easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

rewardableness

handlike

alapalooza

bellerofonte

brool

atrail

excierit

moonshined

warbles

resplend

outcurves

resipisco

ekaterina

hadar

hustisford

untouchability

berzelianite

lacrimosus


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: smithville
cipher variations:
tnjuiwjmmf uokvjxknng vplwkylooh wqmxlzmppi xrnymanqqj
ysoznborrk ztpaocpssl auqbpdqttm bvrcqeruun cwsdrfsvvo
dxtesgtwwp eyufthuxxq fzvguivyyr gawhvjwzzs hbxiwkxaat
icyjxlybbu jdzkymzccv kealznaddw lfbmaobeex mgcnbpcffy
nhdocqdggz oiepdrehha pjfqesfiib qkgrftgjjc rlhsguhkkd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: smithville
Cipher: hnrgseroov

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: smithville
Cipher: BAAAB ABABB ABAAA BAABA AABBB BBBAB ABAAA ABABA ABABA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: smithville
cipher variations:
tnjuiwjmmfdlzgwmziinnjpskcpeevxhfeysfaadhfvqmivwwlrdlcaylsstlzracerkkjvxhmquhggr
fvxyekxcczptnksanyyhzrdwgqduupjptiugtqqxuokvjxknngemahxnajjookqtldqffwyigfztgbbe
igwrnjwxxmsemdbzmttumasbdfsllkwyinrvihhsgwyzflyddaquoltbozziasexhrevvqkqujvhurry
vplwkyloohfnbiyobkkpplrumerggxzjhgauhccfjhxsokxyyntfnecanuuvnbtcegtmmlxzjoswjiit
hxzagmzeebrvpmucpaajbtfyisfwwrlrvkwivsszwqmxlzmppigocjzpcllqqmsvnfshhyakihbviddg
kiytplyzzougofdbovvwocudfhunnmyakptxkjjuiyabhnaffcswqnvdqbbkcugzjtgxxsmswlxjwtta
xrnymanqqjhpdkaqdmmrrntwogtiizbljicwjeehljzuqmzaapvhpgecpwwxpdvegivoonzblquylkkv
jzbciobggdtxrowerccldvhakuhyytntxmykxuubysoznborrkiqelbrennssouxphujjacmkjdxkffi
mkavrnabbqwiqhfdqxxyqewfhjwppoacmrvzmllwkacdjpchheuyspxfsddmewiblvizzuouynzlyvvc
ztpaocpssljrfmcsfoottpvyqivkkbdnlkeylggjnlbwsobccrxjrigeryyzrfxgikxqqpbdnswanmmx
lbdekqdiifvztqygteenfxjcmwjaavpvzoamzwwdauqbpdqttmksgndtgppuuqwzrjwllceomlfzmhhk
omcxtpcddsyksjhfszzasgyhjlyrrqceotxbonnymceflrejjgwaurzhuffogykdnxkbbwqwapbnaxxe
bvrcqeruunlthoeuhqqvvrxaskxmmdfpnmganiilpndyuqdeetzltkigtaabthzikmzssrdfpuycpooz
ndfgmsfkkhxbvsaivggphzleoylccxrxbqcobyyfcwsdrfsvvomuipfvirrwwsybtlynnegqonhbojjm
qoezvreffuamuljhubbcuiajlnattsegqvzdqppaoeghntglliycwtbjwhhqiamfpzmddysycrdpczzg
dxtesgtwwpnvjqgwjssxxtzcumzoofhrpoicpkknrpfawsfggvbnvmkivccdvjbkmobuutfhrwaerqqb
pfhiouhmmjzdxuckxiirjbngqaneeztzdseqdaaheyufthuxxqowkrhxkttyyuadvnappgisqpjdqllo
sqgbxtghhwcownljwddewkclnpcvvugisxbfsrrcqgijpvinnkaeyvdlyjjskcohrboffauaetfrebbi
fzvguivyyrpxlsiyluuzzvbewobqqhjtrqkermmptrhcyuhiixdpxomkxeefxldmoqdwwvhjtycgtssd
rhjkqwjoolbfzwemzkktldpiscpggbvbfugsfccjgawhvjwzzsqymtjzmvvaawcfxpcrrikusrlfsnnq
usidzvijjyeqypnlyffgymenprexxwikuzdhuttesiklrxkppmcgaxfnallumeqjtdqhhcwcgvhtgddk
hbxiwkxaatrznukanwwbbxdgyqdssjlvtsmgtoorvtjeawjkkzfrzqomzgghznfoqsfyyxjlvaeivuuf
tjlmsylqqndhbygobmmvnfrkueriidxdhwiuheelicyjxlybbusaovlboxxccyehzrettkmwutnhupps
wukfbxkllagsarpnahhiaogprtgzzykmwbfjwvvgukmntzmrroeiczhpcnnwogslvfsjjeyeixjviffm
jdzkymzccvtbpwmcpyyddzfiasfuulnxvuoivqqtxvlgcylmmbhtbsqobiijbphqsuhaazlnxcgkxwwh
vlnouansspfjdaiqdooxphtmwgtkkfzfjykwjggnkealznaddwucqxndqzzeeagjbtgvvmoywvpjwrru
ywmhdzmnnciuctrpcjjkcqirtvibbamoydhlyxxiwmopvbottqgkebjreppyqiunxhullgagkzlxkhho
lfbmaobeexvdryoeraaffbhkcuhwwnpzxwqkxssvzxnieanoodjvdusqdkkldrjsuwjccbnpzeimzyyj
xnpqwcpuurhlfcksfqqzrjvoyivmmhbhlamyliipmgcnbpcffyweszpfsbbggcildvixxoqayxrlyttw
ayojfboppekwevtrellmesktvxkddcoqafjnazzkyoqrxdqvvsimgdltgrraskwpzjwnnicimbnzmjjq
nhdocqdggzxftaqgtcchhdjmewjyyprbzysmzuuxbzpkgcpqqflxfwusfmmnftluwyleedprbgkobaal
zprsyerwwtjnhemuhssbtlxqakxoojdjncoankkroiepdrehhaygubrhuddiieknfxkzzqscaztnavvy
caqlhdqrrgmygxvtgnnogumvxzmffeqschlpcbbmaqstzfsxxukoifnvittcumyrblyppkekodpbolls
pjfqesfiibzhvcsiveejjflogylaartdbauobwwzdbrmiersshnzhywuhoophvnwyanggfrtdimqdccn
brtuagtyyvlpjgowjuudvnzscmzqqlflpeqcpmmtqkgrftgjjcaiwdtjwffkkgmphzmbbsuecbvpcxxa
ecsnjfsttioaizxvippqiwoxzbohhgsuejnreddocsuvbhuzzwmqkhpxkvvewoatdnarrmgmqfrdqnnu
rlhsguhkkdbjxeukxggllhnqiancctvfdcwqdyybfdtokgtuujpbjaywjqqrjxpyacpiihtvfkosfeep
dtvwcivaaxnrliqylwwfxpbueobssnhnrgseroovsmithvilleckyfvlyhhmmiorjbodduwgedxrezzc
geuplhuvvkqckbzxkrrskyqzbdqjjiuwglptgffqeuwxdjwbbyosmjrzmxxgyqcvfpcttoioshtfsppw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: smithville
Cipher: fzvguivyyr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: smithville
Cipher: 34234244321542131351

Extended Methods:
Method #1

Plaintext: smithville
method variations:
xroynaoqqkcwtdsftvvphbyixlyaaungdocqdffz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s m i t h v i l l e 
3 2 4 4 3 1 4 1 1 5 
4 3 2 4 2 5 2 3 3 1 
They are then read out in rows:
32443141154324252331
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: smithville
Cipher: htcdvorwmc

Read more ...
Method #3

Plaintext: smithville
method variations:
isrobubcxl srobubcxli robubcxlis
obubcxlisr bubcxlisro ubcxlisrob
bcxlisrobu cxlisrobub xlisrobubc
lisrobubcx

