easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

darnold

tusing

marchionesses

winterers

niveaque

facular

encomiastical

undim

readdress

laved

eudaemonia

pupping

subaerially

yodling

acord

nouabamus

wasalu

forouhar


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: solebasque
cipher variations:
tpmfcbtrvf uqngdcuswg vrohedvtxh wspifewuyi xtqjgfxvzj
yurkhgywak zvslihzxbl awtmjiaycm bxunkjbzdn cyvolkcaeo
dzwpmldbfp eaxqnmecgq fbyronfdhr gczspogeis hdatqphfjt
ieburqigku jfcvsrjhlv kgdwtskimw lhexutljnx mifyvumkoy
njgzwvnlpz okhaxwomqa plibyxpnrb qmjczyqosc rnkdazrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: solebasque
Cipher: hlovyzhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: solebasque
Cipher: BAAAB ABBAB ABABA AABAA AAAAB AAAAA BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: solebasque
cipher variations:
tpmfcbtrvfdrinebdxjnntevgbndxvxvadibxjldhxwlkbhpzlrzstmbrvntldkjqblhpjvfgrsbvndr
fhczubftrzpjyhwbpzfhzlupybzftpjnqxabjlhxuqngdcuswgesjofceykooufwhcoeywywbejcykme
iyxmlciqamsatuncswoumelkrcmiqkwghstcwoesgidavcgusaqkzixcqagiamvqzcaguqkorybckmiy
vrohedvtxhftkpgdfzlppvgxidpfzxzxcfkdzlnfjzynmdjrbntbuvodtxpvnfmlsdnjrlxhitudxpft
hjebwdhvtbrlajydrbhjbnwradbhvrlpszcdlnjzwspifewuyigulqhegamqqwhyjeqgayaydgleamog
kazonekscoucvwpeuyqwognmteoksmyijuveyqguikfcxeiwucsmbkzescikcoxsbeciwsmqtademoka
xtqjgfxvzjhvmrifhbnrrxizkfrhbzbzehmfbnphlbapofltdpvdwxqfvzrxphonufpltnzjkvwfzrhv
jlgdyfjxvdtnclaftdjldpytcfdjxtnrubefnplbyurkhgywakiwnsjgicossyjalgsicacafingcoqi
mcbqpgmueqwexyrgwasyqipovgqmuoaklwxgasiwkmhezgkyweuodmbguekmeqzudgekyuosvcfgoqmc
zvslihzxbljxotkhjdpttzkbmhtjdbdbgjohdprjndcrqhnvfrxfyzshxbtzrjqpwhrnvpblmxyhbtjx
lnifahlzxfvpenchvflnfravehflzvptwdghprndawtmjiaycmkypulikequualcniukecechkpieqsk
oedsriowgsygzatiycuaskrqxisowqcmnyzicukymojgbimaygwqfodiwgmogsbwfigmawquxehiqsoe
bxunkjbzdnlzqvmjlfrvvbmdojvlfdfdilqjfrtlpfetsjpxhtzhabujzdvbtlsryjtpxrdnozajdvlz
npkhcjnbzhxrgpejxhnphtcxgjhnbxrvyfijrtpfcyvolkcaeomarwnkmgswwcnepkwmgegejmrkgsum
qgfutkqyiuaibcvkaewcumtszkuqyseopabkewmaoqlidkocaiyshqfkyioqiudyhkiocyswzgjksuqg
dzwpmldbfpnbsxolnhtxxdofqlxnhfhfknslhtvnrhgvulrzjvbjcdwlbfxdvnutalvrztfpqbclfxnb
prmjelpdbjztirglzjprjveziljpdztxahkltvrheaxqnmecgqoctypmoiuyyepgrmyoigiglotmiuwo
sihwvmsakwckdexmcgyewovubmwsaugqrcdmgyocqsnkfmqeckaujshmakqskwfajmkqeauybilmuwsi
fbyronfdhrpduzqnpjvzzfqhsnzpjhjhmpunjvxptjixwntblxdlefyndhzfxpwvcnxtbvhrsdenhzpd
rtolgnrfdlbvktinblrtlxgbknlrfbvzcjmnvxtjgczspogeisqevaroqkwaagritoaqkikinqvokwyq
ukjyxoucmyemfgzoeiagyqxwdoyucwistefoiaqesupmhosgemcwlujocmsumyhclomsgcwadknowyuk
hdatqphfjtrfwbsprlxbbhsjupbrljljorwplxzrvlkzypvdnzfnghapfjbhzryxepzvdxjtufgpjbrf
tvqnipthfndxmvkpdntvnzidmpnthdxbelopxzvlieburqigkusgxctqsmyccitkvqcsmkmkpsxqmyas
wmlazqweoagohibqgkciaszyfqaweykuvghqkcsguwrojquigoeynwlqeouwoajenqouieycfmpqyawm
jfcvsrjhlvthydurtnzddjulwrdtnlnlqtyrnzbtxnmbarxfpbhpijcrhldjbtazgrbxfzlvwhirldth
vxspkrvjhpfzoxmrfpvxpbkforpvjfzdgnqrzbxnkgdwtskimwuizevsuoaeekvmxseuomomruzsoacu
yoncbsygqciqjkdsimekcubahscygamwxijsmeuiwytqlswkiqgapynsgqwyqclgpsqwkgaehorsacyo
lhexutljnxvjafwtvpbfflwnytfvpnpnsvatpbdvzpodctzhrdjrkletjnfldvcbitdzhbnxyjktnfvj
xzurmtxljrhbqzothrxzrdmhqtrxlhbfipstbdzpmifyvumkoywkbgxuwqcggmxozugwqoqotwbuqcew
aqpeduaisekslmfukogmewdcjueaicoyzkluogwkyavsnuymksicrapuisyasenirusymicgjqtuceaq
njgzwvnlpzxlchyvxrdhhnypavhxrprpuxcvrdfxbrqfevbjtfltmngvlphnfxedkvfbjdpzalmvphxl
zbwtovznltjdsbqvjtzbtfojsvtznjdhkruvdfbrokhaxwomqaymdizwyseiiozqbwiysqsqvydwsegy
csrgfwckugmunohwmqiogyfelwgckeqabmnwqiymacxupwaomuketcrwkuacugpktwuaokeilsvwegcs
plibyxpnrbznejaxztfjjparcxjztrtrwzextfhzdtshgxdlvhnvopixnrjphzgfmxhdlfrbcnoxrjzn
bdyvqxbpnvlfudsxlvbdvhqluxvbplfjmtwxfhdtqmjczyqoscaofkbyaugkkqbsdykaususxafyugia
eutihyemwiowpqjyoskqiahgnyiemgscdopyskaocezwrycqowmgvetymwcewirmvywcqmgknuxygieu
rnkdazrptdbpglczbvhllrctezlbvtvtybgzvhjbfvujizfnxjpxqrkzptlrjbihozjfnhtdepqztlbp
dfaxszdrpxnhwfuznxdfxjsnwzxdrnhlovyzhjfvsolebasquecqhmdacwimmsdufamcwuwuzchawikc
gwvkjagoykqyrslaqumskcjipakgoiuefqraumcqegbytaesqyoixgvaoyegyktoxayesoimpwzaikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: solebasque
Cipher: fbyronfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: solebasque
Cipher: 34431351211134145451

Extended Methods:
Method #1

Plaintext: solebasque
method variations:
xtqkgfxvzkcyvpmlcaephdaurqhfkunifzwvnlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s o l e b a s q u e 
3 4 1 5 2 1 3 1 5 5 
4 3 3 1 1 1 4 4 4 1 
They are then read out in rows:
34152131554331114441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: solebasque
Cipher: svbczocatd

Read more ...
Method #3

Plaintext: solebasque
method variations:
tcxfaldyyl cxfaldyylt xfaldyyltc
faldyyltcx aldyyltcxf ldyyltcxfa
dyyltcxfal yyltcxfald yltcxfaldy
ltcxfaldyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: solebasque

