easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

secessionalist

functor

puros

smidgen

elizaville

kaiak

yakattalo

homobaric

rivoalto

effata

anhtuan

calfee

usuriousness

vanostrand

bikeway

refavor

scerbo

voluminaque


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: simuleturque
cipher variations:
tjnvmfuvsrvf ukowngvwtswg vlpxohwxutxh wmqypixyvuyi xnrzqjyzwvzj
yosarkzaxwak zptbslabyxbl aquctmbczycm brvduncdazdn cswevodebaeo
dtxfwpefcbfp euygxqfgdcgq fvzhyrghedhr gwaizshifeis hxbjatijgfjt
iyckbujkhgku jzdlcvklihlv kaemdwlmjimw lbfnexmnkjnx mcgofynolkoy
ndhpgzopmlpz oeiqhapqnmqa pfjribqronrb qgksjcrsposc rhltkdstqptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: simuleturque
Cipher: hrnfovgfijfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: simuleturque
Cipher: BAAAB ABAAA ABABB BAABB ABABA AABAA BAABA BAABB BAAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: simuleturque
cipher variations:
tjnvmfuvsrvfdzljingjaxjnnpjxevsxidxvxfhladelqjldhvfzwlqzypzlrldnstcngvntlrzpkjapwhpjvhxdgrmdendr
fxvrczyrmtrzpntfyhkfuzfhzdrtupwtcftpjtphqxihklhxukowngvwtswgeamkjohkbykooqkyfwtyjeywygimbefmrkme
iwgaxmrazqamsmeotudohwoumsaqlkbqxiqkwiyehsnefoesgywsdazsnusaqougzilgvagiaesuvqxudguqkuqiryjilmiy
vlpxohwxutxhfbnlkpilczlpprlzgxuzkfzxzhjncfgnslnfjxhbynsbarbntnfpuvepixpvntbrmlcryjrlxjzfitofgpft
hzxtebatovtbrpvhajmhwbhjbftvwryvehvrlvrjszkjmnjzwmqypixyvuyigcomlqjmdamqqsmahyvalgayaikodghotmog
kyiczotcbscouogqvwfqjyqwoucsnmdszksmykagjupghqguiayufcbupwucsqwibknixcikcguwxszwfiwsmwsktalknoka
xnrzqjyzwvzjhdpnmrknebnrrtnbizwbmhbzbjlpehipunphlzjdapudctdpvphrwxgrkzrxpvdtonetaltnzlbhkvqhirhv
jbzvgdcvqxvdtrxjclojydjldhvxytaxgjxtnxtlubmloplbyosarkzaxwakieqonslofcossuocjaxcnicackmqfijqvoqi
makebqvedueqwqisxyhslasyqweupofubmuoamcilwrijsiwkcawhedwryweusykdmpkzekmeiwyzubyhkyuoyumvcnmpqmc
zptbslabyxbljfrpotmpgdpttvpdkbydojdbdlnrgjkrwprjnblfcrwfevfrxrjtyzitmbtzrxfvqpgvcnvpbndjmxsjktjx
ldbxifexszxfvtzlenqlaflnfjxzavczilzvpzvnwdonqrndaquctmbczycmkgsqpunqhequuwqelczepkecemoshklsxqsk
ocmgdsxgfwgsyskuzajuncuasygwrqhwdowqcoeknytklukymecyjgfytaygwuamformbgmogkyabwdajmawqawoxeporsoe
brvduncdazdnlhtrqvorifrvvxrfmdafqlfdfnptilmtyrtlpdnhetyhgxhtztlvabkvodvbtzhxsrixepxrdpflozulmvlz
nfdzkhgzubzhxvbngpsnchnphlzbcxebknbxrbxpyfqpstpfcswevodebaeomiusrwpsjgswwysgnebgrmgegoqujmnuzsum
qeoifuzihyiuaumwbclwpewcuaiytsjyfqyseqgmpavmnwmaogealihavcaiywcohqtodioqimacdyfclocyscyqzgrqtuqg
dtxfwpefcbfpnjvtsxqtkhtxxzthofchsnhfhprvknovatvnrfpjgvajizjvbvnxcdmxqfxdvbjzutkzgrztfrhnqbwnoxnb