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: smithville

first 5040 cipher variations(3628800 total)
smithville smithvilel smithville smithvilel smithviell smithviell smithvlile smithvliel smithvllie smithvllei smithvleli
smithvleil smithvllie smithvllei smithvlile smithvliel smithvleil smithvleli smithvelli smithvelil smithvelli smithvelil
smithveill smithveill smithivlle smithivlel smithivlle smithivlel smithivell smithivell smithilvle smithilvel smithillve
smithillev smithilelv smithilevl smithillve smithillev smithilvle smithilvel smithilevl smithilelv smithiellv smithielvl
smithiellv smithielvl smithievll smithievll smithlivle smithlivel smithlilve smithlilev smithlielv smithlievl smithlvile
smithlviel smithlvlie smithlvlei smithlveli smithlveil smithllvie smithllvei smithllive smithlliev smithlleiv smithllevi
smithlevli smithlevil smithlelvi smithleliv smithleilv smithleivl smithlilve smithlilev smithlivle smithlivel smithlievl
smithlielv smithllive smithlliev smithllvie smithllvei smithllevi smithlleiv smithlvlie smithlvlei smithlvile smithlviel
smithlveil smithlveli smithlelvi smithleliv smithlevli smithlevil smithleivl smithleilv smitheillv smitheilvl smitheillv
smitheilvl smitheivll smitheivll smithelilv smithelivl smithelliv smithellvi smithelvli smithelvil smithelliv smithellvi
smithelilv smithelivl smithelvil smithelvli smithevlli smithevlil smithevlli smithevlil smithevill smithevill smitvhille
smitvhilel smitvhille smitvhilel smitvhiell smitvhiell smitvhlile smitvhliel smitvhllie smitvhllei smitvhleli smitvhleil
smitvhllie smitvhllei smitvhlile smitvhliel smitvhleil smitvhleli smitvhelli smitvhelil smitvhelli smitvhelil smitvheill
smitvheill smitvihlle smitvihlel smitvihlle smitvihlel smitvihell smitvihell smitvilhle smitvilhel smitvillhe smitvilleh
smitvilelh smitvilehl smitvillhe smitvilleh smitvilhle smitvilhel smitvilehl smitvilelh smitviellh smitvielhl smitviellh
smitvielhl smitviehll smitviehll smitvlihle smitvlihel smitvlilhe smitvlileh smitvlielh smitvliehl smitvlhile smitvlhiel
smitvlhlie smitvlhlei smitvlheli smitvlheil smitvllhie smitvllhei smitvllihe smitvllieh smitvlleih smitvllehi smitvlehli
smitvlehil smitvlelhi smitvlelih smitvleilh smitvleihl smitvlilhe smitvlileh smitvlihle smitvlihel smitvliehl smitvlielh
smitvllihe smitvllieh smitvllhie smitvllhei smitvllehi smitvlleih smitvlhlie smitvlhlei smitvlhile smitvlhiel smitvlheil
smitvlheli smitvlelhi smitvlelih smitvlehli smitvlehil smitvleihl smitvleilh smitveillh smitveilhl smitveillh smitveilhl
smitveihll smitveihll smitvelilh smitvelihl smitvellih smitvellhi smitvelhli smitvelhil smitvellih smitvellhi smitvelilh
smitvelihl smitvelhil smitvelhli smitvehlli smitvehlil smitvehlli smitvehlil smitvehill smitvehill smitivhlle smitivhlel
smitivhlle smitivhlel smitivhell smitivhell smitivlhle smitivlhel smitivllhe smitivlleh smitivlelh smitivlehl smitivllhe
smitivlleh smitivlhle smitivlhel smitivlehl smitivlelh smitivellh smitivelhl smitivellh smitivelhl smitivehll smitivehll
smitihvlle smitihvlel smitihvlle smitihvlel smitihvell smitihvell smitihlvle smitihlvel smitihllve smitihllev smitihlelv
smitihlevl smitihllve smitihllev smitihlvle smitihlvel smitihlevl smitihlelv smitihellv smitihelvl smitihellv smitihelvl
smitihevll smitihevll smitilhvle smitilhvel smitilhlve smitilhlev smitilhelv smitilhevl smitilvhle smitilvhel smitilvlhe
smitilvleh smitilvelh smitilvehl smitillvhe smitillveh smitillhve smitillhev smitillehv smitillevh smitilevlh smitilevhl
smitilelvh smitilelhv smitilehlv smitilehvl smitilhlve smitilhlev smitilhvle smitilhvel smitilhevl smitilhelv smitillhve
smitillhev smitillvhe smitillveh smitillevh smitillehv smitilvlhe smitilvleh smitilvhle smitilvhel smitilvehl smitilvelh
smitilelvh smitilelhv smitilevlh smitilevhl smitilehvl smitilehlv smitiehllv smitiehlvl smitiehllv smitiehlvl smitiehvll
smitiehvll smitielhlv smitielhvl smitiellhv smitiellvh smitielvlh smitielvhl smitiellhv smitiellvh smitielhlv smitielhvl
smitielvhl smitielvlh smitievllh smitievlhl smitievllh smitievlhl smitievhll smitievhll smitlvihle smitlvihel smitlvilhe
smitlvileh smitlvielh smitlviehl smitlvhile smitlvhiel smitlvhlie smitlvhlei smitlvheli smitlvheil smitlvlhie smitlvlhei
smitlvlihe smitlvlieh smitlvleih smitlvlehi smitlvehli smitlvehil smitlvelhi smitlvelih smitlveilh smitlveihl smitlivhle
smitlivhel smitlivlhe smitlivleh smitlivelh smitlivehl smitlihvle smitlihvel smitlihlve smitlihlev smitlihelv smitlihevl
smitlilhve smitlilhev smitlilvhe smitlilveh smitlilevh smitlilehv smitliehlv smitliehvl smitlielhv smitlielvh smitlievlh
smitlievhl smitlhivle smitlhivel smitlhilve smitlhilev smitlhielv smitlhievl smitlhvile smitlhviel smitlhvlie smitlhvlei
smitlhveli smitlhveil smitlhlvie smitlhlvei smitlhlive smitlhliev smitlhleiv smitlhlevi smitlhevli smitlhevil smitlhelvi
smitlheliv smitlheilv smitlheivl smitllihve smitllihev smitllivhe smitlliveh smitllievh smitlliehv smitllhive smitllhiev
smitllhvie smitllhvei smitllhevi smitllheiv smitllvhie smitllvhei smitllvihe smitllvieh smitllveih smitllvehi smitllehvi
smitllehiv smitllevhi smitllevih smitlleivh smitlleihv smitleihlv smitleihvl smitleilhv smitleilvh smitleivlh smitleivhl
smitlehilv smitlehivl smitlehliv smitlehlvi smitlehvli smitlehvil smitlelhiv smitlelhvi smitlelihv smitlelivh smitlelvih
smitlelvhi smitlevhli smitlevhil smitlevlhi smitlevlih smitlevilh smitlevihl smitlvilhe smitlvileh smitlvihle smitlvihel
smitlviehl smitlvielh smitlvlihe smitlvlieh smitlvlhie smitlvlhei smitlvlehi smitlvleih smitlvhlie smitlvhlei smitlvhile
smitlvhiel smitlvheil smitlvheli smitlvelhi smitlvelih smitlvehli smitlvehil smitlveihl smitlveilh smitlivlhe smitlivleh
smitlivhle smitlivhel smitlivehl smitlivelh smitlilvhe smitlilveh smitlilhve smitlilhev smitlilehv smitlilevh smitlihlve
smitlihlev smitlihvle smitlihvel smitlihevl smitlihelv smitlielhv smitlielvh smitliehlv smitliehvl smitlievhl smitlievlh
smitllivhe smitlliveh smitllihve smitllihev smitlliehv smitllievh smitllvihe smitllvieh smitllvhie smitllvhei smitllvehi
smitllveih smitllhvie smitllhvei smitllhive smitllhiev smitllheiv smitllhevi smitllevhi smitllevih smitllehvi smitllehiv
smitlleihv smitlleivh smitlhilve smitlhilev smitlhivle smitlhivel smitlhievl smitlhielv smitlhlive smitlhliev smitlhlvie
smitlhlvei smitlhlevi smitlhleiv smitlhvlie smitlhvlei smitlhvile smitlhviel smitlhveil smitlhveli smitlhelvi smitlheliv
smitlhevli smitlhevil smitlheivl smitlheilv smitleilhv smitleilvh smitleihlv smitleihvl smitleivhl smitleivlh smitlelihv
smitlelivh smitlelhiv smitlelhvi smitlelvhi smitlelvih smitlehliv smitlehlvi smitlehilv smitlehivl smitlehvil smitlehvli
smitlevlhi smitlevlih smitlevhli smitlevhil smitlevihl smitlevilh smitevillh smitevilhl smitevillh smitevilhl smitevihll
smitevihll smitevlilh smitevlihl smitevllih smitevllhi smitevlhli smitevlhil smitevllih smitevllhi smitevlilh smitevlihl
smitevlhil smitevlhli smitevhlli smitevhlil smitevhlli smitevhlil smitevhill smitevhill smiteivllh smiteivlhl smiteivllh
smiteivlhl smiteivhll smiteivhll smiteilvlh smiteilvhl smiteillvh smiteillhv smiteilhlv smiteilhvl smiteillvh smiteillhv
smiteilvlh smiteilvhl smiteilhvl smiteilhlv smiteihllv smiteihlvl smiteihllv smiteihlvl smiteihvll smiteihvll smitelivlh
smitelivhl smitelilvh smitelilhv smitelihlv smitelihvl smitelvilh smitelvihl smitelvlih smitelvlhi smitelvhli smitelvhil
smitellvih smitellvhi smitellivh smitellihv smitellhiv smitellhvi smitelhvli smitelhvil smitelhlvi smitelhliv smitelhilv
smitelhivl smitelilvh smitelilhv smitelivlh smitelivhl smitelihvl smitelihlv smitellivh smitellihv smitellvih smitellvhi
smitellhvi smitellhiv smitelvlih smitelvlhi smitelvilh smitelvihl smitelvhil smitelvhli smitelhlvi smitelhliv smitelhvli
smitelhvil smitelhivl smitelhilv smitehillv smitehilvl smitehillv smitehilvl smitehivll smitehivll smitehlilv smitehlivl
smitehlliv smitehllvi smitehlvli smitehlvil smitehlliv smitehllvi smitehlilv smitehlivl smitehlvil smitehlvli smitehvlli
