetsqu
sollicitisatque sollicitisatqeu sollicitisatuqe sollicitisatueq sollicitisateuq sollicitisatequ sollicitisaqtue
sollicitisaqteu sollicitisaqute sollicitisaquet sollicitisaqeut sollicitisaqetu sollicitisauqte sollicitisauqet
sollicitisautqe sollicitisauteq sollicitisauetq sollicitisaueqt sollicitisaequt sollicitisaeqtu sollicitisaeuqt
sollicitisaeutq sollicitisaetuq sollicitisaetqu sollicitistaque sollicitistaqeu sollicitistauqe sollicitistaueq
sollicitistaeuq sollicitistaequ sollicitistqaue sollicitistqaeu sollicitistquae sollicitistquea sollicitistqeua
sollicitistqeau sollicitistuqae sollicitistuqea sollicitistuaqe sollicitistuaeq sollicitistueaq sollicitistueqa
sollicitistequa sollicitisteqau sollicitisteuqa sollicitisteuaq sollicitisteauq sollicitisteaqu sollicitisqtaue
sollicitisqtaeu sollicitisqtuae sollicitisqtuea sollicitisqteua sollicitisqteau sollicitisqatue sollicitisqateu
sollicitisqaute sollicitisqauet sollicitisqaeut sollicitisqaetu sollicitisquate sollicitisquaet sollicitisqutae
sollicitisqutea sollicitisqueta sollicitisqueat sollicitisqeaut sollicitisqeatu sollicitisqeuat sollicitisqeuta
sollicitisqetua sollicitisqetau sollicitisutqae sollicitisutqea sollicitisutaqe sollicitisutaeq sollicitisuteaq
sollicitisuteqa sollicitisuqtae sollicitisuqtea sollicitisuqate sollicitisuqaet sollicitisuqeat sollicitisuqeta
sollicitisuaqte sollicitisuaqet sollicitisuatqe sollicitisuateq sollicitisuaetq sollicitisuaeqt sollicitisueqat
sollicitisueqta sollicitisueaqt sollicitisueatq sollicitisuetaq sollicitisuetqa sollicitisetqua sollicitisetqau
sollicitisetuqa sollicitisetuaq sollicitisetauq sollicitisetaqu sollicitiseqtua sollicitiseqtau sollicitisequta
sollicitisequat sollicitiseqaut sollicitiseqatu sollicitiseuqta sollicitiseuqat sollicitiseutqa sollicitiseutaq
sollicitiseuatq sollicitiseuaqt sollicitiseaqut sollicitiseaqtu sollicitiseauqt sollicitiseautq sollicitiseatuq
sollicitiseatqu sollicitiqastue sollicitiqasteu sollicitiqasute sollicitiqasuet sollicitiqaseut sollicitiqasetu
sollicitiqatsue sollicitiqatseu sollicitiqatuse sollicitiqatues sollicitiqateus sollicitiqatesu sollicitiqautse
sollicitiqautes sollicitiqauste sollicitiqauset sollicitiqauest sollicitiqauets sollicitiqaetus sollicitiqaetsu
sollicitiqaeuts sollicitiqaeust sollicitiqaesut sollicitiqaestu sollicitiqsatue sollicitiqsateu sollicitiqsaute
sollicitiqsauet sollicitiqsaeut sollicitiqsaetu sollicitiqstaue sollicitiqstaeu sollicitiqstuae sollicitiqstuea
sollicitiqsteua sollicitiqsteau sollicitiqsutae sollicitiqsutea sollicitiqsuate sollicitiqsuaet sollicitiqsueat
sollicitiqsueta sollicitiqsetua sollicitiqsetau sollicitiqseuta sollicitiqseuat sollicitiqseaut sollicitiqseatu
sollicitiqtsaue sollicitiqtsaeu sollicitiqtsuae sollicitiqtsuea sollicitiqtseua sollicitiqtseau sollicitiqtasue
sollicitiqtaseu sollicitiqtause sollicitiqtaues sollicitiqtaeus sollicitiqtaesu sollicitiqtuase sollicitiqtuaes
sollicitiqtusae sollicitiqtusea sollicitiqtuesa sollicitiqtueas sollicitiqteaus sollicitiqteasu sollicitiqteuas
sollicitiqteusa sollicitiqtesua sollicitiqtesau sollicitiqustae sollicitiqustea sollicitiqusate sollicitiqusaet
sollicitiquseat sollicitiquseta sollicitiqutsae sollicitiqutsea sollicitiqutase sollicitiqutaes sollicitiquteas
sollicitiqutesa sollicitiquatse sollicitiquates sollicitiquaste sollicitiquaset sollicitiquaest sollicitiquaets
sollicitiquetas sollicitiquetsa sollicitiqueats sollicitiqueast sollicitiquesat sollicitiquesta sollicitiqestua
sollicitiqestau sollicitiqesuta sollicitiqesuat sollicitiqesaut sollicitiqesatu sollicitiqetsua sollicitiqetsau
sollicitiqetusa sollicitiqetuas sollicitiqetaus sollicitiqetasu sollicitiqeutsa sollicitiqeutas sollicitiqeusta
sollicitiqeusat sollicitiqeuast sollicitiqeuats sollicitiqeatus sollicitiqeatsu sollicitiqeauts sollicitiqeaust
sollicitiqeasut sollicitiqeastu sollicitiuasqte sollicitiuasqet sollicitiuastqe sollicitiuasteq sollicitiuasetq
sollicitiuaseqt sollicitiuaqste sollicitiuaqset sollicitiuaqtse sollicitiuaqtes sollicitiuaqets sollicitiuaqest
sollicitiuatqse sollicitiuatqes sollicitiuatsqe sollicitiuatseq sollicitiuatesq sollicitiuateqs sollicitiuaeqts
sollicitiuaeqst sollicitiuaetqs sollicitiuaetsq sollicitiuaestq sollicitiuaesqt sollicitiusaqte sollicitiusaqet
sollicitiusatqe sollicitiusateq sollicitiusaetq sollicitiusaeqt sollicitiusqate sollicitiusqaet sollicitiusqtae
sollicitiusqtea sollicitiusqeta sollicitiusqeat sollicitiustqae sollicitiustqea sollicitiustaqe sollicitiustaeq
sollicitiusteaq sollicitiusteqa sollicitiuseqta sollicitiuseqat sollicitiusetqa sollicitiusetaq sollicitiuseatq
sollicitiuseaqt sollicitiuqsate sollicitiuqsaet sollicitiuqstae sollicitiuqstea sollicitiuqseta sollicitiuqseat
sollicitiuqaste sollicitiuqaset sollicitiuqatse sollicitiuqates sollicitiuqaets sollicitiuqaest sollicitiuqtase
sollicitiuqtaes sollicitiuqtsae sollicitiuqtsea sollicitiuqtesa sollicitiuqteas sollicitiuqeats sollicitiuqeast
sollicitiuqetas sollicitiuqetsa sollicitiuqesta sollicitiuqesat sollicitiutsqae sollicitiutsqea sollicitiutsaqe
sollicitiutsaeq sollicitiutseaq sollicitiutseqa sollicitiutqsae sollicitiutqsea sollicitiutqase sollicitiutqaes
sollicitiutqeas sollicitiutqesa sollicitiutaqse sollicitiutaqes sollicitiutasqe sollicitiutaseq sollicitiutaesq
sollicitiutaeqs sollicitiuteqas sollicitiuteqsa sollicitiuteaqs sollicitiuteasq sollicitiutesaq sollicitiutesqa
sollicitiuesqta sollicitiuesqat sollicitiuestqa sollicitiuestaq sollicitiuesatq sollicitiuesaqt sollicitiueqsta
sollicitiueqsat sollicitiueqtsa sollicitiueqtas sollicitiueqats sollicitiueqast sollicitiuetqsa sollicitiuetqas
sollicitiuetsqa sollicitiuetsaq sollicitiuetasq sollicitiuetaqs sollicitiueaqts sollicitiueaqst sollicitiueatqs
sollicitiueatsq sollicitiueastq sollicitiueasqt sollicitieasqut sollicitieasqtu sollicitieasuqt sollicitieasutq
sollicitieastuq sollicitieastqu sollicitieaqsut sollicitieaqstu sollicitieaqust sollicitieaquts sollicitieaqtus
sollicitieaqtsu sollicitieauqst sollicitieauqts sollicitieausqt sollicitieaustq sollicitieautsq sollicitieautqs
sollicitieatqus sollicitieatqsu sollicitieatuqs sollicitieatusq sollicitieatsuq sollicitieatsqu sollicitiesaqut
sollicitiesaqtu sollicitiesauqt sollicitiesautq sollicitiesatuq sollicitiesatqu sollicitiesqaut sollicitiesqatu
sollicitiesquat sollicitiesquta sollicitiesqtua sollicitiesqtau sollicitiesuqat sollicitiesuqta sollicitiesuaqt
sollicitiesuatq sollicitiesutaq sollicitiesutqa sollicitiestqua sollicitiestqau sollicitiestuqa sollicitiestuaq
sollicitiestauq sollicitiestaqu sollicitieqsaut sollicitieqsatu sollicitieqsuat sollicitieqsuta sollicitieqstua
sollicitieqstau sollicitieqasut sollicitieqastu sollicitieqaust sollicitieqauts sollicitieqatus sollicitieqatsu