phfbmjibwdbjzxdpirupejprjnbdezgdmpdztdzrahsruvrheuygxqfgdcgqokwutyruliuyyauipgditoigiqswlopwbuwo
sgqkhwbkjakwcwoydenyrgyewckavulahsaugsiorcxopyocqigcnkjcxeckayeqjsvqfkqskocefahenqeaueasbitsvwsi
fvzhyrghedhrplxvuzsvmjvzzbvjqhejupjhjrtxmpqxcvxpthrlixclkblxdxpzefozshzfxdlbwvmbitbvhtjpsdypqzpd
rjhdolkdyfdlbzfrktwrglrtlpdfgbiforfbvfbtcjutwxtjgwaizshifeisqmywvatwnkwaacwkrifkvqkiksuynqrydwyq
uismjydmlcmyeyqafgpatiagyemcxwncjucwiukqtezqraqeskiepmlezgemcagsluxshmsumqeghcjgpsgcwgcudkvuxyuk
hxbjatijgfjtrnzxwbuxolxbbdxlsjglwrljltvzorszexzrvjtnkzenmdnzfzrbghqbujbhzfndyxodkvdxjvlrufarsbrf
tljfqnmfahfndbhtmvytintvnrfhidkhqthdxhdvelwvyzvliyckbujkhgkusoayxcvypmycceymtkhmxsmkmuwapstafyas
wkuolafoneoagaschircvkciagoezypelweykwmsvgbstcsgumkgrongbigoeciunwzujouwosgijeliruieyiewfmxwzawm
jzdlcvklihlvtpbzydwzqnzddfznulinytnlnvxbqtubgzbtxlvpmbgpofpbhbtdijsdwldjbhpfazqfmxfzlxntwhctudth
vnlhspohcjhpfdjvoxavkpvxpthjkfmjsvjfzjfxgnyxabxnkaemdwlmjimwuqcazexaroaeegaovmjozuomowycruvchacu
ymwqnchqpgqcicuejktexmekciqgbargnygamyouxiduveuiwomitqpidkiqgekwpybwlqwyquiklgnktwkgakgyhozybcyo
lbfnexmnkjnxvrdbafybspbffhbpwnkpavpnpxzdsvwdibdvznxrodirqhrdjdvfklufynfldjrhcbshozhbnzpvyjevwfvj
xpnjurqjeljrhflxqzcxmrxzrvjlmholuxlhblhzipazcdzpmcgofynolkoywsecbgzctqcggicqxolqbwqoqyaetwxejcew
aoyspejsrisekewglmvgzogmeksidctipaicoaqwzkfwxgwkyqokvsrkfmksigmyradynsyaswkmnipmvymicmiajqbadeaq
ndhpgzopmlpzxtfdchadurdhhjdrypmrcxrprzbfuxyfkdfxbpztqfktsjtflfxhmnwhaphnfltjedujqbjdpbrxalgxyhxl
zrplwtslgnltjhnzsbezotzbtxlnojqnwznjdnjbkrcbefbroeiqhapqnmqayugedibevseiikeszqnsdysqsacgvyzglegy
cqaurglutkugmgyinoxibqiogmukfevkrckeqcsybmhyziymasqmxutmhomukioatcfapuacuymopkroxaokeokclsdcfgcs
pfjribqronrbzvhfejcfwtfjjlftaroteztrtbdhwzahmfhzdrbvshmvulvhnhzjopyjcrjphnvlgfwlsdlfrdtzcnizajzn
btrnyvunipnvljpbudgbqvbdvznpqlspybplfpldmtedghdtqgksjcrsposcawigfkdgxugkkmgubspufausuceixabingia
escwtinwvmwioiakpqzkdskqiowmhgxmtemgseuadojabkaocusozwvojqowmkqcvehcrwcewaoqrmtqzcqmgqmenufehieu
rhltkdstqptdbxjhglehyvhllnhvctqvgbvtvdfjybcjohjbftdxujoxwnxjpjblqraletlrjpxnihynufnhtfvbepkbclbp
dvtpaxwpkrpxnlrdwfidsxdfxbprsnuradrnhrnfovgfijfvsimuleturquecykihmfizwimmoiwdurwhcwuwegkzcdkpikc
gueyvkpyxoykqkcmrsbmfumskqyojizovgoiugwcfqlcdmcqewuqbyxqlsqyomsexgjetyegycqstovsbesoisogpwhgjkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: simuleturque
Cipher: fvzhyrghedhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: simuleturque
Cipher: 344223541351445424145451