first 5040 cipher variations(3628800 total)
solebasque solebasqeu solebasuqe solebasueq solebaseuq solebasequ solebaqsue solebaqseu solebaquse solebaques solebaqeus
solebaqesu solebauqse solebauqes solebausqe solebauseq solebauesq solebaueqs solebaequs solebaeqsu solebaeuqs solebaeusq
solebaesuq solebaesqu solebsaque solebsaqeu solebsauqe solebsaueq solebsaeuq solebsaequ solebsqaue solebsqaeu solebsquae
solebsquea solebsqeua solebsqeau solebsuqae solebsuqea solebsuaqe solebsuaeq solebsueaq solebsueqa solebsequa solebseqau
solebseuqa solebseuaq solebseauq solebseaqu solebqsaue solebqsaeu solebqsuae solebqsuea solebqseua solebqseau solebqasue
solebqaseu solebqause solebqaues solebqaeus solebqaesu solebquase solebquaes solebqusae solebqusea solebquesa solebqueas
solebqeaus solebqeasu solebqeuas solebqeusa solebqesua solebqesau solebusqae solebusqea solebusaqe solebusaeq solebuseaq
solebuseqa solebuqsae solebuqsea solebuqase solebuqaes solebuqeas solebuqesa solebuaqse solebuaqes solebuasqe solebuaseq
solebuaesq solebuaeqs solebueqas solebueqsa solebueaqs solebueasq solebuesaq solebuesqa solebesqua solebesqau solebesuqa
solebesuaq solebesauq solebesaqu solebeqsua solebeqsau solebequsa solebequas solebeqaus solebeqasu solebeuqsa solebeuqas
solebeusqa solebeusaq solebeuasq solebeuaqs solebeaqus solebeaqsu solebeauqs solebeausq solebeasuq solebeasqu soleabsque
soleabsqeu soleabsuqe soleabsueq soleabseuq soleabsequ soleabqsue soleabqseu soleabquse soleabques soleabqeus soleabqesu
soleabuqse soleabuqes soleabusqe soleabuseq soleabuesq soleabueqs soleabequs soleabeqsu soleabeuqs soleabeusq soleabesuq
soleabesqu soleasbque soleasbqeu soleasbuqe soleasbueq soleasbeuq soleasbequ soleasqbue soleasqbeu soleasqube soleasqueb
soleasqeub soleasqebu soleasuqbe soleasuqeb soleasubqe soleasubeq soleasuebq soleasueqb soleasequb soleaseqbu soleaseuqb
soleaseubq soleasebuq soleasebqu soleaqsbue soleaqsbeu soleaqsube soleaqsueb soleaqseub soleaqsebu soleaqbsue soleaqbseu
soleaqbuse soleaqbues soleaqbeus soleaqbesu soleaqubse soleaqubes soleaqusbe soleaquseb soleaquesb soleaquebs soleaqebus
soleaqebsu soleaqeubs soleaqeusb soleaqesub soleaqesbu soleausqbe soleausqeb soleausbqe soleausbeq soleausebq soleauseqb
soleauqsbe soleauqseb soleauqbse soleauqbes soleauqebs soleauqesb soleaubqse soleaubqes soleaubsqe soleaubseq soleaubesq
soleaubeqs soleaueqbs soleaueqsb soleauebqs soleauebsq soleauesbq soleauesqb soleaesqub soleaesqbu soleaesuqb soleaesubq
soleaesbuq soleaesbqu soleaeqsub soleaeqsbu soleaequsb soleaequbs soleaeqbus soleaeqbsu soleaeuqsb soleaeuqbs soleaeusqb
soleaeusbq soleaeubsq soleaeubqs soleaebqus soleaebqsu soleaebuqs soleaebusq soleaebsuq soleaebsqu solesabque solesabqeu
solesabuqe solesabueq solesabeuq solesabequ solesaqbue solesaqbeu solesaqube solesaqueb solesaqeub solesaqebu solesauqbe
solesauqeb solesaubqe solesaubeq solesauebq solesaueqb solesaequb solesaeqbu solesaeuqb solesaeubq solesaebuq solesaebqu
solesbaque solesbaqeu solesbauqe solesbaueq solesbaeuq solesbaequ solesbqaue solesbqaeu solesbquae solesbquea solesbqeua
solesbqeau solesbuqae solesbuqea solesbuaqe solesbuaeq solesbueaq solesbueqa solesbequa solesbeqau solesbeuqa solesbeuaq
solesbeauq solesbeaqu solesqbaue solesqbaeu solesqbuae solesqbuea solesqbeua solesqbeau solesqabue solesqabeu solesqaube
solesqaueb solesqaeub solesqaebu solesquabe solesquaeb solesqubae solesqubea solesqueba solesqueab solesqeaub solesqeabu
solesqeuab solesqeuba solesqebua solesqebau solesubqae solesubqea solesubaqe solesubaeq solesubeaq solesubeqa solesuqbae
solesuqbea solesuqabe solesuqaeb solesuqeab solesuqeba solesuaqbe solesuaqeb solesuabqe solesuabeq solesuaebq solesuaeqb
solesueqab solesueqba solesueaqb solesueabq solesuebaq solesuebqa solesebqua solesebqau solesebuqa solesebuaq solesebauq
solesebaqu soleseqbua soleseqbau solesequba solesequab soleseqaub soleseqabu soleseuqba soleseuqab soleseubqa soleseubaq
soleseuabq soleseuaqb soleseaqub soleseaqbu soleseauqb soleseaubq soleseabuq soleseabqu soleqasbue soleqasbeu soleqasube
soleqasueb soleqaseub soleqasebu soleqabsue soleqabseu soleqabuse soleqabues soleqabeus soleqabesu soleqaubse soleqaubes
soleqausbe soleqauseb soleqauesb soleqauebs soleqaebus soleqaebsu soleqaeubs soleqaeusb soleqaesub soleqaesbu soleqsabue
soleqsabeu soleqsaube soleqsaueb soleqsaeub soleqsaebu soleqsbaue soleqsbaeu soleqsbuae soleqsbuea soleqsbeua soleqsbeau
soleqsubae soleqsubea soleqsuabe soleqsuaeb soleqsueab soleqsueba soleqsebua soleqsebau soleqseuba soleqseuab soleqseaub
soleqseabu soleqbsaue soleqbsaeu soleqbsuae soleqbsuea soleqbseua soleqbseau soleqbasue soleqbaseu soleqbause soleqbaues
soleqbaeus soleqbaesu soleqbuase soleqbuaes soleqbusae soleqbusea soleqbuesa soleqbueas soleqbeaus soleqbeasu soleqbeuas
soleqbeusa soleqbesua soleqbesau solequsbae solequsbea solequsabe solequsaeb solequseab solequseba solequbsae solequbsea
solequbase solequbaes solequbeas solequbesa solequabse solequabes solequasbe solequaseb solequaesb solequaebs solequebas
solequebsa solequeabs solequeasb solequesab solequesba soleqesbua soleqesbau soleqesuba soleqesuab soleqesaub soleqesabu
soleqebsua soleqebsau soleqebusa soleqebuas soleqebaus soleqebasu soleqeubsa soleqeubas soleqeusba soleqeusab soleqeuasb
soleqeuabs soleqeabus soleqeabsu soleqeaubs soleqeausb soleqeasub soleqeasbu soleuasqbe soleuasqeb soleuasbqe soleuasbeq
soleuasebq soleuaseqb soleuaqsbe soleuaqseb soleuaqbse soleuaqbes soleuaqebs soleuaqesb soleuabqse soleuabqes soleuabsqe
soleuabseq soleuabesq soleuabeqs soleuaeqbs soleuaeqsb soleuaebqs soleuaebsq soleuaesbq soleuaesqb soleusaqbe soleusaqeb
soleusabqe soleusabeq soleusaebq soleusaeqb soleusqabe soleusqaeb soleusqbae soleusqbea soleusqeba soleusqeab soleusbqae
soleusbqea soleusbaqe soleusbaeq soleusbeaq soleusbeqa soleuseqba soleuseqab soleusebqa soleusebaq soleuseabq soleuseaqb
soleuqsabe soleuqsaeb soleuqsbae soleuqsbea soleuqseba soleuqseab soleuqasbe soleuqaseb soleuqabse soleuqabes soleuqaebs
soleuqaesb soleuqbase soleuqbaes soleuqbsae soleuqbsea soleuqbesa soleuqbeas soleuqeabs soleuqeasb soleuqebas soleuqebsa
soleuqesba soleuqesab soleubsqae soleubsqea soleubsaqe soleubsaeq soleubseaq soleubseqa soleubqsae soleubqsea soleubqase
soleubqaes soleubqeas soleubqesa soleubaqse soleubaqes soleubasqe soleubaseq soleubaesq soleubaeqs soleubeqas soleubeqsa
soleubeaqs soleubeasq soleubesaq soleubesqa soleuesqba soleuesqab soleuesbqa soleuesbaq soleuesabq soleuesaqb soleueqsba
soleueqsab soleueqbsa soleueqbas soleueqabs soleueqasb soleuebqsa soleuebqas soleuebsqa soleuebsaq soleuebasq soleuebaqs
soleueaqbs soleueaqsb soleueabqs soleueabsq soleueasbq soleueasqb soleeasqub soleeasqbu soleeasuqb soleeasubq soleeasbuq
soleeasbqu soleeaqsub soleeaqsbu soleeaqusb soleeaqubs soleeaqbus soleeaqbsu soleeauqsb soleeauqbs soleeausqb soleeausbq
soleeaubsq soleeaubqs soleeabqus soleeabqsu soleeabuqs soleeabusq soleeabsuq soleeabsqu soleesaqub soleesaqbu soleesauqb
soleesaubq soleesabuq soleesabqu soleesqaub soleesqabu soleesquab soleesquba soleesqbua soleesqbau soleesuqab soleesuqba
soleesuaqb soleesuabq soleesubaq soleesubqa soleesbqua soleesbqau soleesbuqa soleesbuaq soleesbauq soleesbaqu soleeqsaub
soleeqsabu soleeqsuab soleeqsuba soleeqsbua soleeqsbau soleeqasub soleeqasbu soleeqausb soleeqaubs soleeqabus soleeqabsu
soleequasb soleequabs soleequsab soleequsba soleequbsa soleequbas soleeqbaus soleeqbasu soleeqbuas soleeqbusa soleeqbsua
soleeqbsau soleeusqab soleeusqba soleeusaqb soleeusabq soleeusbaq soleeusbqa soleeuqsab soleeuqsba soleeuqasb soleeuqabs
soleeuqbas soleeuqbsa soleeuaqsb soleeuaqbs soleeuasqb soleeuasbq soleeuabsq soleeuabqs soleeubqas soleeubqsa soleeubaqs
soleeubasq soleeubsaq soleeubsqa soleebsqua soleebsqau soleebsuqa soleebsuaq soleebsauq soleebsaqu soleebqsua soleebqsau
soleebqusa soleebquas soleebqaus soleebqasu soleebuqsa soleebuqas soleebusqa soleebusaq soleebuasq soleebuaqs soleebaqus