sollicitiequast sollicitiequats sollicitiequsat sollicitiequsta sollicitiequtsa sollicitiequtas sollicitieqtaus
sollicitieqtasu sollicitieqtuas sollicitieqtusa sollicitieqtsua sollicitieqtsau sollicitieusqat sollicitieusqta
sollicitieusaqt sollicitieusatq sollicitieustaq sollicitieustqa sollicitieuqsat sollicitieuqsta sollicitieuqast
sollicitieuqats sollicitieuqtas sollicitieuqtsa sollicitieuaqst sollicitieuaqts sollicitieuasqt sollicitieuastq
sollicitieuatsq sollicitieuatqs sollicitieutqas sollicitieutqsa sollicitieutaqs sollicitieutasq sollicitieutsaq
sollicitieutsqa sollicitietsqua sollicitietsqau sollicitietsuqa sollicitietsuaq sollicitietsauq sollicitietsaqu
sollicitietqsua sollicitietqsau sollicitietqusa sollicitietquas sollicitietqaus sollicitietqasu sollicitietuqsa
sollicitietuqas sollicitietusqa sollicitietusaq sollicitietuasq sollicitietuaqs sollicitietaqus sollicitietaqsu
sollicitietauqs sollicitietausq sollicitietasuq sollicitietasqu sollicitstiaque sollicitstiaqeu sollicitstiauqe
sollicitstiaueq sollicitstiaeuq sollicitstiaequ sollicitstiqaue sollicitstiqaeu sollicitstiquae sollicitstiquea
sollicitstiqeua sollicitstiqeau sollicitstiuqae sollicitstiuqea sollicitstiuaqe sollicitstiuaeq sollicitstiueaq
sollicitstiueqa sollicitstiequa sollicitstieqau sollicitstieuqa sollicitstieuaq sollicitstieauq sollicitstieaqu
sollicitstaique sollicitstaiqeu sollicitstaiuqe sollicitstaiueq sollicitstaieuq sollicitstaiequ sollicitstaqiue
sollicitstaqieu sollicitstaquie sollicitstaquei sollicitstaqeui sollicitstaqeiu sollicitstauqie sollicitstauqei
sollicitstauiqe sollicitstauieq sollicitstaueiq sollicitstaueqi sollicitstaequi sollicitstaeqiu sollicitstaeuqi
sollicitstaeuiq sollicitstaeiuq sollicitstaeiqu sollicitstqaiue sollicitstqaieu sollicitstqauie sollicitstqauei
sollicitstqaeui sollicitstqaeiu sollicitstqiaue sollicitstqiaeu sollicitstqiuae sollicitstqiuea sollicitstqieua
sollicitstqieau sollicitstquiae sollicitstquiea sollicitstquaie sollicitstquaei sollicitstqueai sollicitstqueia
sollicitstqeiua sollicitstqeiau sollicitstqeuia sollicitstqeuai sollicitstqeaui sollicitstqeaiu sollicitstuaqie
sollicitstuaqei sollicitstuaiqe sollicitstuaieq sollicitstuaeiq sollicitstuaeqi sollicitstuqaie sollicitstuqaei
sollicitstuqiae sollicitstuqiea sollicitstuqeia sollicitstuqeai sollicitstuiqae sollicitstuiqea sollicitstuiaqe
sollicitstuiaeq sollicitstuieaq sollicitstuieqa sollicitstueqia sollicitstueqai sollicitstueiqa sollicitstueiaq
sollicitstueaiq sollicitstueaqi sollicitsteaqui sollicitsteaqiu sollicitsteauqi sollicitsteauiq sollicitsteaiuq
sollicitsteaiqu sollicitsteqaui sollicitsteqaiu sollicitstequai sollicitstequia sollicitsteqiua sollicitsteqiau
sollicitsteuqai sollicitsteuqia sollicitsteuaqi sollicitsteuaiq sollicitsteuiaq sollicitsteuiqa sollicitsteiqua
sollicitsteiqau sollicitsteiuqa sollicitsteiuaq sollicitsteiauq sollicitsteiaqu sollicitsitaque sollicitsitaqeu
sollicitsitauqe sollicitsitaueq sollicitsitaeuq sollicitsitaequ sollicitsitqaue sollicitsitqaeu sollicitsitquae
sollicitsitquea sollicitsitqeua sollicitsitqeau sollicitsituqae sollicitsituqea sollicitsituaqe sollicitsituaeq
sollicitsitueaq sollicitsitueqa sollicitsitequa sollicitsiteqau sollicitsiteuqa sollicitsiteuaq sollicitsiteauq
sollicitsiteaqu sollicitsiatque sollicitsiatqeu sollicitsiatuqe sollicitsiatueq sollicitsiateuq sollicitsiatequ
sollicitsiaqtue sollicitsiaqteu sollicitsiaqute sollicitsiaquet sollicitsiaqeut sollicitsiaqetu sollicitsiauqte
sollicitsiauqet sollicitsiautqe sollicitsiauteq sollicitsiauetq sollicitsiaueqt sollicitsiaequt sollicitsiaeqtu
sollicitsiaeuqt sollicitsiaeutq sollicitsiaetuq sollicitsiaetqu sollicitsiqatue sollicitsiqateu sollicitsiqaute
sollicitsiqauet sollicitsiqaeut sollicitsiqaetu sollicitsiqtaue sollicitsiqtaeu sollicitsiqtuae sollicitsiqtuea
sollicitsiqteua sollicitsiqteau sollicitsiqutae sollicitsiqutea sollicitsiquate sollicitsiquaet sollicitsiqueat
sollicitsiqueta sollicitsiqetua sollicitsiqetau sollicitsiqeuta sollicitsiqeuat sollicitsiqeaut sollicitsiqeatu
sollicitsiuaqte sollicitsiuaqet sollicitsiuatqe sollicitsiuateq sollicitsiuaetq sollicitsiuaeqt sollicitsiuqate
sollicitsiuqaet sollicitsiuqtae sollicitsiuqtea sollicitsiuqeta sollicitsiuqeat sollicitsiutqae sollicitsiutqea
sollicitsiutaqe sollicitsiutaeq sollicitsiuteaq sollicitsiuteqa sollicitsiueqta sollicitsiueqat sollicitsiuetqa
sollicitsiuetaq sollicitsiueatq sollicitsiueaqt sollicitsieaqut sollicitsieaqtu sollicitsieauqt sollicitsieautq
sollicitsieatuq sollicitsieatqu sollicitsieqaut sollicitsieqatu sollicitsiequat sollicitsiequta sollicitsieqtua
sollicitsieqtau sollicitsieuqat sollicitsieuqta sollicitsieuaqt sollicitsieuatq sollicitsieutaq sollicitsieutqa
sollicitsietqua sollicitsietqau sollicitsietuqa sollicitsietuaq sollicitsietauq sollicitsietaqu sollicitsaitque
sollicitsaitqeu sollicitsaituqe sollicitsaitueq sollicitsaiteuq sollicitsaitequ sollicitsaiqtue sollicitsaiqteu
sollicitsaiqute sollicitsaiquet sollicitsaiqeut sollicitsaiqetu sollicitsaiuqte sollicitsaiuqet sollicitsaiutqe
sollicitsaiuteq sollicitsaiuetq sollicitsaiueqt sollicitsaiequt sollicitsaieqtu sollicitsaieuqt sollicitsaieutq
sollicitsaietuq sollicitsaietqu sollicitsatique sollicitsatiqeu sollicitsatiuqe sollicitsatiueq sollicitsatieuq
sollicitsatiequ sollicitsatqiue sollicitsatqieu sollicitsatquie sollicitsatquei sollicitsatqeui sollicitsatqeiu
sollicitsatuqie sollicitsatuqei sollicitsatuiqe sollicitsatuieq sollicitsatueiq sollicitsatueqi sollicitsatequi
sollicitsateqiu sollicitsateuqi sollicitsateuiq sollicitsateiuq sollicitsateiqu sollicitsaqtiue sollicitsaqtieu
sollicitsaqtuie sollicitsaqtuei sollicitsaqteui sollicitsaqteiu sollicitsaqitue sollicitsaqiteu sollicitsaqiute
sollicitsaqiuet sollicitsaqieut sollicitsaqietu sollicitsaquite sollicitsaquiet sollicitsaqutie sollicitsaqutei
sollicitsaqueti sollicitsaqueit sollicitsaqeiut sollicitsaqeitu sollicitsaqeuit sollicitsaqeuti sollicitsaqetui
sollicitsaqetiu sollicitsautqie sollicitsautqei sollicitsautiqe sollicitsautieq sollicitsauteiq sollicitsauteqi
sollicitsauqtie sollicitsauqtei sollicitsauqite sollicitsauqiet sollicitsauqeit sollicitsauqeti sollicitsauiqte
sollicitsauiqet sollicitsauitqe sollicitsauiteq sollicitsauietq sollicitsauieqt sollicitsaueqit sollicitsaueqti
sollicitsaueiqt sollicitsaueitq sollicitsauetiq sollicitsauetqi sollicitsaetqui sollicitsaetqiu sollicitsaetuqi
sollicitsaetuiq sollicitsaetiuq sollicitsaetiqu sollicitsaeqtui sollicitsaeqtiu sollicitsaequti sollicitsaequit
sollicitsaeqiut sollicitsaeqitu sollicitsaeuqti sollicitsaeuqit sollicitsaeutqi sollicitsaeutiq sollicitsaeuitq
sollicitsaeuiqt sollicitsaeiqut sollicitsaeiqtu sollicitsaeiuqt sollicitsaeiutq sollicitsaeituq sollicitsaeitqu