smitehvlil smitehvlli smitehvlil smitehvill smitehvill smihtville smihtvilel smihtville smihtvilel smihtviell smihtviell
smihtvlile smihtvliel smihtvllie smihtvllei smihtvleli smihtvleil smihtvllie smihtvllei smihtvlile smihtvliel smihtvleil
smihtvleli smihtvelli smihtvelil smihtvelli smihtvelil smihtveill smihtveill smihtivlle smihtivlel smihtivlle smihtivlel
smihtivell smihtivell smihtilvle smihtilvel smihtillve smihtillev smihtilelv smihtilevl smihtillve smihtillev smihtilvle
smihtilvel smihtilevl smihtilelv smihtiellv smihtielvl smihtiellv smihtielvl smihtievll smihtievll smihtlivle smihtlivel
smihtlilve smihtlilev smihtlielv smihtlievl smihtlvile smihtlviel smihtlvlie smihtlvlei smihtlveli smihtlveil smihtllvie
smihtllvei smihtllive smihtlliev smihtlleiv smihtllevi smihtlevli smihtlevil smihtlelvi smihtleliv smihtleilv smihtleivl
smihtlilve smihtlilev smihtlivle smihtlivel smihtlievl smihtlielv smihtllive smihtlliev smihtllvie smihtllvei smihtllevi
smihtlleiv smihtlvlie smihtlvlei smihtlvile smihtlviel smihtlveil smihtlveli smihtlelvi smihtleliv smihtlevli smihtlevil
smihtleivl smihtleilv smihteillv smihteilvl smihteillv smihteilvl smihteivll smihteivll smihtelilv smihtelivl smihtelliv
smihtellvi smihtelvli smihtelvil smihtelliv smihtellvi smihtelilv smihtelivl smihtelvil smihtelvli smihtevlli smihtevlil
smihtevlli smihtevlil smihtevill smihtevill smihvtille smihvtilel smihvtille smihvtilel smihvtiell smihvtiell smihvtlile
smihvtliel smihvtllie smihvtllei smihvtleli smihvtleil smihvtllie smihvtllei smihvtlile smihvtliel smihvtleil smihvtleli
smihvtelli smihvtelil smihvtelli smihvtelil smihvteill smihvteill smihvitlle smihvitlel smihvitlle smihvitlel smihvitell
smihvitell smihviltle smihviltel smihvillte smihvillet smihvilelt smihviletl smihvillte smihvillet smihviltle smihviltel
smihviletl smihvilelt smihviellt smihvieltl smihviellt smihvieltl smihvietll smihvietll smihvlitle smihvlitel smihvlilte
smihvlilet smihvlielt smihvlietl smihvltile smihvltiel smihvltlie smihvltlei smihvlteli smihvlteil smihvlltie smihvlltei
smihvllite smihvlliet smihvlleit smihvlleti smihvletli smihvletil smihvlelti smihvlelit smihvleilt smihvleitl smihvlilte
smihvlilet smihvlitle smihvlitel smihvlietl smihvlielt smihvllite smihvlliet smihvlltie smihvlltei smihvlleti smihvlleit
smihvltlie smihvltlei smihvltile smihvltiel smihvlteil smihvlteli smihvlelti smihvlelit smihvletli smihvletil smihvleitl
smihvleilt smihveillt smihveiltl smihveillt smihveiltl smihveitll smihveitll smihvelilt smihvelitl smihvellit smihvellti
smihveltli smihveltil smihvellit smihvellti smihvelilt smihvelitl smihveltil smihveltli smihvetlli smihvetlil smihvetlli
smihvetlil smihvetill smihvetill smihivtlle smihivtlel smihivtlle smihivtlel smihivtell smihivtell smihivltle smihivltel
smihivllte smihivllet smihivlelt smihivletl smihivllte smihivllet smihivltle smihivltel smihivletl smihivlelt smihivellt
smihiveltl smihivellt smihiveltl smihivetll smihivetll smihitvlle smihitvlel smihitvlle smihitvlel smihitvell smihitvell
smihitlvle smihitlvel smihitllve smihitllev smihitlelv smihitlevl smihitllve smihitllev smihitlvle smihitlvel smihitlevl
smihitlelv smihitellv smihitelvl smihitellv smihitelvl smihitevll smihitevll smihiltvle smihiltvel smihiltlve smihiltlev
smihiltelv smihiltevl smihilvtle smihilvtel smihilvlte smihilvlet smihilvelt smihilvetl smihillvte smihillvet smihilltve
smihilltev smihilletv smihillevt smihilevlt smihilevtl smihilelvt smihileltv smihiletlv smihiletvl smihiltlve smihiltlev
smihiltvle smihiltvel smihiltevl smihiltelv smihilltve smihilltev smihillvte smihillvet smihillevt smihilletv smihilvlte
smihilvlet smihilvtle smihilvtel smihilvetl smihilvelt smihilelvt smihileltv smihilevlt smihilevtl smihiletvl smihiletlv
smihietllv smihietlvl smihietllv smihietlvl smihietvll smihietvll smihieltlv smihieltvl smihielltv smihiellvt smihielvlt
smihielvtl smihielltv smihiellvt smihieltlv smihieltvl smihielvtl smihielvlt smihievllt smihievltl smihievllt smihievltl
smihievtll smihievtll smihlvitle smihlvitel smihlvilte smihlvilet smihlvielt smihlvietl smihlvtile smihlvtiel smihlvtlie
smihlvtlei smihlvteli smihlvteil smihlvltie smihlvltei smihlvlite smihlvliet smihlvleit smihlvleti smihlvetli smihlvetil
smihlvelti smihlvelit smihlveilt smihlveitl smihlivtle smihlivtel smihlivlte smihlivlet smihlivelt smihlivetl smihlitvle
smihlitvel smihlitlve smihlitlev smihlitelv smihlitevl smihliltve smihliltev smihlilvte smihlilvet smihlilevt smihliletv
smihlietlv smihlietvl smihlieltv smihlielvt smihlievlt smihlievtl smihltivle smihltivel smihltilve smihltilev smihltielv
smihltievl smihltvile smihltviel smihltvlie smihltvlei smihltveli smihltveil smihltlvie smihltlvei smihltlive smihltliev
smihltleiv smihltlevi smihltevli smihltevil smihltelvi smihlteliv smihlteilv smihlteivl smihllitve smihllitev smihllivte
smihllivet smihllievt smihllietv smihlltive smihlltiev smihlltvie smihlltvei smihlltevi smihllteiv smihllvtie smihllvtei
smihllvite smihllviet smihllveit smihllveti smihlletvi smihlletiv smihllevti smihllevit smihlleivt smihlleitv smihleitlv
smihleitvl smihleiltv smihleilvt smihleivlt smihleivtl smihletilv smihletivl smihletliv smihletlvi smihletvli smihletvil
smihleltiv smihleltvi smihlelitv smihlelivt smihlelvit smihlelvti smihlevtli smihlevtil smihlevlti smihlevlit smihlevilt
smihlevitl smihlvilte smihlvilet smihlvitle smihlvitel smihlvietl smihlvielt smihlvlite smihlvliet smihlvltie smihlvltei
smihlvleti smihlvleit smihlvtlie smihlvtlei smihlvtile smihlvtiel smihlvteil smihlvteli smihlvelti smihlvelit smihlvetli
smihlvetil smihlveitl smihlveilt smihlivlte smihlivlet smihlivtle smihlivtel smihlivetl smihlivelt smihlilvte smihlilvet
smihliltve smihliltev smihliletv smihlilevt smihlitlve smihlitlev smihlitvle smihlitvel smihlitevl smihlitelv smihlieltv
smihlielvt smihlietlv smihlietvl smihlievtl smihlievlt smihllivte smihllivet smihllitve smihllitev smihllietv smihllievt
smihllvite smihllviet smihllvtie smihllvtei smihllveti smihllveit smihlltvie smihlltvei smihlltive smihlltiev smihllteiv
smihlltevi smihllevti smihllevit smihlletvi smihlletiv smihlleitv smihlleivt smihltilve smihltilev smihltivle smihltivel
smihltievl smihltielv smihltlive smihltliev smihltlvie smihltlvei smihltlevi smihltleiv smihltvlie smihltvlei smihltvile
smihltviel smihltveil smihltveli smihltelvi smihlteliv smihltevli smihltevil smihlteivl smihlteilv smihleiltv smihleilvt
smihleitlv smihleitvl smihleivtl smihleivlt smihlelitv smihlelivt smihleltiv smihleltvi smihlelvti smihlelvit smihletliv
smihletlvi smihletilv smihletivl smihletvil smihletvli smihlevlti smihlevlit smihlevtli smihlevtil smihlevitl smihlevilt
smihevillt smiheviltl smihevillt smiheviltl smihevitll smihevitll smihevlilt smihevlitl smihevllit smihevllti smihevltli
smihevltil smihevllit smihevllti smihevlilt smihevlitl smihevltil smihevltli smihevtlli smihevtlil smihevtlli smihevtlil
smihevtill smihevtill smiheivllt smiheivltl smiheivllt smiheivltl smiheivtll smiheivtll smiheilvlt smiheilvtl smiheillvt
smiheilltv smiheiltlv smiheiltvl smiheillvt smiheilltv smiheilvlt smiheilvtl smiheiltvl smiheiltlv smiheitllv smiheitlvl
smiheitllv smiheitlvl smiheitvll smiheitvll smihelivlt smihelivtl smihelilvt smiheliltv smihelitlv smihelitvl smihelvilt
smihelvitl smihelvlit smihelvlti smihelvtli smihelvtil smihellvit smihellvti smihellivt smihellitv smihelltiv smihelltvi
smiheltvli smiheltvil smiheltlvi smiheltliv smiheltilv smiheltivl smihelilvt smiheliltv smihelivlt smihelivtl smihelitvl
smihelitlv smihellivt smihellitv smihellvit smihellvti smihelltvi smihelltiv smihelvlit smihelvlti smihelvilt smihelvitl
smihelvtil smihelvtli smiheltlvi smiheltliv smiheltvli smiheltvil smiheltivl smiheltilv smihetillv smihetilvl smihetillv
smihetilvl smihetivll smihetivll smihetlilv smihetlivl smihetlliv smihetllvi smihetlvli smihetlvil smihetlliv smihetllvi