soleebaqsu soleebauqs soleebausq soleebasuq soleebasqu solbeasque solbeasqeu solbeasuqe solbeasueq solbeaseuq solbeasequ
solbeaqsue solbeaqseu solbeaquse solbeaques solbeaqeus solbeaqesu solbeauqse solbeauqes solbeausqe solbeauseq solbeauesq
solbeaueqs solbeaequs solbeaeqsu solbeaeuqs solbeaeusq solbeaesuq solbeaesqu solbesaque solbesaqeu solbesauqe solbesaueq
solbesaeuq solbesaequ solbesqaue solbesqaeu solbesquae solbesquea solbesqeua solbesqeau solbesuqae solbesuqea solbesuaqe
solbesuaeq solbesueaq solbesueqa solbesequa solbeseqau solbeseuqa solbeseuaq solbeseauq solbeseaqu solbeqsaue solbeqsaeu
solbeqsuae solbeqsuea solbeqseua solbeqseau solbeqasue solbeqaseu solbeqause solbeqaues solbeqaeus solbeqaesu solbequase
solbequaes solbequsae solbequsea solbequesa solbequeas solbeqeaus solbeqeasu solbeqeuas solbeqeusa solbeqesua solbeqesau
solbeusqae solbeusqea solbeusaqe solbeusaeq solbeuseaq solbeuseqa solbeuqsae solbeuqsea solbeuqase solbeuqaes solbeuqeas
solbeuqesa solbeuaqse solbeuaqes solbeuasqe solbeuaseq solbeuaesq solbeuaeqs solbeueqas solbeueqsa solbeueaqs solbeueasq
solbeuesaq solbeuesqa solbeesqua solbeesqau solbeesuqa solbeesuaq solbeesauq solbeesaqu solbeeqsua solbeeqsau solbeequsa
solbeequas solbeeqaus solbeeqasu solbeeuqsa solbeeuqas solbeeusqa solbeeusaq solbeeuasq solbeeuaqs solbeeaqus solbeeaqsu
solbeeauqs solbeeausq solbeeasuq solbeeasqu solbaesque solbaesqeu solbaesuqe solbaesueq solbaeseuq solbaesequ solbaeqsue
solbaeqseu solbaequse solbaeques solbaeqeus solbaeqesu solbaeuqse solbaeuqes solbaeusqe solbaeuseq solbaeuesq solbaeueqs
solbaeequs solbaeeqsu solbaeeuqs solbaeeusq solbaeesuq solbaeesqu solbaseque solbaseqeu solbaseuqe solbaseueq solbaseeuq
solbaseequ solbasqeue solbasqeeu solbasquee solbasquee solbasqeue solbasqeeu solbasuqee solbasuqee solbasueqe solbasueeq
solbasueeq solbasueqe solbaseque solbaseqeu solbaseuqe solbaseueq solbaseeuq solbaseequ solbaqseue solbaqseeu solbaqsuee
solbaqsuee solbaqseue solbaqseeu solbaqesue solbaqeseu solbaqeuse solbaqeues solbaqeeus solbaqeesu solbaquese solbaquees
solbaqusee solbaqusee solbaquese solbaquees solbaqeeus solbaqeesu solbaqeues solbaqeuse solbaqesue solbaqeseu solbausqee
solbausqee solbauseqe solbauseeq solbauseeq solbauseqe solbauqsee solbauqsee solbauqese solbauqees solbauqees solbauqese
solbaueqse solbaueqes solbauesqe solbaueseq solbaueesq solbaueeqs solbaueqes solbaueqse solbaueeqs solbaueesq solbaueseq
solbauesqe solbaesque solbaesqeu solbaesuqe solbaesueq solbaeseuq solbaesequ solbaeqsue solbaeqseu solbaequse solbaeques
solbaeqeus solbaeqesu solbaeuqse solbaeuqes solbaeusqe solbaeuseq solbaeuesq solbaeueqs solbaeequs solbaeeqsu solbaeeuqs
solbaeeusq solbaeesuq solbaeesqu solbsaeque solbsaeqeu solbsaeuqe solbsaeueq solbsaeeuq solbsaeequ solbsaqeue solbsaqeeu
solbsaquee solbsaquee solbsaqeue solbsaqeeu solbsauqee solbsauqee solbsaueqe solbsaueeq solbsaueeq solbsaueqe solbsaeque
solbsaeqeu solbsaeuqe solbsaeueq solbsaeeuq solbsaeequ solbseaque solbseaqeu solbseauqe solbseaueq solbseaeuq solbseaequ
solbseqaue solbseqaeu solbsequae solbsequea solbseqeua solbseqeau solbseuqae solbseuqea solbseuaqe solbseuaeq solbseueaq
solbseueqa solbseequa solbseeqau solbseeuqa solbseeuaq solbseeauq solbseeaqu solbsqeaue solbsqeaeu solbsqeuae solbsqeuea
solbsqeeua solbsqeeau solbsqaeue solbsqaeeu solbsqauee solbsqauee solbsqaeue solbsqaeeu solbsquaee solbsquaee solbsqueae
solbsqueea solbsqueea solbsqueae solbsqeaue solbsqeaeu solbsqeuae solbsqeuea solbsqeeua solbsqeeau solbsueqae solbsueqea
solbsueaqe solbsueaeq solbsueeaq solbsueeqa solbsuqeae solbsuqeea solbsuqaee solbsuqaee solbsuqeae solbsuqeea solbsuaqee
solbsuaqee solbsuaeqe solbsuaeeq solbsuaeeq solbsuaeqe solbsueqae solbsueqea solbsueaqe solbsueaeq solbsueeaq solbsueeqa
solbseequa solbseeqau solbseeuqa solbseeuaq solbseeauq solbseeaqu solbseqeua solbseqeau solbsequea solbsequae solbseqaue
solbseqaeu solbseuqea solbseuqae solbseueqa solbseueaq solbseuaeq solbseuaqe solbseaque solbseaqeu solbseauqe solbseaueq
solbseaeuq solbseaequ solbqaseue solbqaseeu solbqasuee solbqasuee solbqaseue solbqaseeu solbqaesue solbqaeseu solbqaeuse
solbqaeues solbqaeeus solbqaeesu solbqauese solbqauees solbqausee solbqausee solbqauese solbqauees solbqaeeus solbqaeesu
solbqaeues solbqaeuse solbqaesue solbqaeseu solbqsaeue solbqsaeeu solbqsauee solbqsauee solbqsaeue solbqsaeeu solbqseaue
solbqseaeu solbqseuae solbqseuea solbqseeua solbqseeau solbqsueae solbqsueea solbqsuaee solbqsuaee solbqsueae solbqsueea
solbqseeua solbqseeau solbqseuea solbqseuae solbqseaue solbqseaeu solbqesaue solbqesaeu solbqesuae solbqesuea solbqeseua
solbqeseau solbqeasue solbqeaseu solbqeause solbqeaues solbqeaeus solbqeaesu solbqeuase solbqeuaes solbqeusae solbqeusea
solbqeuesa solbqeueas solbqeeaus solbqeeasu solbqeeuas solbqeeusa solbqeesua solbqeesau solbquseae solbquseea solbqusaee
solbqusaee solbquseae solbquseea solbquesae solbquesea solbquease solbqueaes solbqueeas solbqueesa solbquaese solbquaees
solbquasee solbquasee solbquaese solbquaees solbqueeas solbqueesa solbqueaes solbquease solbquesae solbquesea solbqeseua
solbqeseau solbqesuea solbqesuae solbqesaue solbqesaeu solbqeesua solbqeesau solbqeeusa solbqeeuas solbqeeaus solbqeeasu
solbqeuesa solbqeueas solbqeusea solbqeusae solbqeuase solbqeuaes solbqeaeus solbqeaesu solbqeaues solbqeause solbqeasue
solbqeaseu solbuasqee solbuasqee solbuaseqe solbuaseeq solbuaseeq solbuaseqe solbuaqsee solbuaqsee solbuaqese solbuaqees
solbuaqees solbuaqese solbuaeqse solbuaeqes solbuaesqe solbuaeseq solbuaeesq solbuaeeqs solbuaeqes solbuaeqse solbuaeeqs
solbuaeesq solbuaeseq solbuaesqe solbusaqee solbusaqee solbusaeqe solbusaeeq solbusaeeq solbusaeqe solbusqaee solbusqaee
solbusqeae solbusqeea solbusqeea solbusqeae solbuseqae solbuseqea solbuseaqe solbuseaeq solbuseeaq solbuseeqa solbuseqea
solbuseqae solbuseeqa solbuseeaq solbuseaeq solbuseaqe solbuqsaee solbuqsaee solbuqseae solbuqseea solbuqseea solbuqseae
solbuqasee solbuqasee solbuqaese solbuqaees solbuqaees solbuqaese solbuqease solbuqeaes solbuqesae solbuqesea solbuqeesa
solbuqeeas solbuqeaes solbuqease solbuqeeas solbuqeesa solbuqesea solbuqesae solbuesqae solbuesqea solbuesaqe solbuesaeq
solbueseaq solbueseqa solbueqsae solbueqsea solbueqase solbueqaes solbueqeas solbueqesa solbueaqse solbueaqes solbueasqe
solbueaseq solbueaesq solbueaeqs solbueeqas solbueeqsa solbueeaqs solbueeasq solbueesaq solbueesqa solbuesqea solbuesqae
solbueseqa solbueseaq solbuesaeq solbuesaqe solbueqsea solbueqsae solbueqesa solbueqeas solbueqaes solbueqase solbueeqsa
solbueeqas solbueesqa solbueesaq solbueeasq solbueeaqs solbueaqes solbueaqse solbueaeqs solbueaesq solbueaseq solbueasqe
solbeasque solbeasqeu solbeasuqe solbeasueq solbeaseuq solbeasequ solbeaqsue solbeaqseu solbeaquse solbeaques solbeaqeus
solbeaqesu solbeauqse solbeauqes solbeausqe solbeauseq solbeauesq solbeaueqs solbeaequs solbeaeqsu solbeaeuqs solbeaeusq
solbeaesuq solbeaesqu solbesaque solbesaqeu solbesauqe solbesaueq solbesaeuq solbesaequ solbesqaue solbesqaeu solbesquae
solbesquea solbesqeua solbesqeau solbesuqae solbesuqea solbesuaqe solbesuaeq solbesueaq solbesueqa solbesequa solbeseqau
solbeseuqa solbeseuaq solbeseauq solbeseaqu solbeqsaue solbeqsaeu solbeqsuae solbeqsuea solbeqseua solbeqseau solbeqasue
solbeqaseu solbeqause solbeqaues solbeqaeus solbeqaesu solbequase solbequaes solbequsae solbequsea solbequesa solbequeas
solbeqeaus solbeqeasu solbeqeuas solbeqeusa solbeqesua solbeqesau solbeusqae solbeusqea solbeusaqe solbeusaeq solbeuseaq
solbeuseqa solbeuqsae solbeuqsea solbeuqase solbeuqaes solbeuqeas solbeuqesa solbeuaqse solbeuaqes solbeuasqe solbeuaseq
solbeuaesq solbeuaeqs solbeueqas solbeueqsa solbeueaqs solbeueasq solbeuesaq solbeuesqa solbeesqua solbeesqau solbeesuqa
solbeesuaq solbeesauq solbeesaqu solbeeqsua solbeeqsau solbeequsa solbeequas solbeeqaus solbeeqasu solbeeuqsa solbeeuqas
solbeeusqa solbeeusaq solbeeuasq solbeeuaqs solbeeaqus solbeeaqsu solbeeauqs solbeeausq solbeeasuq solbeeasqu solabesque