Extended Methods:
Method #1

Plaintext: simuleturque
method variations:
xorzqkyzwvzkctwevpdebaephybkauikgfkundgpfzopmlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s i m u l e t u r q u e 
3 4 2 5 1 5 4 5 2 1 5 5 
4 2 3 4 3 1 4 4 4 4 4 1 
They are then read out in rows:
342515452155423431444441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: simuleturque
Cipher: swvybziscttd

Read more ...
Method #3

Plaintext: simuleturque
method variations:
tgxdxqyidyyl gxdxqyidyylt xdxqyidyyltg
dxqyidyyltgx xqyidyyltgxd qyidyyltgxdx
yidyyltgxdxq idyyltgxdxqy dyyltgxdxqyi
yyltgxdxqyid yltgxdxqyidy ltgxdxqyidyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: simuleturque

first 5040 cipher variations(475687488 total)
simuleturque simuleturqeu simuleturuqe simuleturueq simuletureuq simuleturequ simuletuqrue simuletuqreu simuletuqure
simuletuquer simuletuqeur simuletuqeru simuletuuqre simuletuuqer simuletuurqe simuletuureq simuletuuerq simuletuueqr
simuletuequr simuletueqru simuletueuqr simuletueurq simuletueruq simuletuerqu simuletruque simuletruqeu simuletruuqe
simuletruueq simuletrueuq simuletruequ simuletrquue simuletrqueu simuletrquue simuletrqueu simuletrqeuu simuletrqeuu
simuletruque simuletruqeu simuletruuqe simuletruueq simuletrueuq simuletruequ simuletrequu simuletrequu simuletreuqu
simuletreuuq simuletreuuq simuletreuqu simuletqruue simuletqrueu simuletqruue simuletqrueu simuletqreuu simuletqreuu
simuletqurue simuletqureu simuletquure simuletquuer simuletqueur simuletqueru simuletquure simuletquuer simuletqurue
simuletqureu simuletqueru simuletqueur simuletqeuur simuletqeuru simuletqeuur simuletqeuru simuletqeruu simuletqeruu
simuleturque simuleturqeu simuleturuqe simuleturueq simuletureuq simuleturequ simuletuqrue simuletuqreu simuletuqure
simuletuquer simuletuqeur simuletuqeru simuletuuqre simuletuuqer simuletuurqe simuletuureq simuletuuerq simuletuueqr
simuletuequr simuletueqru simuletueuqr simuletueurq simuletueruq simuletuerqu simuleterquu simuleterquu simuleteruqu
simuleteruuq simuleteruuq simuleteruqu simuleteqruu simuleteqruu simuletequru simuletequur simuletequur simuletequru
simuleteuqru simuleteuqur simuleteurqu simuleteuruq simuleteuurq simuleteuuqr simuleteuqur simuleteuqru simuleteuuqr
simuleteuurq simuleteuruq simuleteurqu simuleutrque simuleutrqeu simuleutruqe simuleutrueq simuleutreuq simuleutrequ
simuleutqrue simuleutqreu simuleutqure simuleutquer simuleutqeur simuleutqeru simuleutuqre simuleutuqer simuleuturqe
simuleutureq simuleutuerq simuleutueqr simuleutequr simuleuteqru simuleuteuqr simuleuteurq simuleuteruq simuleuterqu
simuleurtque simuleurtqeu simuleurtuqe simuleurtueq simuleurteuq simuleurtequ simuleurqtue simuleurqteu simuleurqute
simuleurquet simuleurqeut simuleurqetu simuleuruqte simuleuruqet simuleurutqe simuleuruteq simuleuruetq simuleurueqt
simuleurequt simuleureqtu simuleureuqt simuleureutq simuleuretuq simuleuretqu simuleuqrtue simuleuqrteu simuleuqrute
simuleuqruet simuleuqreut simuleuqretu simuleuqtrue simuleuqtreu simuleuqture simuleuqtuer simuleuqteur simuleuqteru
simuleuqutre simuleuquter simuleuqurte simuleuquret simuleuquert simuleuquetr simuleuqetur simuleuqetru simuleuqeutr
simuleuqeurt simuleuqerut simuleuqertu simuleuurqte simuleuurqet simuleuurtqe simuleuurteq simuleuuretq simuleuureqt
simuleuuqrte simuleuuqret simuleuuqtre simuleuuqter simuleuuqetr simuleuuqert simuleuutqre simuleuutqer simuleuutrqe
simuleuutreq simuleuuterq simuleuuteqr simuleuueqtr simuleuueqrt simuleuuetqr simuleuuetrq simuleuuertq simuleuuerqt
simuleuerqut simuleuerqtu simuleueruqt simuleuerutq simuleuertuq simuleuertqu simuleueqrut simuleueqrtu simuleuequrt
simuleuequtr simuleueqtur simuleueqtru simuleueuqrt simuleueuqtr simuleueurqt simuleueurtq simuleueutrq simuleueutqr
simuleuetqur simuleuetqru simuleuetuqr simuleueturq simuleuetruq simuleuetrqu simulerutque simulerutqeu simulerutuqe
simulerutueq simuleruteuq simulerutequ simuleruqtue simuleruqteu simuleruqute simuleruquet simuleruqeut simuleruqetu
simuleruuqte simuleruuqet simuleruutqe simuleruuteq simuleruuetq simuleruueqt simuleruequt simulerueqtu simulerueuqt
simulerueutq simuleruetuq simuleruetqu simulertuque simulertuqeu simulertuuqe simulertuueq simulertueuq simulertuequ
simulertquue simulertqueu simulertquue simulertqueu simulertqeuu simulertqeuu simulertuque simulertuqeu simulertuuqe
simulertuueq simulertueuq simulertuequ simulertequu simulertequu simulerteuqu simulerteuuq simulerteuuq simulerteuqu