smihetlilv smihetlivl smihetlvil smihetlvli smihetvlli smihetvlil smihetvlli smihetvlil smihetvill smihetvill smivhtille
smivhtilel smivhtille smivhtilel smivhtiell smivhtiell smivhtlile smivhtliel smivhtllie smivhtllei smivhtleli smivhtleil
smivhtllie smivhtllei smivhtlile smivhtliel smivhtleil smivhtleli smivhtelli smivhtelil smivhtelli smivhtelil smivhteill
smivhteill smivhitlle smivhitlel smivhitlle smivhitlel smivhitell smivhitell smivhiltle smivhiltel smivhillte smivhillet
smivhilelt smivhiletl smivhillte smivhillet smivhiltle smivhiltel smivhiletl smivhilelt smivhiellt smivhieltl smivhiellt
smivhieltl smivhietll smivhietll smivhlitle smivhlitel smivhlilte smivhlilet smivhlielt smivhlietl smivhltile smivhltiel
smivhltlie smivhltlei smivhlteli smivhlteil smivhlltie smivhlltei smivhllite smivhlliet smivhlleit smivhlleti smivhletli
smivhletil smivhlelti smivhlelit smivhleilt smivhleitl smivhlilte smivhlilet smivhlitle smivhlitel smivhlietl smivhlielt
smivhllite smivhlliet smivhlltie smivhlltei smivhlleti smivhlleit smivhltlie smivhltlei smivhltile smivhltiel smivhlteil
smivhlteli smivhlelti smivhlelit smivhletli smivhletil smivhleitl smivhleilt smivheillt smivheiltl smivheillt smivheiltl
smivheitll smivheitll smivhelilt smivhelitl smivhellit smivhellti smivheltli smivheltil smivhellit smivhellti smivhelilt
smivhelitl smivheltil smivheltli smivhetlli smivhetlil smivhetlli smivhetlil smivhetill smivhetill smivthille smivthilel
smivthille smivthilel smivthiell smivthiell smivthlile smivthliel smivthllie smivthllei smivthleli smivthleil smivthllie
smivthllei smivthlile smivthliel smivthleil smivthleli smivthelli smivthelil smivthelli smivthelil smivtheill smivtheill
smivtihlle smivtihlel smivtihlle smivtihlel smivtihell smivtihell smivtilhle smivtilhel smivtillhe smivtilleh smivtilelh
smivtilehl smivtillhe smivtilleh smivtilhle smivtilhel smivtilehl smivtilelh smivtiellh smivtielhl smivtiellh smivtielhl
smivtiehll smivtiehll smivtlihle smivtlihel smivtlilhe smivtlileh smivtlielh smivtliehl smivtlhile smivtlhiel smivtlhlie
smivtlhlei smivtlheli smivtlheil smivtllhie smivtllhei smivtllihe smivtllieh smivtlleih smivtllehi smivtlehli smivtlehil
smivtlelhi smivtlelih smivtleilh smivtleihl smivtlilhe smivtlileh smivtlihle smivtlihel smivtliehl smivtlielh smivtllihe
smivtllieh smivtllhie smivtllhei smivtllehi smivtlleih smivtlhlie smivtlhlei smivtlhile smivtlhiel smivtlheil smivtlheli
smivtlelhi smivtlelih smivtlehli smivtlehil smivtleihl smivtleilh smivteillh smivteilhl smivteillh smivteilhl smivteihll
smivteihll smivtelilh smivtelihl smivtellih smivtellhi smivtelhli smivtelhil smivtellih smivtellhi smivtelilh smivtelihl
smivtelhil smivtelhli smivtehlli smivtehlil smivtehlli smivtehlil smivtehill smivtehill smivithlle smivithlel smivithlle
smivithlel smivithell smivithell smivitlhle smivitlhel smivitllhe smivitlleh smivitlelh smivitlehl smivitllhe smivitlleh
smivitlhle smivitlhel smivitlehl smivitlelh smivitellh smivitelhl smivitellh smivitelhl smivitehll smivitehll smivihtlle
smivihtlel smivihtlle smivihtlel smivihtell smivihtell smivihltle smivihltel smivihllte smivihllet smivihlelt smivihletl
smivihllte smivihllet smivihltle smivihltel smivihletl smivihlelt smivihellt smiviheltl smivihellt smiviheltl smivihetll
smivihetll smivilhtle smivilhtel smivilhlte smivilhlet smivilhelt smivilhetl smivilthle smivilthel smiviltlhe smiviltleh
smiviltelh smiviltehl smivillthe smivillteh smivillhte smivillhet smivilleht smivilleth smiviletlh smivilethl smivilelth
smivilelht smivilehlt smivilehtl smivilhlte smivilhlet smivilhtle smivilhtel smivilhetl smivilhelt smivillhte smivillhet
smivillthe smivillteh smivilleth smivilleht smiviltlhe smiviltleh smivilthle smivilthel smiviltehl smiviltelh smivilelth
smivilelht smiviletlh smivilethl smivilehtl smivilehlt smiviehllt smiviehltl smiviehllt smiviehltl smiviehtll smiviehtll
smivielhlt smivielhtl smiviellht smiviellth smivieltlh smivielthl smiviellht smiviellth smivielhlt smivielhtl smivielthl
smivieltlh smivietllh smivietlhl smivietllh smivietlhl smiviethll smiviethll smivltihle smivltihel smivltilhe smivltileh
smivltielh smivltiehl smivlthile smivlthiel smivlthlie smivlthlei smivltheli smivltheil smivltlhie smivltlhei smivltlihe
smivltlieh smivltleih smivltlehi smivltehli smivltehil smivltelhi smivltelih smivlteilh smivlteihl smivlithle smivlithel
smivlitlhe smivlitleh smivlitelh smivlitehl smivlihtle smivlihtel smivlihlte smivlihlet smivlihelt smivlihetl smivlilhte
smivlilhet smivlilthe smivlilteh smivlileth smivlileht smivliehlt smivliehtl smivlielht smivlielth smivlietlh smivliethl
smivlhitle smivlhitel smivlhilte smivlhilet smivlhielt smivlhietl smivlhtile smivlhtiel smivlhtlie smivlhtlei smivlhteli
smivlhteil smivlhltie smivlhltei smivlhlite smivlhliet smivlhleit smivlhleti smivlhetli smivlhetil smivlhelti smivlhelit
smivlheilt smivlheitl smivllihte smivllihet smivllithe smivlliteh smivllieth smivllieht smivllhite smivllhiet smivllhtie
smivllhtei smivllheti smivllheit smivllthie smivllthei smivlltihe smivlltieh smivllteih smivlltehi smivllehti smivllehit
smivllethi smivlletih smivlleith smivlleiht smivleihlt smivleihtl smivleilht smivleilth smivleitlh smivleithl smivlehilt
smivlehitl smivlehlit smivlehlti smivlehtli smivlehtil smivlelhit smivlelhti smivleliht smivlelith smivleltih smivlelthi
smivlethli smivlethil smivletlhi smivletlih smivletilh smivletihl smivltilhe smivltileh smivltihle smivltihel smivltiehl
smivltielh smivltlihe smivltlieh smivltlhie smivltlhei smivltlehi smivltleih smivlthlie smivlthlei smivlthile smivlthiel
smivltheil smivltheli smivltelhi smivltelih smivltehli smivltehil smivlteihl smivlteilh smivlitlhe smivlitleh smivlithle
smivlithel smivlitehl smivlitelh smivlilthe smivlilteh smivlilhte smivlilhet smivlileht smivlileth smivlihlte smivlihlet
smivlihtle smivlihtel smivlihetl smivlihelt smivlielht smivlielth smivliehlt smivliehtl smivliethl smivlietlh smivllithe
smivlliteh smivllihte smivllihet smivllieht smivllieth smivlltihe smivlltieh smivllthie smivllthei smivlltehi smivllteih
smivllhtie smivllhtei smivllhite smivllhiet smivllheit smivllheti smivllethi smivlletih smivllehti smivllehit smivlleiht
smivlleith smivlhilte smivlhilet smivlhitle smivlhitel smivlhietl smivlhielt smivlhlite smivlhliet smivlhltie smivlhltei
smivlhleti smivlhleit smivlhtlie smivlhtlei smivlhtile smivlhtiel smivlhteil smivlhteli smivlhelti smivlhelit smivlhetli
smivlhetil smivlheitl smivlheilt smivleilht smivleilth smivleihlt smivleihtl smivleithl smivleitlh smivleliht smivlelith
smivlelhit smivlelhti smivlelthi smivleltih smivlehlit smivlehlti smivlehilt smivlehitl smivlehtil smivlehtli smivletlhi
smivletlih smivlethli smivlethil smivletihl smivletilh smivetillh smivetilhl smivetillh smivetilhl smivetihll smivetihll
smivetlilh smivetlihl smivetllih smivetllhi smivetlhli smivetlhil smivetllih smivetllhi smivetlilh smivetlihl smivetlhil
smivetlhli smivethlli smivethlil smivethlli smivethlil smivethill smivethill smiveitllh smiveitlhl smiveitllh smiveitlhl
smiveithll smiveithll smiveiltlh smiveilthl smiveillth smiveillht smiveilhlt smiveilhtl smiveillth smiveillht smiveiltlh
smiveilthl smiveilhtl smiveilhlt smiveihllt smiveihltl smiveihllt smiveihltl smiveihtll smiveihtll smivelitlh smivelithl
smivelilth smivelilht smivelihlt smivelihtl smiveltilh smiveltihl smiveltlih smiveltlhi smivelthli smivelthil smivelltih
smivellthi smivellith smivelliht smivellhit smivellhti smivelhtli smivelhtil smivelhlti smivelhlit smivelhilt smivelhitl
smivelilth smivelilht smivelitlh smivelithl smivelihtl smivelihlt smivellith smivelliht smivelltih smivellthi smivellhti
smivellhit smiveltlih smiveltlhi smiveltilh smiveltihl smivelthil smivelthli smivelhlti smivelhlit smivelhtli smivelhtil
smivelhitl smivelhilt smivehillt smivehiltl smivehillt smivehiltl smivehitll smivehitll smivehlilt smivehlitl smivehllit
smivehllti smivehltli smivehltil smivehllit smivehllti smivehlilt smivehlitl smivehltil smivehltli smivehtlli smivehtlil