solabesqeu solabesuqe solabesueq solabeseuq solabesequ solabeqsue solabeqseu solabequse solabeques solabeqeus solabeqesu
solabeuqse solabeuqes solabeusqe solabeuseq solabeuesq solabeueqs solabeequs solabeeqsu solabeeuqs solabeeusq solabeesuq
solabeesqu solabseque solabseqeu solabseuqe solabseueq solabseeuq solabseequ solabsqeue solabsqeeu solabsquee solabsquee
solabsqeue solabsqeeu solabsuqee solabsuqee solabsueqe solabsueeq solabsueeq solabsueqe solabseque solabseqeu solabseuqe
solabseueq solabseeuq solabseequ solabqseue solabqseeu solabqsuee solabqsuee solabqseue solabqseeu solabqesue solabqeseu
solabqeuse solabqeues solabqeeus solabqeesu solabquese solabquees solabqusee solabqusee solabquese solabquees solabqeeus
solabqeesu solabqeues solabqeuse solabqesue solabqeseu solabusqee solabusqee solabuseqe solabuseeq solabuseeq solabuseqe
solabuqsee solabuqsee solabuqese solabuqees solabuqees solabuqese solabueqse solabueqes solabuesqe solabueseq solabueesq
solabueeqs solabueqes solabueqse solabueeqs solabueesq solabueseq solabuesqe solabesque solabesqeu solabesuqe solabesueq
solabeseuq solabesequ solabeqsue solabeqseu solabequse solabeques solabeqeus solabeqesu solabeuqse solabeuqes solabeusqe
solabeuseq solabeuesq solabeueqs solabeequs solabeeqsu solabeeuqs solabeeusq solabeesuq solabeesqu solaebsque solaebsqeu
solaebsuqe solaebsueq solaebseuq solaebsequ solaebqsue solaebqseu solaebquse solaebques solaebqeus solaebqesu solaebuqse
solaebuqes solaebusqe solaebuseq solaebuesq solaebueqs solaebequs solaebeqsu solaebeuqs solaebeusq solaebesuq solaebesqu
solaesbque solaesbqeu solaesbuqe solaesbueq solaesbeuq solaesbequ solaesqbue solaesqbeu solaesqube solaesqueb solaesqeub
solaesqebu solaesuqbe solaesuqeb solaesubqe solaesubeq solaesuebq solaesueqb solaesequb solaeseqbu solaeseuqb solaeseubq
solaesebuq solaesebqu solaeqsbue solaeqsbeu solaeqsube solaeqsueb solaeqseub solaeqsebu solaeqbsue solaeqbseu solaeqbuse
solaeqbues solaeqbeus solaeqbesu solaequbse solaequbes solaequsbe solaequseb solaequesb solaequebs solaeqebus solaeqebsu
solaeqeubs solaeqeusb solaeqesub solaeqesbu solaeusqbe solaeusqeb solaeusbqe solaeusbeq solaeusebq solaeuseqb solaeuqsbe
solaeuqseb solaeuqbse solaeuqbes solaeuqebs solaeuqesb solaeubqse solaeubqes solaeubsqe solaeubseq solaeubesq solaeubeqs
solaeueqbs solaeueqsb solaeuebqs solaeuebsq solaeuesbq solaeuesqb solaeesqub solaeesqbu solaeesuqb solaeesubq solaeesbuq
solaeesbqu solaeeqsub solaeeqsbu solaeequsb solaeequbs solaeeqbus solaeeqbsu solaeeuqsb solaeeuqbs solaeeusqb solaeeusbq
solaeeubsq solaeeubqs solaeebqus solaeebqsu solaeebuqs solaeebusq solaeebsuq solaeebsqu solasebque solasebqeu solasebuqe
solasebueq solasebeuq solasebequ solaseqbue solaseqbeu solaseqube solasequeb solaseqeub solaseqebu solaseuqbe solaseuqeb
solaseubqe solaseubeq solaseuebq solaseueqb solaseequb solaseeqbu solaseeuqb solaseeubq solaseebuq solaseebqu solasbeque
solasbeqeu solasbeuqe solasbeueq solasbeeuq solasbeequ solasbqeue solasbqeeu solasbquee solasbquee solasbqeue solasbqeeu
solasbuqee solasbuqee solasbueqe solasbueeq solasbueeq solasbueqe solasbeque solasbeqeu solasbeuqe solasbeueq solasbeeuq
solasbeequ solasqbeue solasqbeeu solasqbuee solasqbuee solasqbeue solasqbeeu solasqebue solasqebeu solasqeube solasqeueb
solasqeeub solasqeebu solasquebe solasqueeb solasqubee solasqubee solasquebe solasqueeb solasqeeub solasqeebu solasqeueb
solasqeube solasqebue solasqebeu solasubqee solasubqee solasubeqe solasubeeq solasubeeq solasubeqe solasuqbee solasuqbee
solasuqebe solasuqeeb solasuqeeb solasuqebe solasueqbe solasueqeb solasuebqe solasuebeq solasueebq solasueeqb solasueqeb
solasueqbe solasueeqb solasueebq solasuebeq solasuebqe solasebque solasebqeu solasebuqe solasebueq solasebeuq solasebequ
solaseqbue solaseqbeu solaseqube solasequeb solaseqeub solaseqebu solaseuqbe solaseuqeb solaseubqe solaseubeq solaseuebq
solaseueqb solaseequb solaseeqbu solaseeuqb solaseeubq solaseebuq solaseebqu solaqesbue solaqesbeu solaqesube solaqesueb
solaqeseub solaqesebu solaqebsue solaqebseu solaqebuse solaqebues solaqebeus solaqebesu solaqeubse solaqeubes solaqeusbe
solaqeuseb solaqeuesb solaqeuebs solaqeebus solaqeebsu solaqeeubs solaqeeusb solaqeesub solaqeesbu solaqsebue solaqsebeu
solaqseube solaqseueb solaqseeub solaqseebu solaqsbeue solaqsbeeu solaqsbuee solaqsbuee solaqsbeue solaqsbeeu solaqsubee
solaqsubee solaqsuebe solaqsueeb solaqsueeb solaqsuebe solaqsebue solaqsebeu solaqseube solaqseueb solaqseeub solaqseebu
solaqbseue solaqbseeu solaqbsuee solaqbsuee solaqbseue solaqbseeu solaqbesue solaqbeseu solaqbeuse solaqbeues solaqbeeus
solaqbeesu solaqbuese solaqbuees solaqbusee solaqbusee solaqbuese solaqbuees solaqbeeus solaqbeesu solaqbeues solaqbeuse
solaqbesue solaqbeseu solaqusbee solaqusbee solaqusebe solaquseeb solaquseeb solaqusebe solaqubsee solaqubsee solaqubese
solaqubees solaqubees solaqubese solaquebse solaquebes solaquesbe solaqueseb solaqueesb solaqueebs solaquebes solaquebse
solaqueebs solaqueesb solaqueseb solaquesbe solaqesbue solaqesbeu solaqesube solaqesueb solaqeseub solaqesebu solaqebsue
solaqebseu solaqebuse solaqebues solaqebeus solaqebesu solaqeubse solaqeubes solaqeusbe solaqeuseb solaqeuesb solaqeuebs
solaqeebus solaqeebsu solaqeeubs solaqeeusb solaqeesub solaqeesbu solauesqbe solauesqeb solauesbqe solauesbeq solauesebq
solaueseqb solaueqsbe solaueqseb solaueqbse solaueqbes solaueqebs solaueqesb solauebqse solauebqes solauebsqe solauebseq
solauebesq solauebeqs solaueeqbs solaueeqsb solaueebqs solaueebsq solaueesbq solaueesqb solauseqbe solauseqeb solausebqe
solausebeq solauseebq solauseeqb solausqebe solausqeeb solausqbee solausqbee solausqebe solausqeeb solausbqee solausbqee
solausbeqe solausbeeq solausbeeq solausbeqe solauseqbe solauseqeb solausebqe solausebeq solauseebq solauseeqb solauqsebe
solauqseeb solauqsbee solauqsbee solauqsebe solauqseeb solauqesbe solauqeseb solauqebse solauqebes solauqeebs solauqeesb
solauqbese solauqbees solauqbsee solauqbsee solauqbese solauqbees solauqeebs solauqeesb solauqebes solauqebse solauqesbe
solauqeseb solaubsqee solaubsqee solaubseqe solaubseeq solaubseeq solaubseqe solaubqsee solaubqsee solaubqese solaubqees
solaubqees solaubqese solaubeqse solaubeqes solaubesqe solaubeseq solaubeesq solaubeeqs solaubeqes solaubeqse solaubeeqs
solaubeesq solaubeseq solaubesqe solauesqbe solauesqeb solauesbqe solauesbeq solauesebq solaueseqb solaueqsbe solaueqseb
solaueqbse solaueqbes solaueqebs solaueqesb solauebqse solauebqes solauebsqe solauebseq solauebesq solauebeqs solaueeqbs
solaueeqsb solaueebqs solaueebsq solaueesbq solaueesqb solaeesqub solaeesqbu solaeesuqb solaeesubq solaeesbuq solaeesbqu
solaeeqsub solaeeqsbu solaeequsb solaeequbs solaeeqbus solaeeqbsu solaeeuqsb solaeeuqbs solaeeusqb solaeeusbq solaeeubsq
solaeeubqs solaeebqus solaeebqsu solaeebuqs solaeebusq solaeebsuq solaeebsqu solaesequb solaeseqbu solaeseuqb solaeseubq
solaesebuq solaesebqu solaesqeub solaesqebu solaesqueb solaesqube solaesqbue solaesqbeu solaesuqeb solaesuqbe solaesueqb
solaesuebq solaesubeq solaesubqe solaesbque solaesbqeu solaesbuqe solaesbueq solaesbeuq solaesbequ solaeqseub solaeqsebu
solaeqsueb solaeqsube solaeqsbue solaeqsbeu solaeqesub solaeqesbu solaeqeusb solaeqeubs solaeqebus solaeqebsu solaequesb
solaequebs solaequseb solaequsbe solaequbse solaequbes solaeqbeus solaeqbesu solaeqbues solaeqbuse solaeqbsue solaeqbseu
solaeusqeb solaeusqbe solaeuseqb solaeusebq solaeusbeq solaeusbqe solaeuqseb solaeuqsbe solaeuqesb solaeuqebs solaeuqbes
solaeuqbse solaeueqsb solaeueqbs solaeuesqb solaeuesbq solaeuebsq solaeuebqs solaeubqes solaeubqse solaeubeqs solaeubesq
solaeubseq solaeubsqe solaebsque solaebsqeu solaebsuqe solaebsueq solaebseuq solaebsequ solaebqsue solaebqseu solaebquse
solaebques solaebqeus solaebqesu solaebuqse solaebuqes solaebusqe solaebuseq solaebuesq solaebueqs solaebequs solaebeqsu