simulerqtuue simulerqtueu simulerqtuue simulerqtueu simulerqteuu simulerqteuu simulerqutue simulerquteu simulerquute
simulerquuet simulerqueut simulerquetu simulerquute simulerquuet simulerqutue simulerquteu simulerquetu simulerqueut
simulerqeuut simulerqeutu simulerqeuut simulerqeutu simulerqetuu simulerqetuu simulerutque simulerutqeu simulerutuqe
simulerutueq simuleruteuq simulerutequ simuleruqtue simuleruqteu simuleruqute simuleruquet simuleruqeut simuleruqetu
simuleruuqte simuleruuqet simuleruutqe simuleruuteq simuleruuetq simuleruueqt simuleruequt simulerueqtu simulerueuqt
simulerueutq simuleruetuq simuleruetqu simuleretquu simuleretquu simuleretuqu simuleretuuq simuleretuuq simuleretuqu
simulereqtuu simulereqtuu simulerequtu simulerequut simulerequut simulerequtu simulereuqtu simulereuqut simulereutqu
simulereutuq simulereuutq simulereuuqt simulereuqut simulereuqtu simulereuuqt simulereuutq simulereutuq simulereutqu
simulequrtue simulequrteu simulequrute simulequruet simulequreut simulequretu simulequtrue simulequtreu simulequture
simulequtuer simulequteur simulequteru simulequutre simulequuter simulequurte simulequuret simulequuert simulequuetr
simulequetur simulequetru simulequeutr simulequeurt simulequerut simulequertu simuleqrutue simuleqruteu simuleqruute
simuleqruuet simuleqrueut simuleqruetu simuleqrtuue simuleqrtueu simuleqrtuue simuleqrtueu simuleqrteuu simuleqrteuu
simuleqrutue simuleqruteu simuleqruute simuleqruuet simuleqrueut simuleqruetu simuleqretuu simuleqretuu simuleqreutu
simuleqreuut simuleqreuut simuleqreutu simuleqtruue simuleqtrueu simuleqtruue simuleqtrueu simuleqtreuu simuleqtreuu
simuleqturue simuleqtureu simuleqtuure simuleqtuuer simuleqtueur simuleqtueru simuleqtuure simuleqtuuer simuleqturue
simuleqtureu simuleqtueru simuleqtueur simuleqteuur simuleqteuru simuleqteuur simuleqteuru simuleqteruu simuleqteruu
simulequrtue simulequrteu simulequrute simulequruet simulequreut simulequretu simulequtrue simulequtreu simulequture
simulequtuer simulequteur simulequteru simulequutre simulequuter simulequurte simulequuret simulequuert simulequuetr
simulequetur simulequetru simulequeutr simulequeurt simulequerut simulequertu simuleqertuu simuleqertuu simuleqerutu
simuleqeruut simuleqeruut simuleqerutu simuleqetruu simuleqetruu simuleqeturu simuleqetuur simuleqetuur simuleqeturu
simuleqeutru simuleqeutur simuleqeurtu simuleqeurut simuleqeuurt simuleqeuutr simuleqeutur simuleqeutru simuleqeuutr
simuleqeuurt simuleqeurut simuleqeurtu simuleuurqte simuleuurqet simuleuurtqe simuleuurteq simuleuuretq simuleuureqt
simuleuuqrte simuleuuqret simuleuuqtre simuleuuqter simuleuuqetr simuleuuqert simuleuutqre simuleuutqer simuleuutrqe
simuleuutreq simuleuuterq simuleuuteqr simuleuueqtr simuleuueqrt simuleuuetqr simuleuuetrq simuleuuertq simuleuuerqt
simuleuruqte simuleuruqet simuleurutqe simuleuruteq simuleuruetq simuleurueqt simuleurqute simuleurquet simuleurqtue
simuleurqteu simuleurqetu simuleurqeut simuleurtque simuleurtqeu simuleurtuqe simuleurtueq simuleurteuq simuleurtequ
simuleureqtu simuleurequt simuleuretqu simuleuretuq simuleureutq simuleureuqt simuleuqrute simuleuqruet simuleuqrtue
simuleuqrteu simuleuqretu simuleuqreut simuleuqurte simuleuquret simuleuqutre simuleuquter simuleuquetr simuleuquert
simuleuqture simuleuqtuer simuleuqtrue simuleuqtreu simuleuqteru simuleuqteur simuleuqeutr simuleuqeurt simuleuqetur
simuleuqetru simuleuqertu simuleuqerut simuleutrque simuleutrqeu simuleutruqe simuleutrueq simuleutreuq simuleutrequ
simuleutqrue simuleutqreu simuleutqure simuleutquer simuleutqeur simuleutqeru simuleutuqre simuleutuqer simuleuturqe
simuleutureq simuleutuerq simuleutueqr simuleutequr simuleuteqru simuleuteuqr simuleuteurq simuleuteruq simuleuterqu
simuleuerqtu simuleuerqut simuleuertqu simuleuertuq simuleuerutq simuleueruqt simuleueqrtu simuleueqrut simuleueqtru
simuleueqtur simuleuequtr simuleuequrt simuleuetqru simuleuetqur simuleuetrqu simuleuetruq simuleueturq simuleuetuqr
simuleueuqtr simuleueuqrt simuleueutqr simuleueutrq simuleueurtq simuleueurqt simuleeurqut simuleeurqtu simuleeuruqt
simuleeurutq simuleeurtuq simuleeurtqu simuleeuqrut simuleeuqrtu simuleeuqurt simuleeuqutr simuleeuqtur simuleeuqtru
simuleeuuqrt simuleeuuqtr simuleeuurqt simuleeuurtq simuleeuutrq simuleeuutqr simuleeutqur simuleeutqru simuleeutuqr
simuleeuturq simuleeutruq simuleeutrqu simuleeruqut simuleeruqtu simuleeruuqt simuleeruutq simuleerutuq simuleerutqu
simuleerquut simuleerqutu simuleerquut simuleerqutu simuleerqtuu simuleerqtuu simuleeruqut simuleeruqtu simuleeruuqt