smivehtlli smivehtlil smivehtill smivehtill smiihvtlle smiihvtlel smiihvtlle smiihvtlel smiihvtell smiihvtell smiihvltle
smiihvltel smiihvllte smiihvllet smiihvlelt smiihvletl smiihvllte smiihvllet smiihvltle smiihvltel smiihvletl smiihvlelt
smiihvellt smiihveltl smiihvellt smiihveltl smiihvetll smiihvetll smiihtvlle smiihtvlel smiihtvlle smiihtvlel smiihtvell
smiihtvell smiihtlvle smiihtlvel smiihtllve smiihtllev smiihtlelv smiihtlevl smiihtllve smiihtllev smiihtlvle smiihtlvel
smiihtlevl smiihtlelv smiihtellv smiihtelvl smiihtellv smiihtelvl smiihtevll smiihtevll smiihltvle smiihltvel smiihltlve
smiihltlev smiihltelv smiihltevl smiihlvtle smiihlvtel smiihlvlte smiihlvlet smiihlvelt smiihlvetl smiihllvte smiihllvet
smiihlltve smiihlltev smiihlletv smiihllevt smiihlevlt smiihlevtl smiihlelvt smiihleltv smiihletlv smiihletvl smiihltlve
smiihltlev smiihltvle smiihltvel smiihltevl smiihltelv smiihlltve smiihlltev smiihllvte smiihllvet smiihllevt smiihlletv
smiihlvlte smiihlvlet smiihlvtle smiihlvtel smiihlvetl smiihlvelt smiihlelvt smiihleltv smiihlevlt smiihlevtl smiihletvl
smiihletlv smiihetllv smiihetlvl smiihetllv smiihetlvl smiihetvll smiihetvll smiiheltlv smiiheltvl smiihelltv smiihellvt
smiihelvlt smiihelvtl smiihelltv smiihellvt smiiheltlv smiiheltvl smiihelvtl smiihelvlt smiihevllt smiihevltl smiihevllt
smiihevltl smiihevtll smiihevtll smiivhtlle smiivhtlel smiivhtlle smiivhtlel smiivhtell smiivhtell smiivhltle smiivhltel
smiivhllte smiivhllet smiivhlelt smiivhletl smiivhllte smiivhllet smiivhltle smiivhltel smiivhletl smiivhlelt smiivhellt
smiivheltl smiivhellt smiivheltl smiivhetll smiivhetll smiivthlle smiivthlel smiivthlle smiivthlel smiivthell smiivthell
smiivtlhle smiivtlhel smiivtllhe smiivtlleh smiivtlelh smiivtlehl smiivtllhe smiivtlleh smiivtlhle smiivtlhel smiivtlehl
smiivtlelh smiivtellh smiivtelhl smiivtellh smiivtelhl smiivtehll smiivtehll smiivlthle smiivlthel smiivltlhe smiivltleh
smiivltelh smiivltehl smiivlhtle smiivlhtel smiivlhlte smiivlhlet smiivlhelt smiivlhetl smiivllhte smiivllhet smiivllthe
smiivllteh smiivlleth smiivlleht smiivlehlt smiivlehtl smiivlelht smiivlelth smiivletlh smiivlethl smiivltlhe smiivltleh
smiivlthle smiivlthel smiivltehl smiivltelh smiivllthe smiivllteh smiivllhte smiivllhet smiivlleht smiivlleth smiivlhlte
smiivlhlet smiivlhtle smiivlhtel smiivlhetl smiivlhelt smiivlelht smiivlelth smiivlehlt smiivlehtl smiivlethl smiivletlh
smiivetllh smiivetlhl smiivetllh smiivetlhl smiivethll smiivethll smiiveltlh smiivelthl smiivellth smiivellht smiivelhlt
smiivelhtl smiivellth smiivellht smiiveltlh smiivelthl smiivelhtl smiivelhlt smiivehllt smiivehltl smiivehllt smiivehltl
smiivehtll smiivehtll smiitvhlle smiitvhlel smiitvhlle smiitvhlel smiitvhell smiitvhell smiitvlhle smiitvlhel smiitvllhe
smiitvlleh smiitvlelh smiitvlehl smiitvllhe smiitvlleh smiitvlhle smiitvlhel smiitvlehl smiitvlelh smiitvellh smiitvelhl
smiitvellh smiitvelhl smiitvehll smiitvehll smiithvlle smiithvlel smiithvlle smiithvlel smiithvell smiithvell smiithlvle
smiithlvel smiithllve smiithllev smiithlelv smiithlevl smiithllve smiithllev smiithlvle smiithlvel smiithlevl smiithlelv
smiithellv smiithelvl smiithellv smiithelvl smiithevll smiithevll smiitlhvle smiitlhvel smiitlhlve smiitlhlev smiitlhelv
smiitlhevl smiitlvhle smiitlvhel smiitlvlhe smiitlvleh smiitlvelh smiitlvehl smiitllvhe smiitllveh smiitllhve smiitllhev
smiitllehv smiitllevh smiitlevlh smiitlevhl smiitlelvh smiitlelhv smiitlehlv smiitlehvl smiitlhlve smiitlhlev smiitlhvle
smiitlhvel smiitlhevl smiitlhelv smiitllhve smiitllhev smiitllvhe smiitllveh smiitllevh smiitllehv smiitlvlhe smiitlvleh
smiitlvhle smiitlvhel smiitlvehl smiitlvelh smiitlelvh smiitlelhv smiitlevlh smiitlevhl smiitlehvl smiitlehlv smiitehllv
smiitehlvl smiitehllv smiitehlvl smiitehvll smiitehvll smiitelhlv smiitelhvl smiitellhv smiitellvh smiitelvlh smiitelvhl
smiitellhv smiitellvh smiitelhlv smiitelhvl smiitelvhl smiitelvlh smiitevllh smiitevlhl smiitevllh smiitevlhl smiitevhll
smiitevhll smiilvthle smiilvthel smiilvtlhe smiilvtleh smiilvtelh smiilvtehl smiilvhtle smiilvhtel smiilvhlte smiilvhlet
smiilvhelt smiilvhetl smiilvlhte smiilvlhet smiilvlthe smiilvlteh smiilvleth smiilvleht smiilvehlt smiilvehtl smiilvelht
smiilvelth smiilvetlh smiilvethl smiiltvhle smiiltvhel smiiltvlhe smiiltvleh smiiltvelh smiiltvehl smiilthvle smiilthvel
smiilthlve smiilthlev smiilthelv smiilthevl smiiltlhve smiiltlhev smiiltlvhe smiiltlveh smiiltlevh smiiltlehv smiiltehlv
smiiltehvl smiiltelhv smiiltelvh smiiltevlh smiiltevhl smiilhtvle smiilhtvel smiilhtlve smiilhtlev smiilhtelv smiilhtevl
smiilhvtle smiilhvtel smiilhvlte smiilhvlet smiilhvelt smiilhvetl smiilhlvte smiilhlvet smiilhltve smiilhltev smiilhletv
smiilhlevt smiilhevlt smiilhevtl smiilhelvt smiilheltv smiilhetlv smiilhetvl smiillthve smiillthev smiilltvhe smiilltveh
smiilltevh smiilltehv smiillhtve smiillhtev smiillhvte smiillhvet smiillhevt smiillhetv smiillvhte smiillvhet smiillvthe
smiillvteh smiillveth smiillveht smiillehvt smiillehtv smiillevht smiillevth smiilletvh smiillethv smiilethlv smiilethvl
smiiletlhv smiiletlvh smiiletvlh smiiletvhl smiilehtlv smiilehtvl smiilehltv smiilehlvt smiilehvlt smiilehvtl smiilelhtv
smiilelhvt smiilelthv smiileltvh smiilelvth smiilelvht smiilevhlt smiilevhtl smiilevlht smiilevlth smiilevtlh smiilevthl
smiilvtlhe smiilvtleh smiilvthle smiilvthel smiilvtehl smiilvtelh smiilvlthe smiilvlteh smiilvlhte smiilvlhet smiilvleht
smiilvleth smiilvhlte smiilvhlet smiilvhtle smiilvhtel smiilvhetl smiilvhelt smiilvelht smiilvelth smiilvehlt smiilvehtl
smiilvethl smiilvetlh smiiltvlhe smiiltvleh smiiltvhle smiiltvhel smiiltvehl smiiltvelh smiiltlvhe smiiltlveh smiiltlhve
smiiltlhev smiiltlehv smiiltlevh smiilthlve smiilthlev smiilthvle smiilthvel smiilthevl smiilthelv smiiltelhv smiiltelvh
smiiltehlv smiiltehvl smiiltevhl smiiltevlh smiilltvhe smiilltveh smiillthve smiillthev smiilltehv smiilltevh smiillvthe
smiillvteh smiillvhte smiillvhet smiillveht smiillveth smiillhvte smiillhvet smiillhtve smiillhtev smiillhetv smiillhevt
smiillevht smiillevth smiillehvt smiillehtv smiillethv smiilletvh smiilhtlve smiilhtlev smiilhtvle smiilhtvel smiilhtevl
smiilhtelv smiilhltve smiilhltev smiilhlvte smiilhlvet smiilhlevt smiilhletv smiilhvlte smiilhvlet smiilhvtle smiilhvtel
smiilhvetl smiilhvelt smiilhelvt smiilheltv smiilhevlt smiilhevtl smiilhetvl smiilhetlv smiiletlhv smiiletlvh smiilethlv
smiilethvl smiiletvhl smiiletvlh smiilelthv smiileltvh smiilelhtv smiilelhvt smiilelvht smiilelvth smiilehltv smiilehlvt
smiilehtlv smiilehtvl smiilehvtl smiilehvlt smiilevlht smiilevlth smiilevhlt smiilevhtl smiilevthl smiilevtlh smiievtllh
smiievtlhl smiievtllh smiievtlhl smiievthll smiievthll smiievltlh smiievlthl smiievllth smiievllht smiievlhlt smiievlhtl
smiievllth smiievllht smiievltlh smiievlthl smiievlhtl smiievlhlt smiievhllt smiievhltl smiievhllt smiievhltl smiievhtll
smiievhtll smiietvllh smiietvlhl smiietvllh smiietvlhl smiietvhll smiietvhll smiietlvlh smiietlvhl smiietllvh smiietllhv
smiietlhlv smiietlhvl smiietllvh smiietllhv smiietlvlh smiietlvhl smiietlhvl smiietlhlv smiiethllv smiiethlvl smiiethllv
smiiethlvl smiiethvll smiiethvll smiieltvlh smiieltvhl smiieltlvh smiieltlhv smiielthlv smiielthvl smiielvtlh smiielvthl
smiielvlth smiielvlht smiielvhlt smiielvhtl smiiellvth smiiellvht smiielltvh smiiellthv smiiellhtv smiiellhvt smiielhvlt
smiielhvtl smiielhlvt smiielhltv smiielhtlv smiielhtvl smiieltlvh smiieltlhv smiieltvlh smiieltvhl smiielthvl smiielthlv
smiielltvh smiiellthv smiiellvth smiiellvht smiiellhvt smiiellhtv smiielvlth smiielvlht smiielvtlh smiielvthl smiielvhtl
smiielvhlt smiielhlvt smiielhltv smiielhvlt smiielhvtl smiielhtvl smiielhtlv smiiehtllv smiiehtlvl smiiehtllv smiiehtlvl
smiiehtvll smiiehtvll smiiehltlv smiiehltvl smiiehlltv smiiehllvt smiiehlvlt smiiehlvtl smiiehlltv smiiehllvt smiiehltlv
smiiehltvl smiiehlvtl smiiehlvlt smiiehvllt smiiehvltl smiiehvllt smiiehvltl smiiehvtll smiiehvtll smilhvitle smilhvitel