solaebeuqs solaebeusq solaebesuq solaebesqu solsbaeque solsbaeqeu solsbaeuqe solsbaeueq solsbaeeuq solsbaeequ solsbaqeue
solsbaqeeu solsbaquee solsbaquee solsbaqeue solsbaqeeu solsbauqee solsbauqee solsbaueqe solsbaueeq solsbaueeq solsbaueqe
solsbaeque solsbaeqeu solsbaeuqe solsbaeueq solsbaeeuq solsbaeequ solsbeaque solsbeaqeu solsbeauqe solsbeaueq solsbeaeuq
solsbeaequ solsbeqaue solsbeqaeu solsbequae solsbequea solsbeqeua solsbeqeau solsbeuqae solsbeuqea solsbeuaqe solsbeuaeq
solsbeueaq solsbeueqa solsbeequa solsbeeqau solsbeeuqa solsbeeuaq solsbeeauq solsbeeaqu solsbqeaue solsbqeaeu solsbqeuae
solsbqeuea solsbqeeua solsbqeeau solsbqaeue solsbqaeeu solsbqauee solsbqauee solsbqaeue solsbqaeeu solsbquaee solsbquaee
solsbqueae solsbqueea solsbqueea solsbqueae solsbqeaue solsbqeaeu solsbqeuae solsbqeuea solsbqeeua solsbqeeau solsbueqae
solsbueqea solsbueaqe solsbueaeq solsbueeaq solsbueeqa solsbuqeae solsbuqeea solsbuqaee solsbuqaee solsbuqeae solsbuqeea
solsbuaqee solsbuaqee solsbuaeqe solsbuaeeq solsbuaeeq solsbuaeqe solsbueqae solsbueqea solsbueaqe solsbueaeq solsbueeaq
solsbueeqa solsbeequa solsbeeqau solsbeeuqa solsbeeuaq solsbeeauq solsbeeaqu solsbeqeua solsbeqeau solsbequea solsbequae
solsbeqaue solsbeqaeu solsbeuqea solsbeuqae solsbeueqa solsbeueaq solsbeuaeq solsbeuaqe solsbeaque solsbeaqeu solsbeauqe
solsbeaueq solsbeaeuq solsbeaequ solsabeque solsabeqeu solsabeuqe solsabeueq solsabeeuq solsabeequ solsabqeue solsabqeeu
solsabquee solsabquee solsabqeue solsabqeeu solsabuqee solsabuqee solsabueqe solsabueeq solsabueeq solsabueqe solsabeque
solsabeqeu solsabeuqe solsabeueq solsabeeuq solsabeequ solsaebque solsaebqeu solsaebuqe solsaebueq solsaebeuq solsaebequ
solsaeqbue solsaeqbeu solsaeqube solsaequeb solsaeqeub solsaeqebu solsaeuqbe solsaeuqeb solsaeubqe solsaeubeq solsaeuebq
solsaeueqb solsaeequb solsaeeqbu solsaeeuqb solsaeeubq solsaeebuq solsaeebqu solsaqebue solsaqebeu solsaqeube solsaqeueb
solsaqeeub solsaqeebu solsaqbeue solsaqbeeu solsaqbuee solsaqbuee solsaqbeue solsaqbeeu solsaqubee solsaqubee solsaquebe
solsaqueeb solsaqueeb solsaquebe solsaqebue solsaqebeu solsaqeube solsaqeueb solsaqeeub solsaqeebu solsaueqbe solsaueqeb
solsauebqe solsauebeq solsaueebq solsaueeqb solsauqebe solsauqeeb solsauqbee solsauqbee solsauqebe solsauqeeb solsaubqee
solsaubqee solsaubeqe solsaubeeq solsaubeeq solsaubeqe solsaueqbe solsaueqeb solsauebqe solsauebeq solsaueebq solsaueeqb
solsaeequb solsaeeqbu solsaeeuqb solsaeeubq solsaeebuq solsaeebqu solsaeqeub solsaeqebu solsaequeb solsaeqube solsaeqbue
solsaeqbeu solsaeuqeb solsaeuqbe solsaeueqb solsaeuebq solsaeubeq solsaeubqe solsaebque solsaebqeu solsaebuqe solsaebueq
solsaebeuq solsaebequ solseabque solseabqeu solseabuqe solseabueq solseabeuq solseabequ solseaqbue solseaqbeu solseaqube
solseaqueb solseaqeub solseaqebu solseauqbe solseauqeb solseaubqe solseaubeq solseauebq solseaueqb solseaequb solseaeqbu
solseaeuqb solseaeubq solseaebuq solseaebqu solsebaque solsebaqeu solsebauqe solsebaueq solsebaeuq solsebaequ solsebqaue
solsebqaeu solsebquae solsebquea solsebqeua solsebqeau solsebuqae solsebuqea solsebuaqe solsebuaeq solsebueaq solsebueqa
solsebequa solsebeqau solsebeuqa solsebeuaq solsebeauq solsebeaqu solseqbaue solseqbaeu solseqbuae solseqbuea solseqbeua
solseqbeau solseqabue solseqabeu solseqaube solseqaueb solseqaeub solseqaebu solsequabe solsequaeb solsequbae solsequbea
solsequeba solsequeab solseqeaub solseqeabu solseqeuab solseqeuba solseqebua solseqebau solseubqae solseubqea solseubaqe
solseubaeq solseubeaq solseubeqa solseuqbae solseuqbea solseuqabe solseuqaeb solseuqeab solseuqeba solseuaqbe solseuaqeb
solseuabqe solseuabeq solseuaebq solseuaeqb solseueqab solseueqba solseueaqb solseueabq solseuebaq solseuebqa solseebqua
solseebqau solseebuqa solseebuaq solseebauq solseebaqu solseeqbua solseeqbau solseequba solseequab solseeqaub solseeqabu
solseeuqba solseeuqab solseeubqa solseeubaq solseeuabq solseeuaqb solseeaqub solseeaqbu solseeauqb solseeaubq solseeabuq
solseeabqu solsqaebue solsqaebeu solsqaeube solsqaeueb solsqaeeub solsqaeebu solsqabeue solsqabeeu solsqabuee solsqabuee
solsqabeue solsqabeeu solsqaubee solsqaubee solsqauebe solsqaueeb solsqaueeb solsqauebe solsqaebue solsqaebeu solsqaeube
solsqaeueb solsqaeeub solsqaeebu solsqeabue solsqeabeu solsqeaube solsqeaueb solsqeaeub solsqeaebu solsqebaue solsqebaeu
solsqebuae solsqebuea solsqebeua solsqebeau solsqeubae solsqeubea solsqeuabe solsqeuaeb solsqeueab solsqeueba solsqeebua
solsqeebau solsqeeuba solsqeeuab solsqeeaub solsqeeabu solsqbeaue solsqbeaeu solsqbeuae solsqbeuea solsqbeeua solsqbeeau
solsqbaeue solsqbaeeu solsqbauee solsqbauee solsqbaeue solsqbaeeu solsqbuaee solsqbuaee solsqbueae solsqbueea solsqbueea
solsqbueae solsqbeaue solsqbeaeu solsqbeuae solsqbeuea solsqbeeua solsqbeeau solsquebae solsquebea solsqueabe solsqueaeb
solsqueeab solsqueeba solsqubeae solsqubeea solsqubaee solsqubaee solsqubeae solsqubeea solsquabee solsquabee solsquaebe
solsquaeeb solsquaeeb solsquaebe solsquebae solsquebea solsqueabe solsqueaeb solsqueeab solsqueeba solsqeebua solsqeebau
solsqeeuba solsqeeuab solsqeeaub solsqeeabu solsqebeua solsqebeau solsqebuea solsqebuae solsqebaue solsqebaeu solsqeubea
solsqeubae solsqeueba solsqeueab solsqeuaeb solsqeuabe solsqeabue solsqeabeu solsqeaube solsqeaueb solsqeaeub solsqeaebu
solsuaeqbe solsuaeqeb solsuaebqe solsuaebeq solsuaeebq solsuaeeqb solsuaqebe solsuaqeeb solsuaqbee solsuaqbee solsuaqebe
solsuaqeeb solsuabqee solsuabqee solsuabeqe solsuabeeq solsuabeeq solsuabeqe solsuaeqbe solsuaeqeb solsuaebqe solsuaebeq
solsuaeebq solsuaeeqb solsueaqbe solsueaqeb solsueabqe solsueabeq solsueaebq solsueaeqb solsueqabe solsueqaeb solsueqbae
solsueqbea solsueqeba solsueqeab solsuebqae solsuebqea solsuebaqe solsuebaeq solsuebeaq solsuebeqa solsueeqba solsueeqab
solsueebqa solsueebaq solsueeabq solsueeaqb solsuqeabe solsuqeaeb solsuqebae solsuqebea solsuqeeba solsuqeeab solsuqaebe
solsuqaeeb solsuqabee solsuqabee solsuqaebe solsuqaeeb solsuqbaee solsuqbaee solsuqbeae solsuqbeea solsuqbeea solsuqbeae
solsuqeabe solsuqeaeb solsuqebae solsuqebea solsuqeeba solsuqeeab solsubeqae solsubeqea solsubeaqe solsubeaeq solsubeeaq
solsubeeqa solsubqeae solsubqeea solsubqaee solsubqaee solsubqeae solsubqeea solsubaqee solsubaqee solsubaeqe solsubaeeq
solsubaeeq solsubaeqe solsubeqae solsubeqea solsubeaqe solsubeaeq solsubeeaq solsubeeqa solsueeqba solsueeqab solsueebqa
solsueebaq solsueeabq solsueeaqb solsueqeba solsueqeab solsueqbea solsueqbae solsueqabe solsueqaeb solsuebqea solsuebqae
solsuebeqa solsuebeaq solsuebaeq solsuebaqe solsueaqbe solsueaqeb solsueabqe solsueabeq solsueaebq solsueaeqb solseaequb
solseaeqbu solseaeuqb solseaeubq solseaebuq solseaebqu solseaqeub solseaqebu solseaqueb solseaqube solseaqbue solseaqbeu
solseauqeb solseauqbe solseaueqb solseauebq solseaubeq solseaubqe solseabque solseabqeu solseabuqe solseabueq solseabeuq
solseabequ solseeaqub solseeaqbu solseeauqb solseeaubq solseeabuq solseeabqu solseeqaub solseeqabu solseequab solseequba
solseeqbua solseeqbau solseeuqab solseeuqba solseeuaqb solseeuabq solseeubaq solseeubqa solseebqua solseebqau solseebuqa
solseebuaq solseebauq solseebaqu solseqeaub solseqeabu solseqeuab solseqeuba solseqebua solseqebau solseqaeub solseqaebu
solseqaueb solseqaube solseqabue solseqabeu solsequaeb solsequabe solsequeab solsequeba solsequbea solsequbae solseqbaue
solseqbaeu solseqbuae solseqbuea solseqbeua solseqbeau solseueqab solseueqba solseueaqb solseueabq solseuebaq solseuebqa
solseuqeab solseuqeba solseuqaeb solseuqabe solseuqbae solseuqbea solseuaqeb solseuaqbe solseuaeqb solseuaebq solseuabeq
solseuabqe solseubqae solseubqea solseubaqe solseubaeq solseubeaq solseubeqa solsebequa solsebeqau solsebeuqa solsebeuaq
solsebeauq solsebeaqu solsebqeua solsebqeau solsebquea solsebquae solsebqaue solsebqaeu solsebuqea solsebuqae solsebueqa
solsebueaq solsebuaeq solsebuaqe solsebaque solsebaqeu solsebauqe solsebaueq solsebaeuq solsebaequ solqbaseue solqbaseeu