simuleeruutq simuleerutuq simuleerutqu simuleertquu simuleertquu simuleertuqu simuleertuuq simuleertuuq simuleertuqu
simuleeqruut simuleeqrutu simuleeqruut simuleeqrutu simuleeqrtuu simuleeqrtuu simuleequrut simuleequrtu simuleequurt
simuleequutr simuleequtur simuleequtru simuleequurt simuleequutr simuleequrut simuleequrtu simuleequtru simuleequtur
simuleeqtuur simuleeqturu simuleeqtuur simuleeqturu simuleeqtruu simuleeqtruu simuleeurqut simuleeurqtu simuleeuruqt
simuleeurutq simuleeurtuq simuleeurtqu simuleeuqrut simuleeuqrtu simuleeuqurt simuleeuqutr simuleeuqtur simuleeuqtru
simuleeuuqrt simuleeuuqtr simuleeuurqt simuleeuurtq simuleeuutrq simuleeuutqr simuleeutqur simuleeutqru simuleeutuqr
simuleeuturq simuleeutruq simuleeutrqu simuleetrquu simuleetrquu simuleetruqu simuleetruuq simuleetruuq simuleetruqu
simuleetqruu simuleetqruu simuleetquru simuleetquur simuleetquur simuleetquru simuleetuqru simuleetuqur simuleeturqu
simuleeturuq simuleetuurq simuleetuuqr simuleetuqur simuleetuqru simuleetuuqr simuleetuurq simuleeturuq simuleeturqu
simulteurque simulteurqeu simulteuruqe simulteurueq simulteureuq simulteurequ simulteuqrue simulteuqreu simulteuqure
simulteuquer simulteuqeur simulteuqeru simulteuuqre simulteuuqer simulteuurqe simulteuureq simulteuuerq simulteuueqr
simulteuequr simulteueqru simulteueuqr simulteueurq simulteueruq simulteuerqu simulteruque simulteruqeu simulteruuqe
simulteruueq simulterueuq simulteruequ simulterquue simulterqueu simulterquue simulterqueu simulterqeuu simulterqeuu
simulteruque simulteruqeu simulteruuqe simulteruueq simulterueuq simulteruequ simulterequu simulterequu simultereuqu
simultereuuq simultereuuq simultereuqu simulteqruue simulteqrueu simulteqruue simulteqrueu simulteqreuu simulteqreuu
simultequrue simultequreu simultequure simultequuer simultequeur simultequeru simultequure simultequuer simultequrue
simultequreu simultequeru simultequeur simulteqeuur simulteqeuru simulteqeuur simulteqeuru simulteqeruu simulteqeruu
simulteurque simulteurqeu simulteuruqe simulteurueq simulteureuq simulteurequ simulteuqrue simulteuqreu simulteuqure
simulteuquer simulteuqeur simulteuqeru simulteuuqre simulteuuqer simulteuurqe simulteuureq simulteuuerq simulteuueqr
simulteuequr simulteueqru simulteueuqr simulteueurq simulteueruq simulteuerqu simulteerquu simulteerquu simulteeruqu
simulteeruuq simulteeruuq simulteeruqu simulteeqruu simulteeqruu simulteequru simulteequur simulteequur simulteequru
simulteeuqru simulteeuqur simulteeurqu simulteeuruq simulteeuurq simulteeuuqr simulteeuqur simulteeuqru simulteeuuqr
simulteeuurq simulteeuruq simulteeurqu simultuerque simultuerqeu simultueruqe simultuerueq simultuereuq simultuerequ
simultueqrue simultueqreu simultuequre simultuequer simultueqeur simultueqeru simultueuqre simultueuqer simultueurqe
simultueureq simultueuerq simultueueqr simultueequr simultueeqru simultueeuqr simultueeurq simultueeruq simultueerqu
simultureque simultureqeu simultureuqe simultureueq simultureeuq simultureequ simulturqeue simulturqeeu simulturquee
simulturquee simulturqeue simulturqeeu simulturuqee simulturuqee simulturueqe simulturueeq simulturueeq simulturueqe
simultureque simultureqeu simultureuqe simultureueq simultureeuq simultureequ simultuqreue simultuqreeu simultuqruee
simultuqruee simultuqreue simultuqreeu simultuqerue simultuqereu simultuqeure simultuqeuer simultuqeeur simultuqeeru
simultuquere simultuqueer simultuquree simultuquree simultuquere simultuqueer simultuqeeur simultuqeeru simultuqeuer
simultuqeure simultuqerue simultuqereu simultuurqee simultuurqee simultuureqe simultuureeq simultuureeq simultuureqe
simultuuqree simultuuqree simultuuqere simultuuqeer simultuuqeer simultuuqere simultuueqre simultuueqer simultuuerqe
simultuuereq simultuueerq simultuueeqr simultuueqer simultuueqre simultuueeqr simultuueerq simultuuereq simultuuerqe
simultuerque simultuerqeu simultueruqe simultuerueq simultuereuq simultuerequ simultueqrue simultueqreu simultuequre
simultuequer simultueqeur simultueqeru simultueuqre simultueuqer simultueurqe simultueureq simultueuerq simultueueqr
simultueequr simultueeqru simultueeuqr simultueeurq simultueeruq simultueerqu simultrueque simultrueqeu simultrueuqe
simultrueueq simultrueeuq simultrueequ simultruqeue simultruqeeu simultruquee simultruquee simultruqeue simultruqeeu
simultruuqee simultruuqee simultruueqe simultruueeq simultruueeq simultruueqe simultrueque simultrueqeu simultrueuqe
simultrueueq simultrueeuq simultrueequ simultreuque simultreuqeu simultreuuqe simultreuueq simultreueuq simultreuequ