sollicitsqiatue sollicitsqiateu sollicitsqiaute sollicitsqiauet sollicitsqiaeut sollicitsqiaetu sollicitsqitaue
sollicitsqitaeu sollicitsqituae sollicitsqituea sollicitsqiteua sollicitsqiteau sollicitsqiutae sollicitsqiutea
sollicitsqiuate sollicitsqiuaet sollicitsqiueat sollicitsqiueta sollicitsqietua sollicitsqietau sollicitsqieuta
sollicitsqieuat sollicitsqieaut sollicitsqieatu sollicitsqaitue sollicitsqaiteu sollicitsqaiute sollicitsqaiuet
sollicitsqaieut sollicitsqaietu sollicitsqatiue sollicitsqatieu sollicitsqatuie sollicitsqatuei sollicitsqateui
sollicitsqateiu sollicitsqautie sollicitsqautei sollicitsqauite sollicitsqauiet sollicitsqaueit sollicitsqaueti
sollicitsqaetui sollicitsqaetiu sollicitsqaeuti sollicitsqaeuit sollicitsqaeiut sollicitsqaeitu sollicitsqtaiue
sollicitsqtaieu sollicitsqtauie sollicitsqtauei sollicitsqtaeui sollicitsqtaeiu sollicitsqtiaue sollicitsqtiaeu
sollicitsqtiuae sollicitsqtiuea sollicitsqtieua sollicitsqtieau sollicitsqtuiae sollicitsqtuiea sollicitsqtuaie
sollicitsqtuaei sollicitsqtueai sollicitsqtueia sollicitsqteiua sollicitsqteiau sollicitsqteuia sollicitsqteuai
sollicitsqteaui sollicitsqteaiu sollicitsquatie sollicitsquatei sollicitsquaite sollicitsquaiet sollicitsquaeit
sollicitsquaeti sollicitsqutaie sollicitsqutaei sollicitsqutiae sollicitsqutiea sollicitsquteia sollicitsquteai
sollicitsquitae sollicitsquitea sollicitsquiate sollicitsquiaet sollicitsquieat sollicitsquieta sollicitsquetia
sollicitsquetai sollicitsqueita sollicitsqueiat sollicitsqueait sollicitsqueati sollicitsqeatui sollicitsqeatiu
sollicitsqeauti sollicitsqeauit sollicitsqeaiut sollicitsqeaitu sollicitsqetaui sollicitsqetaiu sollicitsqetuai
sollicitsqetuia sollicitsqetiua sollicitsqetiau sollicitsqeutai sollicitsqeutia sollicitsqeuati sollicitsqeuait
sollicitsqeuiat sollicitsqeuita sollicitsqeitua sollicitsqeitau sollicitsqeiuta sollicitsqeiuat sollicitsqeiaut
sollicitsqeiatu sollicitsuiaqte sollicitsuiaqet sollicitsuiatqe sollicitsuiateq sollicitsuiaetq sollicitsuiaeqt
sollicitsuiqate sollicitsuiqaet sollicitsuiqtae sollicitsuiqtea sollicitsuiqeta sollicitsuiqeat sollicitsuitqae
sollicitsuitqea sollicitsuitaqe sollicitsuitaeq sollicitsuiteaq sollicitsuiteqa sollicitsuieqta sollicitsuieqat
sollicitsuietqa sollicitsuietaq sollicitsuieatq sollicitsuieaqt sollicitsuaiqte sollicitsuaiqet sollicitsuaitqe
sollicitsuaiteq sollicitsuaietq sollicitsuaieqt sollicitsuaqite sollicitsuaqiet sollicitsuaqtie sollicitsuaqtei
sollicitsuaqeti sollicitsuaqeit sollicitsuatqie sollicitsuatqei sollicitsuatiqe sollicitsuatieq sollicitsuateiq
sollicitsuateqi sollicitsuaeqti sollicitsuaeqit sollicitsuaetqi sollicitsuaetiq sollicitsuaeitq sollicitsuaeiqt
sollicitsuqaite sollicitsuqaiet sollicitsuqatie sollicitsuqatei sollicitsuqaeti sollicitsuqaeit sollicitsuqiate
sollicitsuqiaet sollicitsuqitae sollicitsuqitea sollicitsuqieta sollicitsuqieat sollicitsuqtiae sollicitsuqtiea
sollicitsuqtaie sollicitsuqtaei sollicitsuqteai sollicitsuqteia sollicitsuqeita sollicitsuqeiat sollicitsuqetia
sollicitsuqetai sollicitsuqeati sollicitsuqeait sollicitsutaqie sollicitsutaqei sollicitsutaiqe sollicitsutaieq
sollicitsutaeiq sollicitsutaeqi sollicitsutqaie sollicitsutqaei sollicitsutqiae sollicitsutqiea sollicitsutqeia
sollicitsutqeai sollicitsutiqae sollicitsutiqea sollicitsutiaqe sollicitsutiaeq sollicitsutieaq sollicitsutieqa
sollicitsuteqia sollicitsuteqai sollicitsuteiqa sollicitsuteiaq sollicitsuteaiq sollicitsuteaqi sollicitsueaqti
sollicitsueaqit sollicitsueatqi sollicitsueatiq sollicitsueaitq sollicitsueaiqt sollicitsueqati sollicitsueqait
sollicitsueqtai sollicitsueqtia sollicitsueqita sollicitsueqiat sollicitsuetqai sollicitsuetqia sollicitsuetaqi
sollicitsuetaiq sollicitsuetiaq sollicitsuetiqa sollicitsueiqta sollicitsueiqat sollicitsueitqa sollicitsueitaq
sollicitsueiatq sollicitsueiaqt sollicitseiaqut sollicitseiaqtu sollicitseiauqt sollicitseiautq sollicitseiatuq
sollicitseiatqu sollicitseiqaut sollicitseiqatu sollicitseiquat sollicitseiquta sollicitseiqtua sollicitseiqtau
sollicitseiuqat sollicitseiuqta sollicitseiuaqt sollicitseiuatq sollicitseiutaq sollicitseiutqa sollicitseitqua
sollicitseitqau sollicitseituqa sollicitseituaq sollicitseitauq sollicitseitaqu sollicitseaiqut sollicitseaiqtu
sollicitseaiuqt sollicitseaiutq sollicitseaituq sollicitseaitqu sollicitseaqiut sollicitseaqitu sollicitseaquit
sollicitseaquti sollicitseaqtui sollicitseaqtiu sollicitseauqit sollicitseauqti sollicitseauiqt sollicitseauitq
sollicitseautiq sollicitseautqi sollicitseatqui sollicitseatqiu sollicitseatuqi sollicitseatuiq sollicitseatiuq
sollicitseatiqu sollicitseqaiut sollicitseqaitu sollicitseqauit sollicitseqauti sollicitseqatui sollicitseqatiu
sollicitseqiaut sollicitseqiatu sollicitseqiuat sollicitseqiuta sollicitseqitua sollicitseqitau sollicitsequiat
sollicitsequita sollicitsequait sollicitsequati sollicitsequtai sollicitsequtia sollicitseqtiua sollicitseqtiau
sollicitseqtuia sollicitseqtuai sollicitseqtaui sollicitseqtaiu sollicitseuaqit sollicitseuaqti sollicitseuaiqt
sollicitseuaitq sollicitseuatiq sollicitseuatqi sollicitseuqait sollicitseuqati sollicitseuqiat sollicitseuqita
sollicitseuqtia sollicitseuqtai sollicitseuiqat sollicitseuiqta sollicitseuiaqt sollicitseuiatq sollicitseuitaq
sollicitseuitqa sollicitseutqia sollicitseutqai sollicitseutiqa sollicitseutiaq sollicitseutaiq sollicitseutaqi
sollicitsetaqui sollicitsetaqiu sollicitsetauqi sollicitsetauiq sollicitsetaiuq sollicitsetaiqu sollicitsetqaui
sollicitsetqaiu sollicitsetquai sollicitsetquia sollicitsetqiua sollicitsetqiau sollicitsetuqai sollicitsetuqia
sollicitsetuaqi sollicitsetuaiq sollicitsetuiaq sollicitsetuiqa sollicitsetiqua sollicitsetiqau sollicitsetiuqa
sollicitsetiuaq sollicitsetiauq sollicitsetiaqu sollicitqtisaue sollicitqtisaeu sollicitqtisuae sollicitqtisuea
sollicitqtiseua sollicitqtiseau sollicitqtiasue sollicitqtiaseu sollicitqtiause sollicitqtiaues sollicitqtiaeus
sollicitqtiaesu sollicitqtiuase sollicitqtiuaes sollicitqtiusae sollicitqtiusea sollicitqtiuesa sollicitqtiueas
sollicitqtieaus sollicitqtieasu sollicitqtieuas sollicitqtieusa sollicitqtiesua sollicitqtiesau sollicitqtsiaue
sollicitqtsiaeu sollicitqtsiuae sollicitqtsiuea sollicitqtsieua sollicitqtsieau sollicitqtsaiue sollicitqtsaieu
sollicitqtsauie sollicitqtsauei sollicitqtsaeui sollicitqtsaeiu sollicitqtsuaie sollicitqtsuaei sollicitqtsuiae
sollicitqtsuiea sollicitqtsueia sollicitqtsueai sollicitqtseaui sollicitqtseaiu sollicitqtseuai sollicitqtseuia
sollicitqtseiua sollicitqtseiau sollicitqtasiue sollicitqtasieu sollicitqtasuie sollicitqtasuei sollicitqtaseui
sollicitqtaseiu sollicitqtaisue sollicitqtaiseu sollicitqtaiuse sollicitqtaiues sollicitqtaieus sollicitqtaiesu