solqbasuee solqbasuee solqbaseue solqbaseeu solqbaesue solqbaeseu solqbaeuse solqbaeues solqbaeeus solqbaeesu solqbauese
solqbauees solqbausee solqbausee solqbauese solqbauees solqbaeeus solqbaeesu solqbaeues solqbaeuse solqbaesue solqbaeseu
solqbsaeue solqbsaeeu solqbsauee solqbsauee solqbsaeue solqbsaeeu solqbseaue solqbseaeu solqbseuae solqbseuea solqbseeua
solqbseeau solqbsueae solqbsueea solqbsuaee solqbsuaee solqbsueae solqbsueea solqbseeua solqbseeau solqbseuea solqbseuae
solqbseaue solqbseaeu solqbesaue solqbesaeu solqbesuae solqbesuea solqbeseua solqbeseau solqbeasue solqbeaseu solqbeause
solqbeaues solqbeaeus solqbeaesu solqbeuase solqbeuaes solqbeusae solqbeusea solqbeuesa solqbeueas solqbeeaus solqbeeasu
solqbeeuas solqbeeusa solqbeesua solqbeesau solqbuseae solqbuseea solqbusaee solqbusaee solqbuseae solqbuseea solqbuesae
solqbuesea solqbuease solqbueaes solqbueeas solqbueesa solqbuaese solqbuaees solqbuasee solqbuasee solqbuaese solqbuaees
solqbueeas solqbueesa solqbueaes solqbuease solqbuesae solqbuesea solqbeseua solqbeseau solqbesuea solqbesuae solqbesaue
solqbesaeu solqbeesua solqbeesau solqbeeusa solqbeeuas solqbeeaus solqbeeasu solqbeuesa solqbeueas solqbeusea solqbeusae
solqbeuase solqbeuaes solqbeaeus solqbeaesu solqbeaues solqbeause solqbeasue solqbeaseu solqabseue solqabseeu solqabsuee
solqabsuee solqabseue solqabseeu solqabesue solqabeseu solqabeuse solqabeues solqabeeus solqabeesu solqabuese solqabuees
solqabusee solqabusee solqabuese solqabuees solqabeeus solqabeesu solqabeues solqabeuse solqabesue solqabeseu solqasbeue
solqasbeeu solqasbuee solqasbuee solqasbeue solqasbeeu solqasebue solqasebeu solqaseube solqaseueb solqaseeub solqaseebu
solqasuebe solqasueeb solqasubee solqasubee solqasuebe solqasueeb solqaseeub solqaseebu solqaseueb solqaseube solqasebue
solqasebeu solqaesbue solqaesbeu solqaesube solqaesueb solqaeseub solqaesebu solqaebsue solqaebseu solqaebuse solqaebues
solqaebeus solqaebesu solqaeubse solqaeubes solqaeusbe solqaeuseb solqaeuesb solqaeuebs solqaeebus solqaeebsu solqaeeubs
solqaeeusb solqaeesub solqaeesbu solqausebe solqauseeb solqausbee solqausbee solqausebe solqauseeb solqauesbe solqaueseb
solqauebse solqauebes solqaueebs solqaueesb solqaubese solqaubees solqaubsee solqaubsee solqaubese solqaubees solqaueebs
solqaueesb solqauebes solqauebse solqauesbe solqaueseb solqaeseub solqaesebu solqaesueb solqaesube solqaesbue solqaesbeu
solqaeesub solqaeesbu solqaeeusb solqaeeubs solqaeebus solqaeebsu solqaeuesb solqaeuebs solqaeuseb solqaeusbe solqaeubse
solqaeubes solqaebeus solqaebesu solqaebues solqaebuse solqaebsue solqaebseu solqsabeue solqsabeeu solqsabuee solqsabuee
solqsabeue solqsabeeu solqsaebue solqsaebeu solqsaeube solqsaeueb solqsaeeub solqsaeebu solqsauebe solqsaueeb solqsaubee
solqsaubee solqsauebe solqsaueeb solqsaeeub solqsaeebu solqsaeueb solqsaeube solqsaebue solqsaebeu solqsbaeue solqsbaeeu
solqsbauee solqsbauee solqsbaeue solqsbaeeu solqsbeaue solqsbeaeu solqsbeuae solqsbeuea solqsbeeua solqsbeeau solqsbueae
solqsbueea solqsbuaee solqsbuaee solqsbueae solqsbueea solqsbeeua solqsbeeau solqsbeuea solqsbeuae solqsbeaue solqsbeaeu
solqsebaue solqsebaeu solqsebuae solqsebuea solqsebeua solqsebeau solqseabue solqseabeu solqseaube solqseaueb solqseaeub
solqseaebu solqseuabe solqseuaeb solqseubae solqseubea solqseueba solqseueab solqseeaub solqseeabu solqseeuab solqseeuba
solqseebua solqseebau solqsubeae solqsubeea solqsubaee solqsubaee solqsubeae solqsubeea solqsuebae solqsuebea solqsueabe
solqsueaeb solqsueeab solqsueeba solqsuaebe solqsuaeeb solqsuabee solqsuabee solqsuaebe solqsuaeeb solqsueeab solqsueeba
solqsueaeb solqsueabe solqsuebae solqsuebea solqsebeua solqsebeau solqsebuea solqsebuae solqsebaue solqsebaeu solqseebua
solqseebau solqseeuba solqseeuab solqseeaub solqseeabu solqseueba solqseueab solqseubea solqseubae solqseuabe solqseuaeb
solqseaeub solqseaebu solqseaueb solqseaube solqseabue solqseabeu solqeasbue solqeasbeu solqeasube solqeasueb solqeaseub
solqeasebu solqeabsue solqeabseu solqeabuse solqeabues solqeabeus solqeabesu solqeaubse solqeaubes solqeausbe solqeauseb
solqeauesb solqeauebs solqeaebus solqeaebsu solqeaeubs solqeaeusb solqeaesub solqeaesbu solqesabue solqesabeu solqesaube
solqesaueb solqesaeub solqesaebu solqesbaue solqesbaeu solqesbuae solqesbuea solqesbeua solqesbeau solqesubae solqesubea
solqesuabe solqesuaeb solqesueab solqesueba solqesebua solqesebau solqeseuba solqeseuab solqeseaub solqeseabu solqebsaue
solqebsaeu solqebsuae solqebsuea solqebseua solqebseau solqebasue solqebaseu solqebause solqebaues solqebaeus solqebaesu
solqebuase solqebuaes solqebusae solqebusea solqebuesa solqebueas solqebeaus solqebeasu solqebeuas solqebeusa solqebesua
solqebesau solqeusbae solqeusbea solqeusabe solqeusaeb solqeuseab solqeuseba solqeubsae solqeubsea solqeubase solqeubaes
solqeubeas solqeubesa solqeuabse solqeuabes solqeuasbe solqeuaseb solqeuaesb solqeuaebs solqeuebas solqeuebsa solqeueabs
solqeueasb solqeuesab solqeuesba solqeesbua solqeesbau solqeesuba solqeesuab solqeesaub solqeesabu solqeebsua solqeebsau
solqeebusa solqeebuas solqeebaus solqeebasu solqeeubsa solqeeubas solqeeusba solqeeusab solqeeuasb solqeeuabs solqeeabus
solqeeabsu solqeeaubs solqeeausb solqeeasub solqeeasbu solquasebe solquaseeb solquasbee solquasbee solquasebe solquaseeb
solquaesbe solquaeseb solquaebse solquaebes solquaeebs solquaeesb solquabese solquabees solquabsee solquabsee solquabese
solquabees solquaeebs solquaeesb solquaebes solquaebse solquaesbe solquaeseb solqusaebe solqusaeeb solqusabee solqusabee
solqusaebe solqusaeeb solquseabe solquseaeb solqusebae solqusebea solquseeba solquseeab solqusbeae solqusbeea solqusbaee
solqusbaee solqusbeae solqusbeea solquseeba solquseeab solqusebea solqusebae solquseabe solquseaeb solquesabe solquesaeb
solquesbae solquesbea solqueseba solqueseab solqueasbe solqueaseb solqueabse solqueabes solqueaebs solqueaesb solquebase
solquebaes solquebsae solquebsea solquebesa solquebeas solqueeabs solqueeasb solqueebas solqueebsa solqueesba solqueesab
solqubseae solqubseea solqubsaee solqubsaee solqubseae solqubseea solqubesae solqubesea solqubease solqubeaes solqubeeas
solqubeesa solqubaese solqubaees solqubasee solqubasee solqubaese solqubaees solqubeeas solqubeesa solqubeaes solqubease
solqubesae solqubesea solqueseba solqueseab solquesbea solquesbae solquesabe solquesaeb solqueesba solqueesab solqueebsa
solqueebas solqueeabs solqueeasb solquebesa solquebeas solquebsea solquebsae solquebase solquebaes solqueaebs solqueaesb
solqueabes solqueabse solqueasbe solqueaseb solqeaseub solqeasebu solqeasueb solqeasube solqeasbue solqeasbeu solqeaesub
solqeaesbu solqeaeusb solqeaeubs solqeaebus solqeaebsu solqeauesb solqeauebs solqeauseb solqeausbe solqeaubse solqeaubes
solqeabeus solqeabesu solqeabues solqeabuse solqeabsue solqeabseu solqesaeub solqesaebu solqesaueb solqesaube solqesabue
solqesabeu solqeseaub solqeseabu solqeseuab solqeseuba solqesebua solqesebau solqesueab solqesueba solqesuaeb solqesuabe
solqesubae solqesubea solqesbeua solqesbeau solqesbuea solqesbuae solqesbaue solqesbaeu solqeesaub solqeesabu solqeesuab
solqeesuba solqeesbua solqeesbau solqeeasub solqeeasbu solqeeausb solqeeaubs solqeeabus solqeeabsu solqeeuasb solqeeuabs
solqeeusab solqeeusba solqeeubsa solqeeubas solqeebaus solqeebasu solqeebuas solqeebusa solqeebsua solqeebsau solqeuseab
solqeuseba solqeusaeb solqeusabe solqeusbae solqeusbea solqeuesab solqeuesba solqeueasb solqeueabs solqeuebas solqeuebsa
solqeuaesb solqeuaebs solqeuaseb solqeuasbe solqeuabse solqeuabes solqeubeas solqeubesa solqeubaes solqeubase solqeubsae
solqeubsea solqebseua solqebseau solqebsuea solqebsuae solqebsaue solqebsaeu solqebesua solqebesau solqebeusa solqebeuas
solqebeaus solqebeasu solqebuesa solqebueas solqebusea solqebusae solqebuase solqebuaes solqebaeus solqebaesu solqebaues