simultrequue simultrequeu simultrequue simultrequeu simultreqeuu simultreqeuu simultreuque simultreuqeu simultreuuqe
simultreuueq simultreueuq simultreuequ simultreequu simultreequu simultreeuqu simultreeuuq simultreeuuq simultreeuqu
simultrqeuue simultrqeueu simultrqeuue simultrqeueu simultrqeeuu simultrqeeuu simultrqueue simultrqueeu simultrquuee
simultrquuee simultrqueue simultrqueeu simultrquuee simultrquuee simultrqueue simultrqueeu simultrqueeu simultrqueue
simultrqeuue simultrqeueu simultrqeuue simultrqeueu simultrqeeuu simultrqeeuu simultrueque simultrueqeu simultrueuqe
simultrueueq simultrueeuq simultrueequ simultruqeue simultruqeeu simultruquee simultruquee simultruqeue simultruqeeu
simultruuqee simultruuqee simultruueqe simultruueeq simultruueeq simultruueqe simultrueque simultrueqeu simultrueuqe
simultrueueq simultrueeuq simultrueequ simultreequu simultreequu simultreeuqu simultreeuuq simultreeuuq simultreeuqu
simultreqeuu simultreqeuu simultrequeu simultrequue simultrequue simultrequeu simultreuqeu simultreuque simultreuequ
simultreueuq simultreuueq simultreuuqe simultreuque simultreuqeu simultreuuqe simultreuueq simultreueuq simultreuequ
simultqureue simultqureeu simultquruee simultquruee simultqureue simultqureeu simultquerue simultquereu simultqueure
simultqueuer simultqueeur simultqueeru simultquuere simultquueer simultquuree simultquuree simultquuere simultquueer
simultqueeur simultqueeru simultqueuer simultqueure simultquerue simultquereu simultqrueue simultqrueeu simultqruuee
simultqruuee simultqrueue simultqrueeu simultqreuue simultqreueu simultqreuue simultqreueu simultqreeuu simultqreeuu
simultqrueue simultqrueeu simultqruuee simultqruuee simultqrueue simultqrueeu simultqreeuu simultqreeuu simultqreueu
simultqreuue simultqreuue simultqreueu simultqeruue simultqerueu simultqeruue simultqerueu simultqereuu simultqereuu
simultqeurue simultqeureu simultqeuure simultqeuuer simultqeueur simultqeueru simultqeuure simultqeuuer simultqeurue
simultqeureu simultqeueru simultqeueur simultqeeuur simultqeeuru simultqeeuur simultqeeuru simultqeeruu simultqeeruu
simultqureue simultqureeu simultquruee simultquruee simultqureue simultqureeu simultquerue simultquereu simultqueure
simultqueuer simultqueeur simultqueeru simultquuere simultquueer simultquuree simultquuree simultquuere simultquueer
simultqueeur simultqueeru simultqueuer simultqueure simultquerue simultquereu simultqereuu simultqereuu simultqerueu
simultqeruue simultqeruue simultqerueu simultqeeruu simultqeeruu simultqeeuru simultqeeuur simultqeeuur simultqeeuru
simultqeueru simultqeueur simultqeureu simultqeurue simultqeuure simultqeuuer simultqeueur simultqeueru simultqeuuer
simultqeuure simultqeurue simultqeureu simultuurqee simultuurqee simultuureqe simultuureeq simultuureeq simultuureqe
simultuuqree simultuuqree simultuuqere simultuuqeer simultuuqeer simultuuqere simultuueqre simultuueqer simultuuerqe
simultuuereq simultuueerq simultuueeqr simultuueqer simultuueqre simultuueeqr simultuueerq simultuuereq simultuuerqe
simulturuqee simulturuqee simulturueqe simulturueeq simulturueeq simulturueqe simulturquee simulturquee simulturqeue
simulturqeeu simulturqeeu simulturqeue simultureque simultureqeu simultureuqe simultureueq simultureeuq simultureequ
simultureqeu simultureque simultureequ simultureeuq simultureueq simultureuqe simultuqruee simultuqruee simultuqreue
simultuqreeu simultuqreeu simultuqreue simultuquree simultuquree simultuquere simultuqueer simultuqueer simultuquere
simultuqeure simultuqeuer simultuqerue simultuqereu simultuqeeru simultuqeeur simultuqeuer simultuqeure simultuqeeur
simultuqeeru simultuqereu simultuqerue simultuerque simultuerqeu simultueruqe simultuerueq simultuereuq simultuerequ
simultueqrue simultueqreu simultuequre simultuequer simultueqeur simultueqeru simultueuqre simultueuqer simultueurqe
simultueureq simultueuerq simultueueqr simultueequr simultueeqru simultueeuqr simultueeurq simultueeruq simultueerqu
simultuerqeu simultuerque simultuerequ simultuereuq simultuerueq simultueruqe simultueqreu simultueqrue simultueqeru
simultueqeur simultuequer simultuequre simultueeqru simultueequr simultueerqu simultueeruq simultueeurq simultueeuqr
simultueuqer simultueuqre simultueueqr simultueuerq simultueureq simultueurqe simulteurque simulteurqeu simulteuruqe
simulteurueq simulteureuq simulteurequ simulteuqrue simulteuqreu simulteuqure simulteuquer simulteuqeur simulteuqeru