sollicitqtauise sollicitqtauies sollicitqtausie sollicitqtausei sollicitqtauesi sollicitqtaueis sollicitqtaeius
sollicitqtaeisu sollicitqtaeuis sollicitqtaeusi sollicitqtaesui sollicitqtaesiu sollicitqtusaie sollicitqtusaei
sollicitqtusiae sollicitqtusiea sollicitqtuseia sollicitqtuseai sollicitqtuasie sollicitqtuasei sollicitqtuaise
sollicitqtuaies sollicitqtuaeis sollicitqtuaesi sollicitqtuiase sollicitqtuiaes sollicitqtuisae sollicitqtuisea
sollicitqtuiesa sollicitqtuieas sollicitqtueais sollicitqtueasi sollicitqtueias sollicitqtueisa sollicitqtuesia
sollicitqtuesai sollicitqtesaui sollicitqtesaiu sollicitqtesuai sollicitqtesuia sollicitqtesiua sollicitqtesiau
sollicitqteasui sollicitqteasiu sollicitqteausi sollicitqteauis sollicitqteaius sollicitqteaisu sollicitqteuasi
sollicitqteuais sollicitqteusai sollicitqteusia sollicitqteuisa sollicitqteuias sollicitqteiaus sollicitqteiasu
sollicitqteiuas sollicitqteiusa sollicitqteisua sollicitqteisau sollicitqitsaue sollicitqitsaeu sollicitqitsuae
sollicitqitsuea sollicitqitseua sollicitqitseau sollicitqitasue sollicitqitaseu sollicitqitause sollicitqitaues
sollicitqitaeus sollicitqitaesu sollicitqituase sollicitqituaes sollicitqitusae sollicitqitusea sollicitqituesa
sollicitqitueas sollicitqiteaus sollicitqiteasu sollicitqiteuas sollicitqiteusa sollicitqitesua sollicitqitesau
sollicitqistaue sollicitqistaeu sollicitqistuae sollicitqistuea sollicitqisteua sollicitqisteau sollicitqisatue
sollicitqisateu sollicitqisaute sollicitqisauet sollicitqisaeut sollicitqisaetu sollicitqisuate sollicitqisuaet
sollicitqisutae sollicitqisutea sollicitqisueta sollicitqisueat sollicitqiseaut sollicitqiseatu sollicitqiseuat
sollicitqiseuta sollicitqisetua sollicitqisetau sollicitqiastue sollicitqiasteu sollicitqiasute sollicitqiasuet
sollicitqiaseut sollicitqiasetu sollicitqiatsue sollicitqiatseu sollicitqiatuse sollicitqiatues sollicitqiateus
sollicitqiatesu sollicitqiautse sollicitqiautes sollicitqiauste sollicitqiauset sollicitqiauest sollicitqiauets
sollicitqiaetus sollicitqiaetsu sollicitqiaeuts sollicitqiaeust sollicitqiaesut sollicitqiaestu sollicitqiusate
sollicitqiusaet sollicitqiustae sollicitqiustea sollicitqiuseta sollicitqiuseat sollicitqiuaste sollicitqiuaset
sollicitqiuatse sollicitqiuates sollicitqiuaets sollicitqiuaest sollicitqiutase sollicitqiutaes sollicitqiutsae
sollicitqiutsea sollicitqiutesa sollicitqiuteas sollicitqiueats sollicitqiueast sollicitqiuetas sollicitqiuetsa
sollicitqiuesta sollicitqiuesat sollicitqiesaut sollicitqiesatu sollicitqiesuat sollicitqiesuta sollicitqiestua
sollicitqiestau sollicitqieasut sollicitqieastu sollicitqieaust sollicitqieauts sollicitqieatus sollicitqieatsu
sollicitqieuast sollicitqieuats sollicitqieusat sollicitqieusta sollicitqieutsa sollicitqieutas sollicitqietaus
sollicitqietasu sollicitqietuas sollicitqietusa sollicitqietsua sollicitqietsau sollicitqsitaue sollicitqsitaeu
sollicitqsituae sollicitqsituea sollicitqsiteua sollicitqsiteau sollicitqsiatue sollicitqsiateu sollicitqsiaute
sollicitqsiauet sollicitqsiaeut sollicitqsiaetu sollicitqsiuate sollicitqsiuaet sollicitqsiutae sollicitqsiutea
sollicitqsiueta sollicitqsiueat sollicitqsieaut sollicitqsieatu sollicitqsieuat sollicitqsieuta sollicitqsietua
sollicitqsietau sollicitqstiaue sollicitqstiaeu sollicitqstiuae sollicitqstiuea sollicitqstieua sollicitqstieau
sollicitqstaiue sollicitqstaieu sollicitqstauie sollicitqstauei sollicitqstaeui sollicitqstaeiu sollicitqstuaie
sollicitqstuaei sollicitqstuiae sollicitqstuiea sollicitqstueia sollicitqstueai sollicitqsteaui sollicitqsteaiu
sollicitqsteuai sollicitqsteuia sollicitqsteiua sollicitqsteiau sollicitqsatiue sollicitqsatieu sollicitqsatuie
sollicitqsatuei sollicitqsateui sollicitqsateiu sollicitqsaitue sollicitqsaiteu sollicitqsaiute sollicitqsaiuet
sollicitqsaieut sollicitqsaietu sollicitqsauite sollicitqsauiet sollicitqsautie sollicitqsautei sollicitqsaueti
sollicitqsaueit sollicitqsaeiut sollicitqsaeitu sollicitqsaeuit sollicitqsaeuti sollicitqsaetui sollicitqsaetiu
sollicitqsutaie sollicitqsutaei sollicitqsutiae sollicitqsutiea sollicitqsuteia sollicitqsuteai sollicitqsuatie
sollicitqsuatei sollicitqsuaite sollicitqsuaiet sollicitqsuaeit sollicitqsuaeti sollicitqsuiate sollicitqsuiaet
sollicitqsuitae sollicitqsuitea sollicitqsuieta sollicitqsuieat sollicitqsueait sollicitqsueati sollicitqsueiat
sollicitqsueita sollicitqsuetia sollicitqsuetai sollicitqsetaui sollicitqsetaiu sollicitqsetuai sollicitqsetuia
sollicitqsetiua sollicitqsetiau sollicitqseatui sollicitqseatiu sollicitqseauti sollicitqseauit sollicitqseaiut
sollicitqseaitu sollicitqseuati sollicitqseuait sollicitqseutai sollicitqseutia sollicitqseuita sollicitqseuiat
sollicitqseiaut sollicitqseiatu sollicitqseiuat sollicitqseiuta sollicitqseitua sollicitqseitau sollicitqaistue
sollicitqaisteu sollicitqaisute sollicitqaisuet sollicitqaiseut sollicitqaisetu sollicitqaitsue sollicitqaitseu
sollicitqaituse sollicitqaitues sollicitqaiteus sollicitqaitesu sollicitqaiutse sollicitqaiutes sollicitqaiuste
sollicitqaiuset sollicitqaiuest sollicitqaiuets sollicitqaietus sollicitqaietsu sollicitqaieuts sollicitqaieust
sollicitqaiesut sollicitqaiestu sollicitqasitue sollicitqasiteu sollicitqasiute sollicitqasiuet sollicitqasieut
sollicitqasietu sollicitqastiue sollicitqastieu sollicitqastuie sollicitqastuei sollicitqasteui sollicitqasteiu
sollicitqasutie sollicitqasutei sollicitqasuite sollicitqasuiet sollicitqasueit sollicitqasueti sollicitqasetui
sollicitqasetiu sollicitqaseuti sollicitqaseuit sollicitqaseiut sollicitqaseitu sollicitqatsiue sollicitqatsieu
sollicitqatsuie sollicitqatsuei sollicitqatseui sollicitqatseiu sollicitqatisue sollicitqatiseu sollicitqatiuse
sollicitqatiues sollicitqatieus sollicitqatiesu sollicitqatuise sollicitqatuies sollicitqatusie sollicitqatusei
sollicitqatuesi sollicitqatueis sollicitqateius sollicitqateisu sollicitqateuis sollicitqateusi sollicitqatesui
sollicitqatesiu sollicitqaustie sollicitqaustei sollicitqausite sollicitqausiet sollicitqauseit sollicitqauseti
sollicitqautsie sollicitqautsei sollicitqautise sollicitqauties sollicitqauteis sollicitqautesi sollicitqauitse
sollicitqauites sollicitqauiste sollicitqauiset sollicitqauiest sollicitqauiets sollicitqauetis sollicitqauetsi
sollicitqaueits sollicitqaueist sollicitqauesit sollicitqauesti sollicitqaestui sollicitqaestiu sollicitqaesuti
sollicitqaesuit sollicitqaesiut sollicitqaesitu sollicitqaetsui sollicitqaetsiu sollicitqaetusi sollicitqaetuis
sollicitqaetius sollicitqaetisu sollicitqaeutsi sollicitqaeutis sollicitqaeusti sollicitqaeusit sollicitqaeuist
sollicitqaeuits sollicitqaeitus sollicitqaeitsu sollicitqaeiuts sollicitqaeiust sollicitqaeisut sollicitqaeistu