solqebause solqebasue solqebaseu solubasqee solubasqee solubaseqe solubaseeq solubaseeq solubaseqe solubaqsee solubaqsee
solubaqese solubaqees solubaqees solubaqese solubaeqse solubaeqes solubaesqe solubaeseq solubaeesq solubaeeqs solubaeqes
solubaeqse solubaeeqs solubaeesq solubaeseq solubaesqe solubsaqee solubsaqee solubsaeqe solubsaeeq solubsaeeq solubsaeqe
solubsqaee solubsqaee solubsqeae solubsqeea solubsqeea solubsqeae solubseqae solubseqea solubseaqe solubseaeq solubseeaq
solubseeqa solubseqea solubseqae solubseeqa solubseeaq solubseaeq solubseaqe solubqsaee solubqsaee solubqseae solubqseea
solubqseea solubqseae solubqasee solubqasee solubqaese solubqaees solubqaees solubqaese solubqease solubqeaes solubqesae
solubqesea solubqeesa solubqeeas solubqeaes solubqease solubqeeas solubqeesa solubqesea solubqesae solubesqae solubesqea
solubesaqe solubesaeq solubeseaq solubeseqa solubeqsae solubeqsea solubeqase solubeqaes solubeqeas solubeqesa solubeaqse
solubeaqes solubeasqe solubeaseq solubeaesq solubeaeqs solubeeqas solubeeqsa solubeeaqs solubeeasq solubeesaq solubeesqa
solubesqea solubesqae solubeseqa solubeseaq solubesaeq solubesaqe solubeqsea solubeqsae solubeqesa solubeqeas solubeqaes
solubeqase solubeeqsa solubeeqas solubeesqa solubeesaq solubeeasq solubeeaqs solubeaqes solubeaqse solubeaeqs solubeaesq
solubeaseq solubeasqe soluabsqee soluabsqee soluabseqe soluabseeq soluabseeq soluabseqe soluabqsee soluabqsee soluabqese
soluabqees soluabqees soluabqese soluabeqse soluabeqes soluabesqe soluabeseq soluabeesq soluabeeqs soluabeqes soluabeqse
soluabeeqs soluabeesq soluabeseq soluabesqe soluasbqee soluasbqee soluasbeqe soluasbeeq soluasbeeq soluasbeqe soluasqbee
soluasqbee soluasqebe soluasqeeb soluasqeeb soluasqebe soluaseqbe soluaseqeb soluasebqe soluasebeq soluaseebq soluaseeqb
soluaseqeb soluaseqbe soluaseeqb soluaseebq soluasebeq soluasebqe soluaqsbee soluaqsbee soluaqsebe soluaqseeb soluaqseeb
soluaqsebe soluaqbsee soluaqbsee soluaqbese soluaqbees soluaqbees soluaqbese soluaqebse soluaqebes soluaqesbe soluaqeseb
soluaqeesb soluaqeebs soluaqebes soluaqebse soluaqeebs soluaqeesb soluaqeseb soluaqesbe soluaesqbe soluaesqeb soluaesbqe
soluaesbeq soluaesebq soluaeseqb soluaeqsbe soluaeqseb soluaeqbse soluaeqbes soluaeqebs soluaeqesb soluaebqse soluaebqes
soluaebsqe soluaebseq soluaebesq soluaebeqs soluaeeqbs soluaeeqsb soluaeebqs soluaeebsq soluaeesbq soluaeesqb soluaesqeb
soluaesqbe soluaeseqb soluaesebq soluaesbeq soluaesbqe soluaeqseb soluaeqsbe soluaeqesb soluaeqebs soluaeqbes soluaeqbse
soluaeeqsb soluaeeqbs soluaeesqb soluaeesbq soluaeebsq soluaeebqs soluaebqes soluaebqse soluaebeqs soluaebesq soluaebseq
soluaebsqe solusabqee solusabqee solusabeqe solusabeeq solusabeeq solusabeqe solusaqbee solusaqbee solusaqebe solusaqeeb
solusaqeeb solusaqebe solusaeqbe solusaeqeb solusaebqe solusaebeq solusaeebq solusaeeqb solusaeqeb solusaeqbe solusaeeqb
solusaeebq solusaebeq solusaebqe solusbaqee solusbaqee solusbaeqe solusbaeeq solusbaeeq solusbaeqe solusbqaee solusbqaee
solusbqeae solusbqeea solusbqeea solusbqeae solusbeqae solusbeqea solusbeaqe solusbeaeq solusbeeaq solusbeeqa solusbeqea
solusbeqae solusbeeqa solusbeeaq solusbeaeq solusbeaqe solusqbaee solusqbaee solusqbeae solusqbeea solusqbeea solusqbeae
solusqabee solusqabee solusqaebe solusqaeeb solusqaeeb solusqaebe solusqeabe solusqeaeb solusqebae solusqebea solusqeeba
solusqeeab solusqeaeb solusqeabe solusqeeab solusqeeba solusqebea solusqebae solusebqae solusebqea solusebaqe solusebaeq
solusebeaq solusebeqa soluseqbae soluseqbea soluseqabe soluseqaeb soluseqeab soluseqeba soluseaqbe soluseaqeb soluseabqe
soluseabeq soluseaebq soluseaeqb soluseeqab soluseeqba soluseeaqb soluseeabq soluseebaq soluseebqa solusebqea solusebqae
solusebeqa solusebeaq solusebaeq solusebaqe soluseqbea soluseqbae soluseqeba soluseqeab soluseqaeb soluseqabe soluseeqba
soluseeqab soluseebqa soluseebaq soluseeabq soluseeaqb soluseaqeb soluseaqbe soluseaeqb soluseaebq soluseabeq soluseabqe
soluqasbee soluqasbee soluqasebe soluqaseeb soluqaseeb soluqasebe soluqabsee soluqabsee soluqabese soluqabees soluqabees
soluqabese soluqaebse soluqaebes soluqaesbe soluqaeseb soluqaeesb soluqaeebs soluqaebes soluqaebse soluqaeebs soluqaeesb
soluqaeseb soluqaesbe soluqsabee soluqsabee soluqsaebe soluqsaeeb soluqsaeeb soluqsaebe soluqsbaee soluqsbaee soluqsbeae
soluqsbeea soluqsbeea soluqsbeae soluqsebae soluqsebea soluqseabe soluqseaeb soluqseeab soluqseeba soluqsebea soluqsebae
soluqseeba soluqseeab soluqseaeb soluqseabe soluqbsaee soluqbsaee soluqbseae soluqbseea soluqbseea soluqbseae soluqbasee
soluqbasee soluqbaese soluqbaees soluqbaees soluqbaese soluqbease soluqbeaes soluqbesae soluqbesea soluqbeesa soluqbeeas
soluqbeaes soluqbease soluqbeeas soluqbeesa soluqbesea soluqbesae soluqesbae soluqesbea soluqesabe soluqesaeb soluqeseab
soluqeseba soluqebsae soluqebsea soluqebase soluqebaes soluqebeas soluqebesa soluqeabse soluqeabes soluqeasbe soluqeaseb
soluqeaesb soluqeaebs soluqeebas soluqeebsa soluqeeabs soluqeeasb soluqeesab soluqeesba soluqesbea soluqesbae soluqeseba
soluqeseab soluqesaeb soluqesabe soluqebsea soluqebsae soluqebesa soluqebeas soluqebaes soluqebase soluqeebsa soluqeebas
soluqeesba soluqeesab soluqeeasb soluqeeabs soluqeabes soluqeabse soluqeaebs soluqeaesb soluqeaseb soluqeasbe solueasqbe
solueasqeb solueasbqe solueasbeq solueasebq solueaseqb solueaqsbe solueaqseb solueaqbse solueaqbes solueaqebs solueaqesb
solueabqse solueabqes solueabsqe solueabseq solueabesq solueabeqs solueaeqbs solueaeqsb solueaebqs solueaebsq solueaesbq
solueaesqb soluesaqbe soluesaqeb soluesabqe soluesabeq soluesaebq soluesaeqb soluesqabe soluesqaeb soluesqbae soluesqbea
soluesqeba soluesqeab soluesbqae soluesbqea soluesbaqe soluesbaeq soluesbeaq soluesbeqa solueseqba solueseqab soluesebqa
soluesebaq solueseabq solueseaqb solueqsabe solueqsaeb solueqsbae solueqsbea solueqseba solueqseab solueqasbe solueqaseb
solueqabse solueqabes solueqaebs solueqaesb solueqbase solueqbaes solueqbsae solueqbsea solueqbesa solueqbeas solueqeabs
solueqeasb solueqebas solueqebsa solueqesba solueqesab soluebsqae soluebsqea soluebsaqe soluebsaeq soluebseaq soluebseqa
soluebqsae soluebqsea soluebqase soluebqaes soluebqeas soluebqesa soluebaqse soluebaqes soluebasqe soluebaseq soluebaesq
soluebaeqs soluebeqas soluebeqsa soluebeaqs soluebeasq soluebesaq soluebesqa solueesqba solueesqab solueesbqa solueesbaq
solueesabq solueesaqb solueeqsba solueeqsab solueeqbsa solueeqbas solueeqabs solueeqasb solueebqsa solueebqas solueebsqa
solueebsaq solueebasq solueebaqs solueeaqbs solueeaqsb solueeabqs solueeabsq solueeasbq solueeasqb solueasqeb solueasqbe
solueaseqb solueasebq solueasbeq solueasbqe solueaqseb solueaqsbe solueaqesb solueaqebs solueaqbes solueaqbse solueaeqsb
solueaeqbs solueaesqb solueaesbq solueaebsq solueaebqs solueabqes solueabqse solueabeqs solueabesq solueabseq solueabsqe
soluesaqeb soluesaqbe soluesaeqb soluesaebq soluesabeq soluesabqe soluesqaeb soluesqabe soluesqeab soluesqeba soluesqbea
soluesqbae solueseqab solueseqba solueseaqb solueseabq soluesebaq soluesebqa soluesbqea soluesbqae soluesbeqa soluesbeaq
soluesbaeq soluesbaqe solueqsaeb solueqsabe solueqseab solueqseba solueqsbea solueqsbae solueqaseb solueqasbe solueqaesb
solueqaebs solueqabes solueqabse solueqeasb solueqeabs solueqesab solueqesba solueqebsa solueqebas solueqbaes solueqbase
solueqbeas solueqbesa solueqbsea solueqbsae solueesqab solueesqba solueesaqb solueesabq solueesbaq solueesbqa solueeqsab
solueeqsba solueeqasb solueeqabs solueeqbas solueeqbsa solueeaqsb solueeaqbs solueeasqb solueeasbq solueeabsq solueeabqs
solueebqas solueebqsa solueebaqs solueebasq solueebsaq solueebsqa soluebsqea soluebsqae soluebseqa soluebseaq soluebsaeq
soluebsaqe soluebqsea soluebqsae soluebqesa soluebqeas soluebqaes soluebqase soluebeqsa soluebeqas soluebesqa soluebesaq
soluebeasq soluebeaqs soluebaqes soluebaqse soluebaeqs soluebaesq soluebaseq soluebasqe solebasque solebasqeu solebasuqe