simulteuuqre simulteuuqer simulteuurqe simulteuureq simulteuuerq simulteuueqr simulteuequr simulteueqru simulteueuqr
simulteueurq simulteueruq simulteuerqu simulteruque simulteruqeu simulteruuqe simulteruueq simulterueuq simulteruequ
simulterquue simulterqueu simulterquue simulterqueu simulterqeuu simulterqeuu simulteruque simulteruqeu simulteruuqe
simulteruueq simulterueuq simulteruequ simulterequu simulterequu simultereuqu simultereuuq simultereuuq simultereuqu
simulteqruue simulteqrueu simulteqruue simulteqrueu simulteqreuu simulteqreuu simultequrue simultequreu simultequure
simultequuer simultequeur simultequeru simultequure simultequuer simultequrue simultequreu simultequeru simultequeur
simulteqeuur simulteqeuru simulteqeuur simulteqeuru simulteqeruu simulteqeruu simulteurque simulteurqeu simulteuruqe
simulteurueq simulteureuq simulteurequ simulteuqrue simulteuqreu simulteuqure simulteuquer simulteuqeur simulteuqeru
simulteuuqre simulteuuqer simulteuurqe simulteuureq simulteuuerq simulteuueqr simulteuequr simulteueqru simulteueuqr
simulteueurq simulteueruq simulteuerqu simulteerquu simulteerquu simulteeruqu simulteeruuq simulteeruuq simulteeruqu
simulteeqruu simulteeqruu simulteequru simulteequur simulteequur simulteequru simulteeuqru simulteeuqur simulteeurqu
simulteeuruq simulteeuurq simulteeuuqr simulteeuqur simulteeuqru simulteeuuqr simulteeuurq simulteeuruq simulteeurqu
simuluterque simuluterqeu simuluteruqe simuluterueq simulutereuq simuluterequ simuluteqrue simuluteqreu simulutequre
simulutequer simuluteqeur simuluteqeru simuluteuqre simuluteuqer simuluteurqe simuluteureq simuluteuerq simuluteueqr
simuluteequr simuluteeqru simuluteeuqr simuluteeurq simuluteeruq simuluteerqu simulutreque simulutreqeu simulutreuqe
simulutreueq simulutreeuq simulutreequ simulutrqeue simulutrqeeu simulutrquee simulutrquee simulutrqeue simulutrqeeu
simulutruqee simulutruqee simulutrueqe simulutrueeq simulutrueeq simulutrueqe simulutreque simulutreqeu simulutreuqe
simulutreueq simulutreeuq simulutreequ simulutqreue simulutqreeu simulutqruee simulutqruee simulutqreue simulutqreeu
simulutqerue simulutqereu simulutqeure simulutqeuer simulutqeeur simulutqeeru simulutquere simulutqueer simulutquree
simulutquree simulutquere simulutqueer simulutqeeur simulutqeeru simulutqeuer simulutqeure simulutqerue simulutqereu
simuluturqee simuluturqee simulutureqe simulutureeq simulutureeq simulutureqe simulutuqree simulutuqree simulutuqere
simulutuqeer simulutuqeer simulutuqere simulutueqre simulutueqer simulutuerqe simulutuereq simulutueerq simulutueeqr
simulutueqer simulutueqre simulutueeqr simulutueerq simulutuereq simulutuerqe simuluterque simuluterqeu simuluteruqe
simuluterueq simulutereuq simuluterequ simuluteqrue simuluteqreu simulutequre simulutequer simuluteqeur simuluteqeru
simuluteuqre simuluteuqer simuluteurqe simuluteureq simuluteuerq simuluteueqr simuluteequr simuluteeqru simuluteeuqr
simuluteeurq simuluteeruq simuluteerqu simuluetrque simuluetrqeu simuluetruqe simuluetrueq simuluetreuq simuluetrequ
simuluetqrue simuluetqreu simuluetqure simuluetquer simuluetqeur simuluetqeru simuluetuqre simuluetuqer simulueturqe
simuluetureq simuluetuerq simuluetueqr simuluetequr simulueteqru simulueteuqr simulueteurq simulueteruq simulueterqu
simuluertque simuluertqeu simuluertuqe simuluertueq simuluerteuq simuluertequ simuluerqtue simuluerqteu simuluerqute
simuluerquet simuluerqeut simuluerqetu simulueruqte simulueruqet simuluerutqe simulueruteq simulueruetq simuluerueqt
simuluerequt simuluereqtu simuluereuqt simuluereutq simulueretuq simulueretqu simulueqrtue simulueqrteu simulueqrute
simulueqruet simulueqreut simulueqretu simulueqtrue simulueqtreu simulueqture simulueqtuer simulueqteur simulueqteru
simuluequtre simuluequter simuluequrte simuluequret simuluequert simuluequetr simulueqetur simulueqetru simulueqeutr
simulueqeurt simulueqerut simulueqertu simulueurqte simulueurqet simulueurtqe simulueurteq simulueuretq simulueureqt
simulueuqrte simulueuqret simulueuqtre simulueuqter simulueuqetr simulueuqert simulueutqre simulueutqer simulueutrqe
simulueutreq simulueuterq simulueuteqr simulueueqtr simulueueqrt simulueuetqr simulueuetrq simulueuertq simulueuerqt
simulueerqut simulueerqtu simulueeruqt simulueerutq simulueertuq simulueertqu simulueeqrut simulueeqrtu simulueequrt
simulueequtr simulueeqtur simulueeqtru simulueeuqrt simulueeuqtr simulueeurqt simulueeurtq simulueeutrq simulueeutqr
simulueetqur simulueetqru simulueetuqr simulueeturq simulueetruq simulueetrqu simuluretque simuluretqeu simuluretuqe