smilhvilte smilhvilet smilhvielt smilhvietl smilhvtile smilhvtiel smilhvtlie smilhvtlei smilhvteli smilhvteil smilhvltie
smilhvltei smilhvlite smilhvliet smilhvleit smilhvleti smilhvetli smilhvetil smilhvelti smilhvelit smilhveilt smilhveitl
smilhivtle smilhivtel smilhivlte smilhivlet smilhivelt smilhivetl smilhitvle smilhitvel smilhitlve smilhitlev smilhitelv
smilhitevl smilhiltve smilhiltev smilhilvte smilhilvet smilhilevt smilhiletv smilhietlv smilhietvl smilhieltv smilhielvt
smilhievlt smilhievtl smilhtivle smilhtivel smilhtilve smilhtilev smilhtielv smilhtievl smilhtvile smilhtviel smilhtvlie
smilhtvlei smilhtveli smilhtveil smilhtlvie smilhtlvei smilhtlive smilhtliev smilhtleiv smilhtlevi smilhtevli smilhtevil
smilhtelvi smilhteliv smilhteilv smilhteivl smilhlitve smilhlitev smilhlivte smilhlivet smilhlievt smilhlietv smilhltive
smilhltiev smilhltvie smilhltvei smilhltevi smilhlteiv smilhlvtie smilhlvtei smilhlvite smilhlviet smilhlveit smilhlveti
smilhletvi smilhletiv smilhlevti smilhlevit smilhleivt smilhleitv smilheitlv smilheitvl smilheiltv smilheilvt smilheivlt
smilheivtl smilhetilv smilhetivl smilhetliv smilhetlvi smilhetvli smilhetvil smilheltiv smilheltvi smilhelitv smilhelivt
smilhelvit smilhelvti smilhevtli smilhevtil smilhevlti smilhevlit smilhevilt smilhevitl smilvhitle smilvhitel smilvhilte
smilvhilet smilvhielt smilvhietl smilvhtile smilvhtiel smilvhtlie smilvhtlei smilvhteli smilvhteil smilvhltie smilvhltei
smilvhlite smilvhliet smilvhleit smilvhleti smilvhetli smilvhetil smilvhelti smilvhelit smilvheilt smilvheitl smilvihtle
smilvihtel smilvihlte smilvihlet smilvihelt smilvihetl smilvithle smilvithel smilvitlhe smilvitleh smilvitelh smilvitehl
smilvilthe smilvilteh smilvilhte smilvilhet smilvileht smilvileth smilvietlh smilviethl smilvielth smilvielht smilviehlt
smilviehtl smilvtihle smilvtihel smilvtilhe smilvtileh smilvtielh smilvtiehl smilvthile smilvthiel smilvthlie smilvthlei
smilvtheli smilvtheil smilvtlhie smilvtlhei smilvtlihe smilvtlieh smilvtleih smilvtlehi smilvtehli smilvtehil smilvtelhi
smilvtelih smilvteilh smilvteihl smilvlithe smilvliteh smilvlihte smilvlihet smilvlieht smilvlieth smilvltihe smilvltieh
smilvlthie smilvlthei smilvltehi smilvlteih smilvlhtie smilvlhtei smilvlhite smilvlhiet smilvlheit smilvlheti smilvlethi
smilvletih smilvlehti smilvlehit smilvleiht smilvleith smilveitlh smilveithl smilveilth smilveilht smilveihlt smilveihtl
smilvetilh smilvetihl smilvetlih smilvetlhi smilvethli smilvethil smilveltih smilvelthi smilvelith smilveliht smilvelhit
smilvelhti smilvehtli smilvehtil smilvehlti smilvehlit smilvehilt smilvehitl smilivhtle smilivhtel smilivhlte smilivhlet
smilivhelt smilivhetl smilivthle smilivthel smilivtlhe smilivtleh smilivtelh smilivtehl smilivlthe smilivlteh smilivlhte
smilivlhet smilivleht smilivleth smilivetlh smilivethl smilivelth smilivelht smilivehlt smilivehtl smilihvtle smilihvtel
smilihvlte smilihvlet smilihvelt smilihvetl smilihtvle smilihtvel smilihtlve smilihtlev smilihtelv smilihtevl smilihltve
smilihltev smilihlvte smilihlvet smilihlevt smilihletv smilihetlv smilihetvl smiliheltv smilihelvt smilihevlt smilihevtl
smilithvle smilithvel smilithlve smilithlev smilithelv smilithevl smilitvhle smilitvhel smilitvlhe smilitvleh smilitvelh
smilitvehl smilitlvhe smilitlveh smilitlhve smilitlhev smilitlehv smilitlevh smilitevlh smilitevhl smilitelvh smilitelhv
smilitehlv smilitehvl smililhtve smililhtev smililhvte smililhvet smililhevt smililhetv smililthve smililthev smililtvhe
smililtveh smililtevh smililtehv smililvthe smililvteh smililvhte smililvhet smililveht smililveth smililetvh smililethv
smililevth smililevht smililehvt smililehtv smiliehtlv smiliehtvl smiliehltv smiliehlvt smiliehvlt smiliehvtl smiliethlv
smiliethvl smilietlhv smilietlvh smilietvlh smilietvhl smilielthv smilieltvh smilielhtv smilielhvt smilielvht smilielvth
smilievtlh smilievthl smilievlth smilievlht smilievhlt smilievhtl smiltvihle smiltvihel smiltvilhe smiltvileh smiltvielh
smiltviehl smiltvhile smiltvhiel smiltvhlie smiltvhlei smiltvheli smiltvheil smiltvlhie smiltvlhei smiltvlihe smiltvlieh
smiltvleih smiltvlehi smiltvehli smiltvehil smiltvelhi smiltvelih smiltveilh smiltveihl smiltivhle smiltivhel smiltivlhe
smiltivleh smiltivelh smiltivehl smiltihvle smiltihvel smiltihlve smiltihlev smiltihelv smiltihevl smiltilhve smiltilhev
smiltilvhe smiltilveh smiltilevh smiltilehv smiltiehlv smiltiehvl smiltielhv smiltielvh smiltievlh smiltievhl smilthivle
smilthivel smilthilve smilthilev smilthielv smilthievl smilthvile smilthviel smilthvlie smilthvlei smilthveli smilthveil
smilthlvie smilthlvei smilthlive smilthliev smilthleiv smilthlevi smilthevli smilthevil smilthelvi smiltheliv smiltheilv
smiltheivl smiltlihve smiltlihev smiltlivhe smiltliveh smiltlievh smiltliehv smiltlhive smiltlhiev smiltlhvie smiltlhvei
smiltlhevi smiltlheiv smiltlvhie smiltlvhei smiltlvihe smiltlvieh smiltlveih smiltlvehi smiltlehvi smiltlehiv smiltlevhi
smiltlevih smiltleivh smiltleihv smilteihlv smilteihvl smilteilhv smilteilvh smilteivlh smilteivhl smiltehilv smiltehivl
smiltehliv smiltehlvi smiltehvli smiltehvil smiltelhiv smiltelhvi smiltelihv smiltelivh smiltelvih smiltelvhi smiltevhli
smiltevhil smiltevlhi smiltevlih smiltevilh smiltevihl smillvithe smillviteh smillvihte smillvihet smillvieht smillvieth
smillvtihe smillvtieh smillvthie smillvthei smillvtehi smillvteih smillvhtie smillvhtei smillvhite smillvhiet smillvheit
smillvheti smillvethi smillvetih smillvehti smillvehit smillveiht smillveith smillivthe smillivteh smillivhte smillivhet
smilliveht smilliveth smillitvhe smillitveh smillithve smillithev smillitehv smillitevh smillihtve smillihtev smillihvte
smillihvet smillihevt smillihetv smilliethv smillietvh smilliehtv smilliehvt smillievht smillievth smilltivhe smilltiveh
smilltihve smilltihev smilltiehv smilltievh smilltvihe smilltvieh smilltvhie smilltvhei smilltvehi smilltveih smillthvie
smillthvei smillthive smillthiev smilltheiv smillthevi smilltevhi smilltevih smilltehvi smilltehiv smillteihv smillteivh
smillhitve smillhitev smillhivte smillhivet smillhievt smillhietv smillhtive smillhtiev smillhtvie smillhtvei smillhtevi
smillhteiv smillhvtie smillhvtei smillhvite smillhviet smillhveit smillhveti smillhetvi smillhetiv smillhevti smillhevit
smillheivt smillheitv smilleithv smilleitvh smilleihtv smilleihvt smilleivht smilleivth smilletihv smilletivh smillethiv
smillethvi smilletvhi smilletvih smillehtiv smillehtvi smillehitv smillehivt smillehvit smillehvti smillevthi smillevtih
smillevhti smillevhit smilleviht smillevith smilevitlh smilevithl smilevilth smilevilht smilevihlt smilevihtl smilevtilh
smilevtihl smilevtlih smilevtlhi smilevthli smilevthil smilevltih smilevlthi smilevlith smilevliht smilevlhit smilevlhti
smilevhtli smilevhtil smilevhlti smilevhlit smilevhilt smilevhitl smileivtlh smileivthl smileivlth smileivlht smileivhlt
smileivhtl smileitvlh smileitvhl smileitlvh smileitlhv smileithlv smileithvl smileiltvh smileilthv smileilvth smileilvht
smileilhvt smileilhtv smileihtlv smileihtvl smileihltv smileihlvt smileihvlt smileihvtl smiletivlh smiletivhl smiletilvh
smiletilhv smiletihlv smiletihvl smiletvilh smiletvihl smiletvlih smiletvlhi smiletvhli smiletvhil smiletlvih smiletlvhi
smiletlivh smiletlihv smiletlhiv smiletlhvi smilethvli smilethvil smilethlvi smilethliv smilethilv smilethivl smilelitvh
smilelithv smilelivth smilelivht smilelihvt smilelihtv smileltivh smileltihv smileltvih smileltvhi smilelthvi smilelthiv
smilelvtih smilelvthi smilelvith smilelviht smilelvhit smilelvhti smilelhtvi smilelhtiv smilelhvti smilelhvit smilelhivt
smilelhitv smilehitlv smilehitvl smilehiltv smilehilvt smilehivlt smilehivtl smilehtilv smilehtivl smilehtliv smilehtlvi
smilehtvli smilehtvil smilehltiv smilehltvi smilehlitv smilehlivt smilehlvit smilehlvti smilehvtli smilehvtil smilehvlti