solebasueq solebaseuq solebasequ solebaqsue solebaqseu solebaquse solebaques solebaqeus solebaqesu solebauqse solebauqes
solebausqe solebauseq solebauesq solebaueqs solebaequs solebaeqsu solebaeuqs solebaeusq solebaesuq solebaesqu solebsaque
solebsaqeu solebsauqe solebsaueq solebsaeuq solebsaequ solebsqaue solebsqaeu solebsquae solebsquea solebsqeua solebsqeau
solebsuqae solebsuqea solebsuaqe solebsuaeq solebsueaq solebsueqa solebsequa solebseqau solebseuqa solebseuaq solebseauq
solebseaqu solebqsaue solebqsaeu solebqsuae solebqsuea solebqseua solebqseau solebqasue solebqaseu solebqause solebqaues
solebqaeus solebqaesu solebquase solebquaes solebqusae solebqusea solebquesa solebqueas solebqeaus solebqeasu solebqeuas
solebqeusa solebqesua solebqesau solebusqae solebusqea solebusaqe solebusaeq solebuseaq solebuseqa solebuqsae solebuqsea
solebuqase solebuqaes solebuqeas solebuqesa solebuaqse solebuaqes solebuasqe solebuaseq solebuaesq solebuaeqs solebueqas
solebueqsa solebueaqs solebueasq solebuesaq solebuesqa solebesqua solebesqau solebesuqa solebesuaq solebesauq solebesaqu
solebeqsua solebeqsau solebequsa solebequas solebeqaus solebeqasu solebeuqsa solebeuqas solebeusqa solebeusaq solebeuasq
solebeuaqs solebeaqus solebeaqsu solebeauqs solebeausq solebeasuq solebeasqu soleabsque soleabsqeu soleabsuqe soleabsueq
soleabseuq soleabsequ soleabqsue soleabqseu soleabquse soleabques soleabqeus soleabqesu soleabuqse soleabuqes soleabusqe
soleabuseq soleabuesq soleabueqs soleabequs soleabeqsu soleabeuqs soleabeusq soleabesuq soleabesqu soleasbque soleasbqeu
soleasbuqe soleasbueq soleasbeuq soleasbequ soleasqbue soleasqbeu soleasqube soleasqueb soleasqeub soleasqebu soleasuqbe
soleasuqeb soleasubqe soleasubeq soleasuebq soleasueqb soleasequb soleaseqbu soleaseuqb soleaseubq soleasebuq soleasebqu
soleaqsbue soleaqsbeu soleaqsube soleaqsueb soleaqseub soleaqsebu soleaqbsue soleaqbseu soleaqbuse soleaqbues soleaqbeus
soleaqbesu soleaqubse soleaqubes soleaqusbe soleaquseb soleaquesb soleaquebs soleaqebus soleaqebsu soleaqeubs soleaqeusb
soleaqesub soleaqesbu soleausqbe soleausqeb soleausbqe soleausbeq soleausebq soleauseqb soleauqsbe soleauqseb soleauqbse
soleauqbes soleauqebs soleauqesb soleaubqse soleaubqes soleaubsqe soleaubseq soleaubesq soleaubeqs soleaueqbs soleaueqsb
soleauebqs soleauebsq soleauesbq soleauesqb soleaesqub soleaesqbu soleaesuqb soleaesubq soleaesbuq soleaesbqu soleaeqsub
soleaeqsbu soleaequsb soleaequbs soleaeqbus soleaeqbsu soleaeuqsb soleaeuqbs soleaeusqb soleaeusbq soleaeubsq soleaeubqs
soleaebqus soleaebqsu soleaebuqs soleaebusq soleaebsuq soleaebsqu solesabque solesabqeu solesabuqe solesabueq solesabeuq
solesabequ solesaqbue solesaqbeu solesaqube solesaqueb solesaqeub solesaqebu solesauqbe solesauqeb solesaubqe solesaubeq
solesauebq solesaueqb solesaequb solesaeqbu solesaeuqb solesaeubq solesaebuq solesaebqu solesbaque solesbaqeu solesbauqe
solesbaueq solesbaeuq solesbaequ solesbqaue solesbqaeu solesbquae solesbquea solesbqeua solesbqeau solesbuqae solesbuqea
solesbuaqe solesbuaeq solesbueaq solesbueqa solesbequa solesbeqau solesbeuqa solesbeuaq solesbeauq solesbeaqu solesqbaue
solesqbaeu solesqbuae solesqbuea solesqbeua solesqbeau solesqabue solesqabeu solesqaube solesqaueb solesqaeub solesqaebu
solesquabe solesquaeb solesqubae solesqubea solesqueba solesqueab solesqeaub solesqeabu solesqeuab solesqeuba solesqebua
solesqebau solesubqae solesubqea solesubaqe solesubaeq solesubeaq solesubeqa solesuqbae solesuqbea solesuqabe solesuqaeb
solesuqeab solesuqeba solesuaqbe solesuaqeb solesuabqe solesuabeq solesuaebq solesuaeqb solesueqab solesueqba solesueaqb
solesueabq solesuebaq solesuebqa solesebqua solesebqau solesebuqa solesebuaq solesebauq solesebaqu soleseqbua soleseqbau
solesequba solesequab soleseqaub soleseqabu soleseuqba soleseuqab soleseubqa soleseubaq soleseuabq soleseuaqb soleseaqub
soleseaqbu soleseauqb soleseaubq soleseabuq soleseabqu soleqasbue soleqasbeu soleqasube soleqasueb soleqaseub soleqasebu
soleqabsue soleqabseu soleqabuse soleqabues soleqabeus soleqabesu soleqaubse soleqaubes soleqausbe soleqauseb soleqauesb
soleqauebs soleqaebus soleqaebsu soleqaeubs soleqaeusb soleqaesub soleqaesbu soleqsabue soleqsabeu soleqsaube soleqsaueb
soleqsaeub soleqsaebu soleqsbaue soleqsbaeu soleqsbuae soleqsbuea soleqsbeua soleqsbeau soleqsubae soleqsubea soleqsuabe
soleqsuaeb soleqsueab soleqsueba soleqsebua soleqsebau soleqseuba soleqseuab soleqseaub soleqseabu soleqbsaue soleqbsaeu
soleqbsuae soleqbsuea soleqbseua soleqbseau soleqbasue soleqbaseu soleqbause soleqbaues soleqbaeus soleqbaesu soleqbuase
soleqbuaes soleqbusae soleqbusea soleqbuesa soleqbueas soleqbeaus soleqbeasu soleqbeuas soleqbeusa soleqbesua soleqbesau
solequsbae solequsbea solequsabe solequsaeb solequseab solequseba solequbsae solequbsea solequbase solequbaes solequbeas
solequbesa solequabse solequabes solequasbe solequaseb solequaesb solequaebs solequebas solequebsa solequeabs solequeasb
solequesab solequesba soleqesbua soleqesbau soleqesuba soleqesuab soleqesaub soleqesabu soleqebsua soleqebsau soleqebusa
soleqebuas soleqebaus soleqebasu soleqeubsa soleqeubas soleqeusba soleqeusab soleqeuasb soleqeuabs soleqeabus soleqeabsu
soleqeaubs soleqeausb soleqeasub soleqeasbu soleuasqbe soleuasqeb soleuasbqe soleuasbeq soleuasebq soleuaseqb soleuaqsbe
soleuaqseb soleuaqbse soleuaqbes soleuaqebs soleuaqesb soleuabqse soleuabqes soleuabsqe soleuabseq soleuabesq soleuabeqs
soleuaeqbs soleuaeqsb soleuaebqs soleuaebsq soleuaesbq soleuaesqb soleusaqbe soleusaqeb soleusabqe soleusabeq soleusaebq
soleusaeqb soleusqabe soleusqaeb soleusqbae soleusqbea soleusqeba soleusqeab soleusbqae soleusbqea soleusbaqe soleusbaeq
soleusbeaq soleusbeqa soleuseqba soleuseqab soleusebqa soleusebaq soleuseabq soleuseaqb soleuqsabe soleuqsaeb soleuqsbae
soleuqsbea soleuqseba soleuqseab soleuqasbe soleuqaseb soleuqabse soleuqabes soleuqaebs soleuqaesb soleuqbase soleuqbaes
soleuqbsae soleuqbsea soleuqbesa soleuqbeas soleuqeabs soleuqeasb soleuqebas soleuqebsa soleuqesba soleuqesab soleubsqae
soleubsqea soleubsaqe soleubsaeq soleubseaq soleubseqa soleubqsae soleubqsea soleubqase soleubqaes soleubqeas soleubqesa
soleubaqse soleubaqes soleubasqe soleubaseq soleubaesq soleubaeqs soleubeqas soleubeqsa soleubeaqs soleubeasq soleubesaq
soleubesqa soleuesqba soleuesqab soleuesbqa soleuesbaq soleuesabq soleuesaqb soleueqsba soleueqsab soleueqbsa soleueqbas
soleueqabs soleueqasb soleuebqsa soleuebqas soleuebsqa soleuebsaq soleuebasq soleuebaqs soleueaqbs soleueaqsb soleueabqs
soleueabsq soleueasbq soleueasqb soleeasqub soleeasqbu soleeasuqb soleeasubq soleeasbuq soleeasbqu soleeaqsub soleeaqsbu
soleeaqusb soleeaqubs soleeaqbus soleeaqbsu soleeauqsb soleeauqbs soleeausqb soleeausbq soleeaubsq soleeaubqs soleeabqus
soleeabqsu soleeabuqs soleeabusq soleeabsuq soleeabsqu soleesaqub soleesaqbu soleesauqb soleesaubq soleesabuq soleesabqu
soleesqaub soleesqabu soleesquab soleesquba soleesqbua soleesqbau soleesuqab soleesuqba soleesuaqb soleesuabq soleesubaq
soleesubqa soleesbqua soleesbqau soleesbuqa soleesbuaq soleesbauq soleesbaqu soleeqsaub soleeqsabu soleeqsuab soleeqsuba
soleeqsbua soleeqsbau soleeqasub soleeqasbu soleeqausb soleeqaubs soleeqabus soleeqabsu soleequasb soleequabs soleequsab
soleequsba soleequbsa soleequbas soleeqbaus soleeqbasu soleeqbuas soleeqbusa soleeqbsua soleeqbsau soleeusqab soleeusqba
soleeusaqb soleeusabq soleeusbaq soleeusbqa soleeuqsab soleeuqsba soleeuqasb soleeuqabs soleeuqbas soleeuqbsa soleeuaqsb
soleeuaqbs soleeuasqb soleeuasbq soleeuabsq soleeuabqs soleeubqas soleeubqsa soleeubaqs soleeubasq soleeubsaq soleeubsqa
soleebsqua soleebsqau soleebsuqa soleebsuaq soleebsauq soleebsaqu soleebqsua soleebqsau soleebqusa soleebquas soleebqaus
soleebqasu soleebuqsa soleebuqas soleebusqa soleebusaq soleebuasq soleebuaqs soleebaqus soleebaqsu soleebauqs soleebausq
soleebasuq soleebasqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us