sollicitquisate sollicitquisaet sollicitquistae sollicitquistea sollicitquiseta sollicitquiseat sollicitquiaste
sollicitquiaset sollicitquiatse sollicitquiates sollicitquiaets sollicitquiaest sollicitquitase sollicitquitaes
sollicitquitsae sollicitquitsea sollicitquitesa sollicitquiteas sollicitquieats sollicitquieast sollicitquietas
sollicitquietsa sollicitquiesta sollicitquiesat sollicitqusiate sollicitqusiaet sollicitqusitae sollicitqusitea
sollicitqusieta sollicitqusieat sollicitqusaite sollicitqusaiet sollicitqusatie sollicitqusatei sollicitqusaeti
sollicitqusaeit sollicitqustaie sollicitqustaei sollicitqustiae sollicitqustiea sollicitqusteia sollicitqusteai
sollicitquseati sollicitquseait sollicitqusetai sollicitqusetia sollicitquseita sollicitquseiat sollicitquasite
sollicitquasiet sollicitquastie sollicitquastei sollicitquaseti sollicitquaseit sollicitquaiste sollicitquaiset
sollicitquaitse sollicitquaites sollicitquaiets sollicitquaiest sollicitquatise sollicitquaties sollicitquatsie
sollicitquatsei sollicitquatesi sollicitquateis sollicitquaeits sollicitquaeist sollicitquaetis sollicitquaetsi
sollicitquaesti sollicitquaesit sollicitqutsaie sollicitqutsaei sollicitqutsiae sollicitqutsiea sollicitqutseia
sollicitqutseai sollicitqutasie sollicitqutasei sollicitqutaise sollicitqutaies sollicitqutaeis sollicitqutaesi
sollicitqutiase sollicitqutiaes sollicitqutisae sollicitqutisea sollicitqutiesa sollicitqutieas sollicitquteais
sollicitquteasi sollicitquteias sollicitquteisa sollicitqutesia sollicitqutesai sollicitquesati sollicitquesait
sollicitquestai sollicitquestia sollicitquesita sollicitquesiat sollicitqueasti sollicitqueasit sollicitqueatsi
sollicitqueatis sollicitqueaits sollicitqueaist sollicitquetasi sollicitquetais sollicitquetsai sollicitquetsia
sollicitquetisa sollicitquetias sollicitqueiats sollicitqueiast sollicitqueitas sollicitqueitsa sollicitqueista
sollicitqueisat sollicitqeisaut sollicitqeisatu sollicitqeisuat sollicitqeisuta sollicitqeistua sollicitqeistau
sollicitqeiasut sollicitqeiastu sollicitqeiaust sollicitqeiauts sollicitqeiatus sollicitqeiatsu sollicitqeiuast
sollicitqeiuats sollicitqeiusat sollicitqeiusta sollicitqeiutsa sollicitqeiutas sollicitqeitaus sollicitqeitasu
sollicitqeituas sollicitqeitusa sollicitqeitsua sollicitqeitsau sollicitqesiaut sollicitqesiatu sollicitqesiuat
sollicitqesiuta sollicitqesitua sollicitqesitau sollicitqesaiut sollicitqesaitu sollicitqesauit sollicitqesauti
sollicitqesatui sollicitqesatiu sollicitqesuait sollicitqesuati sollicitqesuiat sollicitqesuita sollicitqesutia
sollicitqesutai sollicitqestaui sollicitqestaiu sollicitqestuai sollicitqestuia sollicitqestiua sollicitqestiau
sollicitqeasiut sollicitqeasitu sollicitqeasuit sollicitqeasuti sollicitqeastui sollicitqeastiu sollicitqeaisut
sollicitqeaistu sollicitqeaiust sollicitqeaiuts sollicitqeaitus sollicitqeaitsu sollicitqeauist sollicitqeauits
sollicitqeausit sollicitqeausti sollicitqeautsi sollicitqeautis sollicitqeatius sollicitqeatisu sollicitqeatuis
sollicitqeatusi sollicitqeatsui sollicitqeatsiu sollicitqeusait sollicitqeusati sollicitqeusiat sollicitqeusita
sollicitqeustia sollicitqeustai sollicitqeuasit sollicitqeuasti sollicitqeuaist sollicitqeuaits sollicitqeuatis
sollicitqeuatsi sollicitqeuiast sollicitqeuiats sollicitqeuisat sollicitqeuista sollicitqeuitsa sollicitqeuitas
sollicitqeutais sollicitqeutasi sollicitqeutias sollicitqeutisa sollicitqeutsia sollicitqeutsai sollicitqetsaui
sollicitqetsaiu sollicitqetsuai sollicitqetsuia sollicitqetsiua sollicitqetsiau sollicitqetasui sollicitqetasiu
sollicitqetausi sollicitqetauis sollicitqetaius sollicitqetaisu sollicitqetuasi sollicitqetuais sollicitqetusai
sollicitqetusia sollicitqetuisa sollicitqetuias sollicitqetiaus sollicitqetiasu sollicitqetiuas sollicitqetiusa
sollicitqetisua sollicitqetisau sollicitutisqae sollicitutisqea sollicitutisaqe sollicitutisaeq sollicitutiseaq
sollicitutiseqa sollicitutiqsae sollicitutiqsea sollicitutiqase sollicitutiqaes sollicitutiqeas sollicitutiqesa
sollicitutiaqse sollicitutiaqes sollicitutiasqe sollicitutiaseq sollicitutiaesq sollicitutiaeqs sollicitutieqas
sollicitutieqsa sollicitutieaqs sollicitutieasq sollicitutiesaq sollicitutiesqa sollicitutsiqae sollicitutsiqea
sollicitutsiaqe sollicitutsiaeq sollicitutsieaq sollicitutsieqa sollicitutsqiae sollicitutsqiea sollicitutsqaie
sollicitutsqaei sollicitutsqeai sollicitutsqeia sollicitutsaqie sollicitutsaqei sollicitutsaiqe sollicitutsaieq
sollicitutsaeiq sollicitutsaeqi sollicitutseqai sollicitutseqia sollicitutseaqi sollicitutseaiq sollicitutseiaq
sollicitutseiqa sollicitutqsiae sollicitutqsiea sollicitutqsaie sollicitutqsaei sollicitutqseai sollicitutqseia
sollicitutqisae sollicitutqisea sollicitutqiase sollicitutqiaes sollicitutqieas sollicitutqiesa sollicitutqaise
sollicitutqaies sollicitutqasie sollicitutqasei sollicitutqaesi sollicitutqaeis sollicitutqeias sollicitutqeisa
sollicitutqeais sollicitutqeasi sollicitutqesai sollicitutqesia sollicitutasqie sollicitutasqei sollicitutasiqe
sollicitutasieq sollicitutaseiq sollicitutaseqi sollicitutaqsie sollicitutaqsei sollicitutaqise sollicitutaqies
sollicitutaqeis sollicitutaqesi sollicitutaiqse sollicitutaiqes sollicitutaisqe sollicitutaiseq sollicitutaiesq
sollicitutaieqs sollicitutaeqis sollicitutaeqsi sollicitutaeiqs sollicitutaeisq sollicitutaesiq sollicitutaesqi
sollicitutesqai sollicitutesqia sollicitutesaqi sollicitutesaiq sollicitutesiaq sollicitutesiqa sollicituteqsai
sollicituteqsia sollicituteqasi sollicituteqais sollicituteqias sollicituteqisa sollicituteaqsi sollicituteaqis
sollicituteasqi sollicituteasiq sollicituteaisq sollicituteaiqs sollicituteiqas sollicituteiqsa sollicituteiaqs
sollicituteiasq sollicituteisaq sollicituteisqa sollicituitsqae sollicituitsqea sollicituitsaqe sollicituitsaeq
sollicituitseaq sollicituitseqa sollicituitqsae sollicituitqsea sollicituitqase sollicituitqaes sollicituitqeas
sollicituitqesa sollicituitaqse sollicituitaqes sollicituitasqe sollicituitaseq sollicituitaesq sollicituitaeqs
sollicituiteqas sollicituiteqsa sollicituiteaqs sollicituiteasq sollicituitesaq sollicituitesqa sollicituistqae
sollicituistqea sollicituistaqe sollicituistaeq sollicituisteaq sollicituisteqa sollicituisqtae sollicituisqtea
sollicituisqate sollicituisqaet sollicituisqeat sollicituisqeta sollicituisaqte sollicituisaqet sollicituisatqe
sollicituisateq sollicituisaetq sollicituisaeqt sollicituiseqat sollicituiseqta sollicituiseaqt sollicituiseatq
sollicituisetaq sollicituisetqa sollicituiqstae sollicituiqstea sollicituiqsate sollicituiqsaet sollicituiqseat
sollicituiqseta sollicituiqtsae sollicituiqtsea sollicituiqtase sollicituiqtaes sollicituiqteas sollicituiqtesa