smilehvlit smilehvilt smilehvitl smilhvilte smilhvilet smilhvitle smilhvitel smilhvietl smilhvielt smilhvlite smilhvliet
smilhvltie smilhvltei smilhvleti smilhvleit smilhvtlie smilhvtlei smilhvtile smilhvtiel smilhvteil smilhvteli smilhvelti
smilhvelit smilhvetli smilhvetil smilhveitl smilhveilt smilhivlte smilhivlet smilhivtle smilhivtel smilhivetl smilhivelt
smilhilvte smilhilvet smilhiltve smilhiltev smilhiletv smilhilevt smilhitlve smilhitlev smilhitvle smilhitvel smilhitevl
smilhitelv smilhieltv smilhielvt smilhietlv smilhietvl smilhievtl smilhievlt smilhlivte smilhlivet smilhlitve smilhlitev
smilhlietv smilhlievt smilhlvite smilhlviet smilhlvtie smilhlvtei smilhlveti smilhlveit smilhltvie smilhltvei smilhltive
smilhltiev smilhlteiv smilhltevi smilhlevti smilhlevit smilhletvi smilhletiv smilhleitv smilhleivt smilhtilve smilhtilev
smilhtivle smilhtivel smilhtievl smilhtielv smilhtlive smilhtliev smilhtlvie smilhtlvei smilhtlevi smilhtleiv smilhtvlie
smilhtvlei smilhtvile smilhtviel smilhtveil smilhtveli smilhtelvi smilhteliv smilhtevli smilhtevil smilhteivl smilhteilv
smilheiltv smilheilvt smilheitlv smilheitvl smilheivtl smilheivlt smilhelitv smilhelivt smilheltiv smilheltvi smilhelvti
smilhelvit smilhetliv smilhetlvi smilhetilv smilhetivl smilhetvil smilhetvli smilhevlti smilhevlit smilhevtli smilhevtil
smilhevitl smilhevilt smilvhilte smilvhilet smilvhitle smilvhitel smilvhietl smilvhielt smilvhlite smilvhliet smilvhltie
smilvhltei smilvhleti smilvhleit smilvhtlie smilvhtlei smilvhtile smilvhtiel smilvhteil smilvhteli smilvhelti smilvhelit
smilvhetli smilvhetil smilvheitl smilvheilt smilvihlte smilvihlet smilvihtle smilvihtel smilvihetl smilvihelt smilvilhte
smilvilhet smilvilthe smilvilteh smilvileth smilvileht smilvitlhe smilvitleh smilvithle smilvithel smilvitehl smilvitelh
smilvielth smilvielht smilvietlh smilviethl smilviehtl smilviehlt smilvlihte smilvlihet smilvlithe smilvliteh smilvlieth
smilvlieht smilvlhite smilvlhiet smilvlhtie smilvlhtei smilvlheti smilvlheit smilvlthie smilvlthei smilvltihe smilvltieh
smilvlteih smilvltehi smilvlehti smilvlehit smilvlethi smilvletih smilvleith smilvleiht smilvtilhe smilvtileh smilvtihle
smilvtihel smilvtiehl smilvtielh smilvtlihe smilvtlieh smilvtlhie smilvtlhei smilvtlehi smilvtleih smilvthlie smilvthlei
smilvthile smilvthiel smilvtheil smilvtheli smilvtelhi smilvtelih smilvtehli smilvtehil smilvteihl smilvteilh smilveilth
smilveilht smilveitlh smilveithl smilveihtl smilveihlt smilvelith smilveliht smilveltih smilvelthi smilvelhti smilvelhit
smilvetlih smilvetlhi smilvetilh smilvetihl smilvethil smilvethli smilvehlti smilvehlit smilvehtli smilvehtil smilvehitl
smilvehilt smilivhlte smilivhlet smilivhtle smilivhtel smilivhetl smilivhelt smilivlhte smilivlhet smilivlthe smilivlteh
smilivleth smilivleht smilivtlhe smilivtleh smilivthle smilivthel smilivtehl smilivtelh smilivelth smilivelht smilivetlh
smilivethl smilivehtl smilivehlt smilihvlte smilihvlet smilihvtle smilihvtel smilihvetl smilihvelt smilihlvte smilihlvet
smilihltve smilihltev smilihletv smilihlevt smilihtlve smilihtlev smilihtvle smilihtvel smilihtevl smilihtelv smiliheltv
smilihelvt smilihetlv smilihetvl smilihevtl smilihevlt smililhvte smililhvet smililhtve smililhtev smililhetv smililhevt
smililvhte smililvhet smililvthe smililvteh smililveth smililveht smililtvhe smililtveh smililthve smililthev smililtehv
smililtevh smililevth smililevht smililetvh smililethv smililehtv smililehvt smilithlve smilithlev smilithvle smilithvel
smilithevl smilithelv smilitlhve smilitlhev smilitlvhe smilitlveh smilitlevh smilitlehv smilitvlhe smilitvleh smilitvhle
smilitvhel smilitvehl smilitvelh smilitelvh smilitelhv smilitevlh smilitevhl smilitehvl smilitehlv smiliehltv smiliehlvt
smiliehtlv smiliehtvl smiliehvtl smiliehvlt smilielhtv smilielhvt smilielthv smilieltvh smilielvth smilielvht smilietlhv
smilietlvh smiliethlv smiliethvl smilietvhl smilietvlh smilievlth smilievlht smilievtlh smilievthl smilievhtl smilievhlt
smillvihte smillvihet smillvithe smillviteh smillvieth smillvieht smillvhite smillvhiet smillvhtie smillvhtei smillvheti
smillvheit smillvthie smillvthei smillvtihe smillvtieh smillvteih smillvtehi smillvehti smillvehit smillvethi smillvetih
smillveith smillveiht smillivhte smillivhet smillivthe smillivteh smilliveth smilliveht smillihvte smillihvet smillihtve
smillihtev smillihetv smillihevt smillithve smillithev smillitvhe smillitveh smillitevh smillitehv smilliehtv smilliehvt
smilliethv smillietvh smillievth smillievht smillhivte smillhivet smillhitve smillhitev smillhietv smillhievt smillhvite
smillhviet smillhvtie smillhvtei smillhveti smillhveit smillhtvie smillhtvei smillhtive smillhtiev smillhteiv smillhtevi
smillhevti smillhevit smillhetvi smillhetiv smillheitv smillheivt smilltihve smilltihev smilltivhe smilltiveh smilltievh
smilltiehv smillthive smillthiev smillthvie smillthvei smillthevi smilltheiv smilltvhie smilltvhei smilltvihe smilltvieh
smilltveih smilltvehi smilltehvi smilltehiv smilltevhi smilltevih smillteivh smillteihv smilleihtv smilleihvt smilleithv
smilleitvh smilleivth smilleivht smillehitv smillehivt smillehtiv smillehtvi smillehvti smillehvit smillethiv smillethvi
smilletihv smilletivh smilletvih smilletvhi smillevhti smillevhit smillevthi smillevtih smillevith smilleviht smiltvilhe
smiltvileh smiltvihle smiltvihel smiltviehl smiltvielh smiltvlihe smiltvlieh smiltvlhie smiltvlhei smiltvlehi smiltvleih
smiltvhlie smiltvhlei smiltvhile smiltvhiel smiltvheil smiltvheli smiltvelhi smiltvelih smiltvehli smiltvehil smiltveihl
smiltveilh smiltivlhe smiltivleh smiltivhle smiltivhel smiltivehl smiltivelh smiltilvhe smiltilveh smiltilhve smiltilhev
smiltilehv smiltilevh smiltihlve smiltihlev smiltihvle smiltihvel smiltihevl smiltihelv smiltielhv smiltielvh smiltiehlv
smiltiehvl smiltievhl smiltievlh smiltlivhe smiltliveh smiltlihve smiltlihev smiltliehv smiltlievh smiltlvihe smiltlvieh
smiltlvhie smiltlvhei smiltlvehi smiltlveih smiltlhvie smiltlhvei smiltlhive smiltlhiev smiltlheiv smiltlhevi smiltlevhi
smiltlevih smiltlehvi smiltlehiv smiltleihv smiltleivh smilthilve smilthilev smilthivle smilthivel smilthievl smilthielv
smilthlive smilthliev smilthlvie smilthlvei smilthlevi smilthleiv smilthvlie smilthvlei smilthvile smilthviel smilthveil
smilthveli smilthelvi smiltheliv smilthevli smilthevil smiltheivl smiltheilv smilteilhv smilteilvh smilteihlv smilteihvl
smilteivhl smilteivlh smiltelihv smiltelivh smiltelhiv smiltelhvi smiltelvhi smiltelvih smiltehliv smiltehlvi smiltehilv
smiltehivl smiltehvil smiltehvli smiltevlhi smiltevlih smiltevhli smiltevhil smiltevihl smiltevilh smilevilth smilevilht
smilevitlh smilevithl smilevihtl smilevihlt smilevlith smilevliht smilevltih smilevlthi smilevlhti smilevlhit smilevtlih
smilevtlhi smilevtilh smilevtihl smilevthil smilevthli smilevhlti smilevhlit smilevhtli smilevhtil smilevhitl smilevhilt
smileivlth smileivlht smileivtlh smileivthl smileivhtl smileivhlt smileilvth smileilvht smileiltvh smileilthv smileilhtv
smileilhvt smileitlvh smileitlhv smileitvlh smileitvhl smileithvl smileithlv smileihltv smileihlvt smileihtlv smileihtvl
smileihvtl smileihvlt smilelivth smilelivht smilelitvh smilelithv smilelihtv smilelihvt smilelvith smilelviht smilelvtih
smilelvthi smilelvhti smilelvhit smileltvih smileltvhi smileltivh smileltihv smilelthiv smilelthvi smilelhvti smilelhvit
smilelhtvi smilelhtiv smilelhitv smilelhivt smiletilvh smiletilhv smiletivlh smiletivhl smiletihvl smiletihlv smiletlivh
smiletlihv smiletlvih smiletlvhi smiletlhvi smiletlhiv smiletvlih smiletvlhi smiletvilh smiletvihl smiletvhil smiletvhli
smilethlvi smilethliv smilethvli smilethvil smilethivl smilethilv smilehiltv smilehilvt smilehitlv smilehitvl smilehivtl
smilehivlt smilehlitv smilehlivt smilehltiv smilehltvi smilehlvti smilehlvit smilehtliv smilehtlvi smilehtilv smilehtivl
smilehtvil smilehtvli smilehvlti smilehvlit smilehvtli smilehvtil smilehvitl smilehvilt smiehvillt smiehviltl smiehvillt