sollicituiqatse sollicituiqates sollicituiqaste sollicituiqaset sollicituiqaest sollicituiqaets sollicituiqetas
sollicituiqetsa sollicituiqeats sollicituiqeast sollicituiqesat sollicituiqesta sollicituiasqte sollicituiasqet
sollicituiastqe sollicituiasteq sollicituiasetq sollicituiaseqt sollicituiaqste sollicituiaqset sollicituiaqtse
sollicituiaqtes sollicituiaqets sollicituiaqest sollicituiatqse sollicituiatqes sollicituiatsqe sollicituiatseq
sollicituiatesq sollicituiateqs sollicituiaeqts sollicituiaeqst sollicituiaetqs sollicituiaetsq sollicituiaestq
sollicituiaesqt sollicituiesqat sollicituiesqta sollicituiesaqt sollicituiesatq sollicituiestaq sollicituiestqa
sollicituieqsat sollicituieqsta sollicituieqast sollicituieqats sollicituieqtas sollicituieqtsa sollicituieaqst
sollicituieaqts sollicituieasqt sollicituieastq sollicituieatsq sollicituieatqs sollicituietqas sollicituietqsa
sollicituietaqs sollicituietasq sollicituietsaq sollicituietsqa sollicitusitqae sollicitusitqea sollicitusitaqe
sollicitusitaeq sollicitusiteaq sollicitusiteqa sollicitusiqtae sollicitusiqtea sollicitusiqate sollicitusiqaet
sollicitusiqeat sollicitusiqeta sollicitusiaqte sollicitusiaqet sollicitusiatqe sollicitusiateq sollicitusiaetq
sollicitusiaeqt sollicitusieqat sollicitusieqta sollicitusieaqt sollicitusieatq sollicitusietaq sollicitusietqa
sollicitustiqae sollicitustiqea sollicitustiaqe sollicitustiaeq sollicitustieaq sollicitustieqa sollicitustqiae
sollicitustqiea sollicitustqaie sollicitustqaei sollicitustqeai sollicitustqeia sollicitustaqie sollicitustaqei
sollicitustaiqe sollicitustaieq sollicitustaeiq sollicitustaeqi sollicitusteqai sollicitusteqia sollicitusteaqi
sollicitusteaiq sollicitusteiaq sollicitusteiqa sollicitusqtiae sollicitusqtiea sollicitusqtaie sollicitusqtaei
sollicitusqteai sollicitusqteia sollicitusqitae sollicitusqitea sollicitusqiate sollicitusqiaet sollicitusqieat
sollicitusqieta sollicitusqaite sollicitusqaiet sollicitusqatie sollicitusqatei sollicitusqaeti sollicitusqaeit
sollicitusqeiat sollicitusqeita sollicitusqeait sollicitusqeati sollicitusqetai sollicitusqetia sollicitusatqie
sollicitusatqei sollicitusatiqe sollicitusatieq sollicitusateiq sollicitusateqi sollicitusaqtie sollicitusaqtei
sollicitusaqite sollicitusaqiet sollicitusaqeit sollicitusaqeti sollicitusaiqte sollicitusaiqet sollicitusaitqe
sollicitusaiteq sollicitusaietq sollicitusaieqt sollicitusaeqit sollicitusaeqti sollicitusaeiqt sollicitusaeitq
sollicitusaetiq sollicitusaetqi sollicitusetqai sollicitusetqia sollicitusetaqi sollicitusetaiq sollicitusetiaq
sollicitusetiqa sollicituseqtai sollicituseqtia sollicituseqati sollicituseqait sollicituseqiat sollicituseqita
sollicituseaqti sollicituseaqit sollicituseatqi sollicituseatiq sollicituseaitq sollicituseaiqt sollicituseiqat
sollicituseiqta sollicituseiaqt sollicituseiatq sollicituseitaq sollicituseitqa sollicituqistae sollicituqistea
sollicituqisate sollicituqisaet sollicituqiseat sollicituqiseta sollicituqitsae sollicituqitsea sollicituqitase
sollicituqitaes sollicituqiteas sollicituqitesa sollicituqiatse sollicituqiates sollicituqiaste sollicituqiaset
sollicituqiaest sollicituqiaets sollicituqietas sollicituqietsa sollicituqieats sollicituqieast sollicituqiesat
sollicituqiesta sollicituqsitae sollicituqsitea sollicituqsiate sollicituqsiaet sollicituqsieat sollicituqsieta
sollicituqstiae sollicituqstiea sollicituqstaie sollicituqstaei sollicituqsteai sollicituqsteia sollicituqsatie
sollicituqsatei sollicituqsaite sollicituqsaiet sollicituqsaeit sollicituqsaeti sollicituqsetai sollicituqsetia
sollicituqseati sollicituqseait sollicituqseiat sollicituqseita sollicituqtsiae sollicituqtsiea sollicituqtsaie
sollicituqtsaei sollicituqtseai sollicituqtseia sollicituqtisae sollicituqtisea sollicituqtiase sollicituqtiaes
sollicituqtieas sollicituqtiesa sollicituqtaise sollicituqtaies sollicituqtasie sollicituqtasei sollicituqtaesi
sollicituqtaeis sollicituqteias sollicituqteisa sollicituqteais sollicituqteasi sollicituqtesai sollicituqtesia
sollicituqastie sollicituqastei sollicituqasite sollicituqasiet sollicituqaseit sollicituqaseti sollicituqatsie
sollicituqatsei sollicituqatise sollicituqaties sollicituqateis sollicituqatesi sollicituqaitse sollicituqaites
sollicituqaiste sollicituqaiset sollicituqaiest sollicituqaiets sollicituqaetis sollicituqaetsi sollicituqaeits
sollicituqaeist sollicituqaesit sollicituqaesti sollicituqestai sollicituqestia sollicituqesati sollicituqesait
sollicituqesiat sollicituqesita sollicituqetsai sollicituqetsia sollicituqetasi sollicituqetais sollicituqetias
sollicituqetisa sollicituqeatsi sollicituqeatis sollicituqeasti sollicituqeasit sollicituqeaist sollicituqeaits
sollicituqeitas sollicituqeitsa sollicituqeiats sollicituqeiast sollicituqeisat sollicituqeista sollicituaisqte
sollicituaisqet sollicituaistqe sollicituaisteq sollicituaisetq sollicituaiseqt sollicituaiqste sollicituaiqset
sollicituaiqtse sollicituaiqtes sollicituaiqets sollicituaiqest sollicituaitqse sollicituaitqes sollicituaitsqe
sollicituaitseq sollicituaitesq sollicituaiteqs sollicituaieqts sollicituaieqst sollicituaietqs sollicituaietsq
sollicituaiestq sollicituaiesqt sollicituasiqte sollicituasiqet sollicituasitqe sollicituasiteq sollicituasietq
sollicituasieqt sollicituasqite sollicituasqiet sollicituasqtie sollicituasqtei sollicituasqeti sollicituasqeit
sollicituastqie sollicituastqei sollicituastiqe sollicituastieq sollicituasteiq sollicituasteqi sollicituaseqti
sollicituaseqit sollicituasetqi sollicituasetiq sollicituaseitq sollicituaseiqt sollicituaqsite sollicituaqsiet
sollicituaqstie sollicituaqstei sollicituaqseti sollicituaqseit sollicituaqiste sollicituaqiset sollicituaqitse
sollicituaqites sollicituaqiets sollicituaqiest sollicituaqtise sollicituaqties sollicituaqtsie sollicituaqtsei
sollicituaqtesi sollicituaqteis sollicituaqeits sollicituaqeist sollicituaqetis sollicituaqetsi sollicituaqesti
sollicituaqesit sollicituatsqie sollicituatsqei sollicituatsiqe sollicituatsieq sollicituatseiq sollicituatseqi
sollicituatqsie sollicituatqsei sollicituatqise sollicituatqies sollicituatqeis sollicituatqesi sollicituatiqse
sollicituatiqes sollicituatisqe sollicituatiseq sollicituatiesq sollicituatieqs sollicituateqis sollicituateqsi
sollicituateiqs sollicituateisq sollicituatesiq sollicituatesqi sollicituaesqti sollicituaesqit sollicituaestqi
sollicituaestiq sollicituaesitq sollicituaesiqt sollicituaeqsti sollicituaeqsit sollicituaeqtsi sollicituaeqtis
sollicituaeqits sollicituaeqist sollicituaetqsi sollicituaetqis sollicituaetsqi sollicituaetsiq sollicituaetisq
sollicituaetiqs sollicituaeiqts sollicituaeiqst sollicituaeitqs sollicituaeitsq sollicituaeistq sollicituaeisqt
sollicitueisqat sollicitueisqta sollicitueisaqt sollicitueisatq sollicitueistaq sollicitueistqa sollicitueiqsat
sollicitueiqsta sollicitueiqast sollicitueiqats sollicitueiqtas sollicitueiqtsa sollicitueiaqst sollicitueiaqts
sollicitueiasqt sollicitueiastq sollicitueiatsq sollicitueiatqs sollicitueitqas sollicitueitqsa sollicitueitaqs
sollicitueitasq sollicitueitsaq sollicitueitsqa sollicituesiqat sollicituesiqta sollicituesiaqt sollicituesiatq
sollicituesitaq sollicituesitqa sollicituesqiat sollicituesqita sollicituesqait sollicituesqati sollicituesqtai
sollicituesqtia sollicituesaqit sollicituesaqti sollicituesaiqt sollicituesaitq sollicituesatiq sollicituesatqi
sollicituestqai sollicituestqia sollicituestaqi sollicituestaiq sollicituestiaq sollicituestiqa sollicitueqsiat
sollicitueqsita sollicitueqsait sollicitueqsati sollicitueqstai sollicitueqstia sollicitueqisat sollicitueqista
sollicitueqiast sollicitueqiats sollicitueqitas sollicitueqitsa sollicitueqaist sollicitueqaits sollicitueqasit
sollicitueqasti sollicitueqatsi sollicitueqatis sollicitueqtias sollicitueqtisa sollicitueqtais sollicitueqtasi
sollicitueqtsai sollicitueqtsia sollicitueasqit sollicitueasqti sollicitueasiqt sollicitueasitq sollicitueastiq
sollicitueastqi sollicitueaqsit sollicitueaqsti sollicitueaqist sollicitueaqits sollicitueaqtis sollicitueaqtsi
sollicitueaiqst sollicitueaiqts sollicitueaisqt sollicitueaistq sollicitueaitsq sollicitueaitqs sollicitueatqis
sollicitueatqsi sollicitueatiqs sollicitueatisq sollicitueatsiq sollicitueatsqi sollicituetsqai sollicituetsqia
sollicituetsaqi sollicituetsaiq sollicituetsiaq sollicituetsiqa sollicituetqsai sollicituetqsia sollicituetqasi
sollicituetqais sollicituetqias sollicituetqisa sollicituetaqsi sollicituetaqis sollicituetasqi sollicituetasiq
sollicituetaisq sollicituetaiqs sollicituetiqas sollicituetiqsa sollicituetiaqs sollicituetiasq sollicituetisaq
sollicituetisqa sollicitetisqua sollicitetisqau sollicitetisuqa sollicitetisuaq sollicitetisauq sollicitetisaqu
sollicitetiqsua sollicitetiqsau sollicitetiqusa sollicitetiquas sollicitetiqaus sollicitetiqasu sollicitetiuqsa
sollicitetiuqas sollicitetiusqa sollicitetiusaq sollicitetiuasq sollicitetiuaqs sollicitetiaqus sollicitetiaqsu
sollicitetiauqs sollicitetiausq sollicitetiasuq sollicitetiasqu sollicitetsiqua sollicitetsiqau sollicitetsiuqa
sollicitetsiuaq sollicitetsiauq sollicitetsiaqu sollicitetsqiua sollicitetsqiau sollicitetsquia sollicitetsquai
sollicitetsqaui sollicitetsqaiu sollicitetsuqia sollicitetsuqai sollicitetsuiqa sollicitetsuiaq sollicitetsuaiq
sollicitetsuaqi sollicitetsaqui sollicitetsaqiu sollicitetsauqi sollicitetsauiq sollicitetsaiuq sollicitetsaiqu
sollicitetqsiua sollicitetqsiau sollicitetqsuia sollicitetqsuai sollicitetqsaui sollicitetqsaiu sollicitetqisua
sollicitetqisau sollicitetqiusa sollicitetqiuas sollicitetqiaus sollicitetqiasu sollicitetquisa sollicitetquias
sollicitetqusia sollicitetqusai sollicitetquasi sollicitetquais sollicitetqaius sollicitetqaisu sollicitetqauis
sollicitetqausi sollicitetqasui sollicitetqasiu sollicitetusqia sollicitetusqai sollicitetusiqa sollicitetusiaq
sollicitetusaiq sollicitetusaqi sollicitetuqsia sollicitetuqsai sollicitetuqisa sollicitetuqias sollicitetuqais
sollicitetuqasi sollicitetuiqsa sollicitetuiqas sollicitetuisqa sollicitetuisaq sollicitetuiasq sollicitetuiaqs
sollicitetuaqis sollicitetuaqsi sollicitetuaiqs sollicitetuaisq sollicitetuasiq sollicitetuasqi sollicitetasqui
sollicitetasqiu sollicitetasuqi sollicitetasuiq sollicitetasiuq sollicitetasiqu sollicitetaqsui sollicitetaqsiu
sollicitetaqusi sollicitetaquis sollicitetaqius sollicitetaqisu sollicitetauqsi sollicitetauqis sollicitetausqi
sollicitetausiq sollicitetauisq sollicitetauiqs sollicitetaiqus sollicitetaiqsu sollicitetaiuqs sollicitetaiusq
sollicitetaisuq sollicitetaisqu solliciteitsqua solliciteitsqau solliciteitsuqa solliciteitsuaq solliciteitsauq
solliciteitsaqu solliciteitqsua solliciteitqsau solliciteitqusa solliciteitquas solliciteitqaus solliciteitqasu
solliciteituqsa solliciteituqas solliciteitusqa solliciteitusaq solliciteituasq solliciteituaqs solliciteitaqus
solliciteitaqsu solliciteitauqs solliciteitausq solliciteitasuq solliciteitasqu solliciteistqua solliciteistqau
solliciteistuqa solliciteistuaq solliciteistauq solliciteistaqu solliciteisqtua solliciteisqtau solliciteisquta
solliciteisquat solliciteisqaut solliciteisqatu solliciteisuqta solliciteisuqat solliciteisutqa solliciteisutaq
solliciteisuatq solliciteisuaqt solliciteisaqut solliciteisaqtu solliciteisauqt solliciteisautq solliciteisatuq
solliciteisatqu solliciteiqstua solliciteiqstau solliciteiqsuta solliciteiqsuat solliciteiqsaut solliciteiqsatu
solliciteiqtsua solliciteiqtsau solliciteiqtusa solliciteiqtuas solliciteiqtaus solliciteiqtasu solliciteiqutsa
solliciteiqutas solliciteiqusta solliciteiqusat solliciteiquast solliciteiquats solliciteiqatus solliciteiqatsu
solliciteiqauts solliciteiqaust solliciteiqasut solliciteiqastu solliciteiusqta solliciteiusqat solliciteiustqa
solliciteiustaq solliciteiusatq solliciteiusaqt solliciteiuqsta solliciteiuqsat solliciteiuqtsa solliciteiuqtas
solliciteiuqats solliciteiuqast solliciteiutqsa solliciteiutqas solliciteiutsqa solliciteiutsaq solliciteiutasq
solliciteiutaqs solliciteiuaqts solliciteiuaqst solliciteiuatqs solliciteiuatsq solliciteiuastq solliciteiuasqt
solliciteiasqut solliciteiasqtu solliciteiasuqt solliciteiasutq solliciteiastuq solliciteiastqu solliciteiaqsut
solliciteiaqstu solliciteiaqust solliciteiaquts solliciteiaqtus solliciteiaqtsu solliciteiauqst solliciteiauqts
solliciteiausqt solliciteiaustq solliciteiautsq solliciteiautqs solliciteiatqus solliciteiatqsu solliciteiatuqs
solliciteiatusq solliciteiatsuq solliciteiatsqu sollicitesitqua sollicitesitqau sollicitesituqa sollicitesituaq
sollicitesitauq sollicitesitaqu sollicitesiqtua sollicitesiqtau sollicitesiquta sollicitesiquat sollicitesiqaut
sollicitesiqatu sollicitesiuqta sollicitesiuqat sollicitesiutqa sollicitesiutaq sollicitesiuatq sollicitesiuaqt
sollicitesiaqut sollicitesiaqtu sollicitesiauqt sollicitesiautq sollicitesiatuq sollicitesiatqu sollicitestiqua
sollicitestiqau sollicitestiuqa sollicitestiuaq sollicitestiauq sollicitestiaqu sollicitestqiua sollicitestqiau
sollicitestquia sollicitestquai sollicitestqaui sollicitestqaiu sollicitestuqia sollicitestuqai sollicitestuiqa
sollicitestuiaq sollicitestuaiq sollicitestuaqi sollicitestaqui sollicitestaqiu sollicitestauqi sollicitestauiq
sollicitestaiuq sollicitestaiqu sollicitesqtiua sollicitesqtiau sollicitesqtuia sollicitesqtuai sollicitesqtaui
sollicitesqtaiu sollicitesqitua sollicitesqitau sollicitesqiuta sollicitesqiuat sollicitesqiaut sollicitesqiatu