smiehviltl smiehvitll smiehvitll smiehvlilt smiehvlitl smiehvllit smiehvllti smiehvltli smiehvltil smiehvllit smiehvllti
smiehvlilt smiehvlitl smiehvltil smiehvltli smiehvtlli smiehvtlil smiehvtlli smiehvtlil smiehvtill smiehvtill smiehivllt
smiehivltl smiehivllt smiehivltl smiehivtll smiehivtll smiehilvlt smiehilvtl smiehillvt smiehilltv smiehiltlv smiehiltvl
smiehillvt smiehilltv smiehilvlt smiehilvtl smiehiltvl smiehiltlv smiehitllv smiehitlvl smiehitllv smiehitlvl smiehitvll
smiehitvll smiehlivlt smiehlivtl smiehlilvt smiehliltv smiehlitlv smiehlitvl smiehlvilt smiehlvitl smiehlvlit smiehlvlti
smiehlvtli smiehlvtil smiehllvit smiehllvti smiehllivt smiehllitv smiehlltiv smiehlltvi smiehltvli smiehltvil smiehltlvi
smiehltliv smiehltilv smiehltivl smiehlilvt smiehliltv smiehlivlt smiehlivtl smiehlitvl smiehlitlv smiehllivt smiehllitv
smiehllvit smiehllvti smiehlltvi smiehlltiv smiehlvlit smiehlvlti smiehlvilt smiehlvitl smiehlvtil smiehlvtli smiehltlvi
smiehltliv smiehltvli smiehltvil smiehltivl smiehltilv smiehtillv smiehtilvl smiehtillv smiehtilvl smiehtivll smiehtivll
smiehtlilv smiehtlivl smiehtlliv smiehtllvi smiehtlvli smiehtlvil smiehtlliv smiehtllvi smiehtlilv smiehtlivl smiehtlvil
smiehtlvli smiehtvlli smiehtvlil smiehtvlli smiehtvlil smiehtvill smiehtvill smievhillt smievhiltl smievhillt smievhiltl
smievhitll smievhitll smievhlilt smievhlitl smievhllit smievhllti smievhltli smievhltil smievhllit smievhllti smievhlilt
smievhlitl smievhltil smievhltli smievhtlli smievhtlil smievhtlli smievhtlil smievhtill smievhtill smievihllt smievihltl
smievihllt smievihltl smievihtll smievihtll smievilhlt smievilhtl smievillht smievillth smieviltlh smievilthl smievillht
smievillth smievilhlt smievilhtl smievilthl smieviltlh smievitllh smievitlhl smievitllh smievitlhl smievithll smievithll
smievlihlt smievlihtl smievlilht smievlilth smievlitlh smievlithl smievlhilt smievlhitl smievlhlit smievlhlti smievlhtli
smievlhtil smievllhit smievllhti smievlliht smievllith smievlltih smievllthi smievlthli smievlthil smievltlhi smievltlih
smievltilh smievltihl smievlilht smievlilth smievlihlt smievlihtl smievlithl smievlitlh smievlliht smievllith smievllhit
smievllhti smievllthi smievlltih smievlhlit smievlhlti smievlhilt smievlhitl smievlhtil smievlhtli smievltlhi smievltlih
smievlthli smievlthil smievltihl smievltilh smievtillh smievtilhl smievtillh smievtilhl smievtihll smievtihll smievtlilh
smievtlihl smievtllih smievtllhi smievtlhli smievtlhil smievtllih smievtllhi smievtlilh smievtlihl smievtlhil smievtlhli
smievthlli smievthlil smievthlli smievthlil smievthill smievthill smieivhllt smieivhltl smieivhllt smieivhltl smieivhtll
smieivhtll smieivlhlt smieivlhtl smieivllht smieivllth smieivltlh smieivlthl smieivllht smieivllth smieivlhlt smieivlhtl
smieivlthl smieivltlh smieivtllh smieivtlhl smieivtllh smieivtlhl smieivthll smieivthll smieihvllt smieihvltl smieihvllt
smieihvltl smieihvtll smieihvtll smieihlvlt smieihlvtl smieihllvt smieihlltv smieihltlv smieihltvl smieihllvt smieihlltv
smieihlvlt smieihlvtl smieihltvl smieihltlv smieihtllv smieihtlvl smieihtllv smieihtlvl smieihtvll smieihtvll smieilhvlt
smieilhvtl smieilhlvt smieilhltv smieilhtlv smieilhtvl smieilvhlt smieilvhtl smieilvlht smieilvlth smieilvtlh smieilvthl
smieillvht smieillvth smieillhvt smieillhtv smieillthv smieilltvh smieiltvlh smieiltvhl smieiltlvh smieiltlhv smieilthlv
smieilthvl smieilhlvt smieilhltv smieilhvlt smieilhvtl smieilhtvl smieilhtlv smieillhvt smieillhtv smieillvht smieillvth
smieilltvh smieillthv smieilvlht smieilvlth smieilvhlt smieilvhtl smieilvthl smieilvtlh smieiltlvh smieiltlhv smieiltvlh
smieiltvhl smieilthvl smieilthlv smieithllv smieithlvl smieithllv smieithlvl smieithvll smieithvll smieitlhlv smieitlhvl
smieitllhv smieitllvh smieitlvlh smieitlvhl smieitllhv smieitllvh smieitlhlv smieitlhvl smieitlvhl smieitlvlh smieitvllh
smieitvlhl smieitvllh smieitvlhl smieitvhll smieitvhll smielvihlt smielvihtl smielvilht smielvilth smielvitlh smielvithl
smielvhilt smielvhitl smielvhlit smielvhlti smielvhtli smielvhtil smielvlhit smielvlhti smielvliht smielvlith smielvltih
smielvlthi smielvthli smielvthil smielvtlhi smielvtlih smielvtilh smielvtihl smielivhlt smielivhtl smielivlht smielivlth
smielivtlh smielivthl smielihvlt smielihvtl smielihlvt smielihltv smielihtlv smielihtvl smielilhvt smielilhtv smielilvht
smielilvth smieliltvh smielilthv smielithlv smielithvl smielitlhv smielitlvh smielitvlh smielitvhl smielhivlt smielhivtl
smielhilvt smielhiltv smielhitlv smielhitvl smielhvilt smielhvitl smielhvlit smielhvlti smielhvtli smielhvtil smielhlvit
smielhlvti smielhlivt smielhlitv smielhltiv smielhltvi smielhtvli smielhtvil smielhtlvi smielhtliv smielhtilv smielhtivl
smiellihvt smiellihtv smiellivht smiellivth smiellitvh smiellithv smiellhivt smiellhitv smiellhvit smiellhvti smiellhtvi
smiellhtiv smiellvhit smiellvhti smiellviht smiellvith smiellvtih smiellvthi smiellthvi smiellthiv smielltvhi smielltvih
smielltivh smielltihv smieltihlv smieltihvl smieltilhv smieltilvh smieltivlh smieltivhl smielthilv smielthivl smielthliv
smielthlvi smielthvli smielthvil smieltlhiv smieltlhvi smieltlihv smieltlivh smieltlvih smieltlvhi smieltvhli smieltvhil
smieltvlhi smieltvlih smieltvilh smieltvihl smielvilht smielvilth smielvihlt smielvihtl smielvithl smielvitlh smielvliht
smielvlith smielvlhit smielvlhti smielvlthi smielvltih smielvhlit smielvhlti smielvhilt smielvhitl smielvhtil smielvhtli
smielvtlhi smielvtlih smielvthli smielvthil smielvtihl smielvtilh smielivlht smielivlth smielivhlt smielivhtl smielivthl
smielivtlh smielilvht smielilvth smielilhvt smielilhtv smielilthv smieliltvh smielihlvt smielihltv smielihvlt smielihvtl
smielihtvl smielihtlv smielitlhv smielitlvh smielithlv smielithvl smielitvhl smielitvlh smiellivht smiellivth smiellihvt
smiellihtv smiellithv smiellitvh smiellviht smiellvith smiellvhit smiellvhti smiellvthi smiellvtih smiellhvit smiellhvti
smiellhivt smiellhitv smiellhtiv smiellhtvi smielltvhi smielltvih smiellthvi smiellthiv smielltihv smielltivh smielhilvt
smielhiltv smielhivlt smielhivtl smielhitvl smielhitlv smielhlivt smielhlitv smielhlvit smielhlvti smielhltvi smielhltiv
smielhvlit smielhvlti smielhvilt smielhvitl smielhvtil smielhvtli smielhtlvi smielhtliv smielhtvli smielhtvil smielhtivl
smielhtilv smieltilhv smieltilvh smieltihlv smieltihvl smieltivhl smieltivlh smieltlihv smieltlivh smieltlhiv smieltlhvi
smieltlvhi smieltlvih smielthliv smielthlvi smielthilv smielthivl smielthvil smielthvli smieltvlhi smieltvlih smieltvhli
smieltvhil smieltvihl smieltvilh smietvillh smietvilhl smietvillh smietvilhl smietvihll smietvihll smietvlilh smietvlihl
smietvllih smietvllhi smietvlhli smietvlhil smietvllih smietvllhi smietvlilh smietvlihl smietvlhil smietvlhli smietvhlli
smietvhlil smietvhlli smietvhlil smietvhill smietvhill smietivllh smietivlhl smietivllh smietivlhl smietivhll smietivhll
smietilvlh smietilvhl smietillvh smietillhv smietilhlv smietilhvl smietillvh smietillhv smietilvlh smietilvhl smietilhvl
smietilhlv smietihllv smietihlvl smietihllv smietihlvl smietihvll smietihvll smietlivlh smietlivhl smietlilvh smietlilhv
smietlihlv smietlihvl smietlvilh smietlvihl smietlvlih smietlvlhi smietlvhli smietlvhil smietllvih smietllvhi smietllivh
smietllihv smietllhiv smietllhvi smietlhvli smietlhvil smietlhlvi smietlhliv smietlhilv smietlhivl smietlilvh smietlilhv
smietlivlh smietlivhl smietlihvl smietlihlv smietllivh smietllihv smietllvih smietllvhi smietllhvi smietllhiv smietlvlih
smietlvlhi smietlvilh smietlvihl smietlvhil smietlvhli smietlhlvi smietlhliv smietlhvli smietlhvil smietlhivl smietlhilv
smiethillv smiethilvl smiethillv smiethilvl smiethivll smiethivll smiethlilv smiethlivl smiethlliv smiethllvi smiethlvli
smiethlvil smiethlliv smiethllvi smiethlilv smiethlivl smiethlvil smiethlvli smiethvlli smiethvlil smiethvlli smiethvlil
smiethvill smiethvill

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us