sollicitesquita sollicitesquiat sollicitesqutia sollicitesqutai sollicitesquati sollicitesquait sollicitesqaiut
sollicitesqaitu sollicitesqauit sollicitesqauti sollicitesqatui sollicitesqatiu sollicitesutqia sollicitesutqai
sollicitesutiqa sollicitesutiaq sollicitesutaiq sollicitesutaqi sollicitesuqtia sollicitesuqtai sollicitesuqita
sollicitesuqiat sollicitesuqait sollicitesuqati sollicitesuiqta sollicitesuiqat sollicitesuitqa sollicitesuitaq
sollicitesuiatq sollicitesuiaqt sollicitesuaqit sollicitesuaqti sollicitesuaiqt sollicitesuaitq sollicitesuatiq
sollicitesuatqi sollicitesatqui sollicitesatqiu sollicitesatuqi sollicitesatuiq sollicitesatiuq sollicitesatiqu
sollicitesaqtui sollicitesaqtiu sollicitesaquti sollicitesaquit sollicitesaqiut sollicitesaqitu sollicitesauqti
sollicitesauqit sollicitesautqi sollicitesautiq sollicitesauitq sollicitesauiqt sollicitesaiqut sollicitesaiqtu
sollicitesaiuqt sollicitesaiutq sollicitesaituq sollicitesaitqu solliciteqistua solliciteqistau solliciteqisuta
solliciteqisuat solliciteqisaut solliciteqisatu solliciteqitsua solliciteqitsau solliciteqitusa solliciteqituas
solliciteqitaus solliciteqitasu solliciteqiutsa solliciteqiutas solliciteqiusta solliciteqiusat solliciteqiuast
solliciteqiuats solliciteqiatus solliciteqiatsu solliciteqiauts solliciteqiaust solliciteqiasut solliciteqiastu
solliciteqsitua solliciteqsitau solliciteqsiuta solliciteqsiuat solliciteqsiaut solliciteqsiatu solliciteqstiua
solliciteqstiau solliciteqstuia solliciteqstuai solliciteqstaui solliciteqstaiu solliciteqsutia solliciteqsutai
solliciteqsuita solliciteqsuiat solliciteqsuait solliciteqsuati solliciteqsatui solliciteqsatiu solliciteqsauti
solliciteqsauit solliciteqsaiut solliciteqsaitu solliciteqtsiua solliciteqtsiau solliciteqtsuia solliciteqtsuai
solliciteqtsaui solliciteqtsaiu solliciteqtisua solliciteqtisau solliciteqtiusa solliciteqtiuas solliciteqtiaus
solliciteqtiasu solliciteqtuisa solliciteqtuias solliciteqtusia solliciteqtusai solliciteqtuasi solliciteqtuais
solliciteqtaius solliciteqtaisu solliciteqtauis solliciteqtausi solliciteqtasui solliciteqtasiu sollicitequstia
sollicitequstai sollicitequsita sollicitequsiat sollicitequsait sollicitequsati sollicitequtsia sollicitequtsai
sollicitequtisa sollicitequtias sollicitequtais sollicitequtasi sollicitequitsa sollicitequitas sollicitequista
sollicitequisat sollicitequiast sollicitequiats sollicitequatis sollicitequatsi sollicitequaits sollicitequaist
sollicitequasit sollicitequasti solliciteqastui solliciteqastiu solliciteqasuti solliciteqasuit solliciteqasiut
solliciteqasitu solliciteqatsui solliciteqatsiu solliciteqatusi solliciteqatuis solliciteqatius solliciteqatisu
solliciteqautsi solliciteqautis solliciteqausti solliciteqausit solliciteqauist solliciteqauits solliciteqaitus
solliciteqaitsu solliciteqaiuts solliciteqaiust solliciteqaisut solliciteqaistu solliciteuisqta solliciteuisqat
solliciteuistqa solliciteuistaq solliciteuisatq solliciteuisaqt solliciteuiqsta solliciteuiqsat solliciteuiqtsa
solliciteuiqtas solliciteuiqats solliciteuiqast solliciteuitqsa solliciteuitqas solliciteuitsqa solliciteuitsaq
solliciteuitasq solliciteuitaqs solliciteuiaqts solliciteuiaqst solliciteuiatqs solliciteuiatsq solliciteuiastq
solliciteuiasqt solliciteusiqta solliciteusiqat solliciteusitqa solliciteusitaq solliciteusiatq solliciteusiaqt
solliciteusqita solliciteusqiat solliciteusqtia solliciteusqtai solliciteusqati solliciteusqait solliciteustqia
solliciteustqai solliciteustiqa solliciteustiaq solliciteustaiq solliciteustaqi solliciteusaqti solliciteusaqit
solliciteusatqi solliciteusatiq solliciteusaitq solliciteusaiqt solliciteuqsita solliciteuqsiat solliciteuqstia
solliciteuqstai solliciteuqsati solliciteuqsait solliciteuqista solliciteuqisat solliciteuqitsa solliciteuqitas
solliciteuqiats solliciteuqiast solliciteuqtisa solliciteuqtias solliciteuqtsia solliciteuqtsai solliciteuqtasi
solliciteuqtais solliciteuqaits solliciteuqaist solliciteuqatis solliciteuqatsi solliciteuqasti solliciteuqasit
solliciteutsqia solliciteutsqai solliciteutsiqa solliciteutsiaq solliciteutsaiq solliciteutsaqi solliciteutqsia
solliciteutqsai solliciteutqisa solliciteutqias solliciteutqais solliciteutqasi solliciteutiqsa solliciteutiqas
solliciteutisqa solliciteutisaq solliciteutiasq solliciteutiaqs solliciteutaqis solliciteutaqsi solliciteutaiqs
solliciteutaisq solliciteutasiq solliciteutasqi solliciteuasqti solliciteuasqit solliciteuastqi solliciteuastiq
solliciteuasitq solliciteuasiqt solliciteuaqsti solliciteuaqsit solliciteuaqtsi solliciteuaqtis solliciteuaqits
solliciteuaqist solliciteuatqsi solliciteuatqis solliciteuatsqi solliciteuatsiq solliciteuatisq solliciteuatiqs
solliciteuaiqts solliciteuaiqst solliciteuaitqs solliciteuaitsq solliciteuaistq solliciteuaisqt solliciteaisqut
solliciteaisqtu solliciteaisuqt solliciteaisutq solliciteaistuq solliciteaistqu solliciteaiqsut solliciteaiqstu
solliciteaiqust solliciteaiquts solliciteaiqtus solliciteaiqtsu solliciteaiuqst solliciteaiuqts solliciteaiusqt
solliciteaiustq solliciteaiutsq solliciteaiutqs solliciteaitqus solliciteaitqsu solliciteaituqs solliciteaitusq
solliciteaitsuq solliciteaitsqu solliciteasiqut solliciteasiqtu solliciteasiuqt solliciteasiutq solliciteasituq
solliciteasitqu solliciteasqiut solliciteasqitu solliciteasquit solliciteasquti solliciteasqtui solliciteasqtiu
solliciteasuqit solliciteasuqti solliciteasuiqt solliciteasuitq solliciteasutiq solliciteasutqi solliciteastqui
solliciteastqiu solliciteastuqi solliciteastuiq solliciteastiuq solliciteastiqu solliciteaqsiut solliciteaqsitu
solliciteaqsuit solliciteaqsuti solliciteaqstui solliciteaqstiu solliciteaqisut solliciteaqistu solliciteaqiust
solliciteaqiuts solliciteaqitus solliciteaqitsu solliciteaquist solliciteaquits solliciteaqusit solliciteaqusti
solliciteaqutsi solliciteaqutis solliciteaqtius solliciteaqtisu solliciteaqtuis solliciteaqtusi solliciteaqtsui
solliciteaqtsiu solliciteausqit solliciteausqti solliciteausiqt solliciteausitq solliciteaustiq solliciteaustqi
solliciteauqsit solliciteauqsti solliciteauqist solliciteauqits solliciteauqtis solliciteauqtsi solliciteauiqst
solliciteauiqts solliciteauisqt solliciteauistq solliciteauitsq solliciteauitqs solliciteautqis solliciteautqsi
solliciteautiqs solliciteautisq solliciteautsiq solliciteautsqi solliciteatsqui solliciteatsqiu solliciteatsuqi
solliciteatsuiq solliciteatsiuq solliciteatsiqu solliciteatqsui solliciteatqsiu solliciteatqusi solliciteatquis
solliciteatqius solliciteatqisu solliciteatuqsi solliciteatuqis solliciteatusqi solliciteatusiq solliciteatuisq
solliciteatuiqs solliciteatiqus solliciteatiqsu solliciteatiuqs solliciteatiusq solliciteatisuq solliciteatisqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us