simuluretueq simulureteuq simuluretequ simulureqtue simulureqteu simulurequte simulurequet simulureqeut simulureqetu
simulureuqte simulureuqet simulureutqe simulureuteq simulureuetq simulureueqt simulureequt simulureeqtu simulureeuqt
simulureeutq simulureetuq simulureetqu simulurteque simulurteqeu simulurteuqe simulurteueq simulurteeuq simulurteequ
simulurtqeue simulurtqeeu simulurtquee simulurtquee simulurtqeue simulurtqeeu simulurtuqee simulurtuqee simulurtueqe
simulurtueeq simulurtueeq simulurtueqe simulurteque simulurteqeu simulurteuqe simulurteueq simulurteeuq simulurteequ
simulurqteue simulurqteeu simulurqtuee simulurqtuee simulurqteue simulurqteeu simulurqetue simulurqeteu simulurqeute
simulurqeuet simulurqeeut simulurqeetu simulurquete simulurqueet simulurqutee simulurqutee simulurquete simulurqueet
simulurqeeut simulurqeetu simulurqeuet simulurqeute simulurqetue simulurqeteu simulurutqee simulurutqee simuluruteqe
simuluruteeq simuluruteeq simuluruteqe simuluruqtee simuluruqtee simuluruqete simuluruqeet simuluruqeet simuluruqete
simulurueqte simulurueqet simuluruetqe simulurueteq simulurueetq simulurueeqt simulurueqet simulurueqte simulurueeqt
simulurueetq simulurueteq simuluruetqe simuluretque simuluretqeu simuluretuqe simuluretueq simulureteuq simuluretequ
simulureqtue simulureqteu simulurequte simulurequet simulureqeut simulureqetu simulureuqte simulureuqet simulureutqe
simulureuteq simulureuetq simulureueqt simulureequt simulureeqtu simulureeuqt simulureeutq simulureetuq simulureetqu
simuluqertue simuluqerteu simuluqerute simuluqeruet simuluqereut simuluqeretu simuluqetrue simuluqetreu simuluqeture
simuluqetuer simuluqeteur simuluqeteru simuluqeutre simuluqeuter simuluqeurte simuluqeuret simuluqeuert simuluqeuetr
simuluqeetur simuluqeetru simuluqeeutr simuluqeeurt simuluqeerut simuluqeertu simuluqretue simuluqreteu simuluqreute
simuluqreuet simuluqreeut simuluqreetu simuluqrteue simuluqrteeu simuluqrtuee simuluqrtuee simuluqrteue simuluqrteeu
simuluqrutee simuluqrutee simuluqruete simuluqrueet simuluqrueet simuluqruete simuluqretue simuluqreteu simuluqreute
simuluqreuet simuluqreeut simuluqreetu simuluqtreue simuluqtreeu simuluqtruee simuluqtruee simuluqtreue simuluqtreeu
simuluqterue simuluqtereu simuluqteure simuluqteuer simuluqteeur simuluqteeru simuluqtuere simuluqtueer simuluqturee
simuluqturee simuluqtuere simuluqtueer simuluqteeur simuluqteeru simuluqteuer simuluqteure simuluqterue simuluqtereu
simuluqurtee simuluqurtee simuluqurete simuluqureet simuluqureet simuluqurete simuluqutree simuluqutree simuluqutere
simuluquteer simuluquteer simuluqutere simuluquetre simuluqueter simuluquerte simuluqueret simuluqueert simuluqueetr
simuluqueter simuluquetre simuluqueetr simuluqueert simuluqueret simuluquerte simuluqertue simuluqerteu simuluqerute
simuluqeruet simuluqereut simuluqeretu simuluqetrue simuluqetreu simuluqeture simuluqetuer simuluqeteur simuluqeteru
simuluqeutre simuluqeuter simuluqeurte simuluqeuret simuluqeuert simuluqeuetr simuluqeetur simuluqeetru simuluqeeutr
simuluqeeurt simuluqeerut simuluqeertu simuluuerqte simuluuerqet simuluuertqe simuluuerteq simuluueretq simuluuereqt
simuluueqrte simuluueqret simuluueqtre simuluueqter simuluueqetr simuluueqert simuluuetqre simuluuetqer simuluuetrqe
simuluuetreq simuluueterq simuluueteqr simuluueeqtr simuluueeqrt simuluueetqr simuluueetrq simuluueertq simuluueerqt
simuluureqte simuluureqet simuluuretqe simuluureteq simuluureetq simuluureeqt simuluurqete simuluurqeet simuluurqtee
simuluurqtee simuluurqete simuluurqeet simuluurtqee simuluurtqee simuluurteqe simuluurteeq simuluurteeq simuluurteqe
simuluureqte simuluureqet simuluuretqe simuluureteq simuluureetq simuluureeqt simuluuqrete simuluuqreet simuluuqrtee
simuluuqrtee simuluuqrete simuluuqreet simuluuqerte simuluuqeret simuluuqetre simuluuqeter simuluuqeetr simuluuqeert
simuluuqtere simuluuqteer simuluuqtree simuluuqtree simuluuqtere simuluuqteer simuluuqeetr simuluuqeert simuluuqeter
simuluuqetre simuluuqerte simuluuqeret simuluutrqee simuluutrqee simuluutreqe simuluutreeq simuluutreeq simuluutreqe
simuluutqree simuluutqree simuluutqere simuluutqeer simuluutqeer simuluutqere simuluuteqre simuluuteqer simuluuterqe
simuluutereq simuluuteerq simuluuteeqr simuluuteqer simuluuteqre simuluuteeqr simuluuteerq simuluutereq simuluuterqe
simuluuerqte simuluuerqet simuluuertqe simuluuerteq simuluueretq simuluuereqt simuluueqrte simuluueqret simuluueqtre
simuluueqter simuluueqetr simuluueqert simuluuetqre simuluuetqer simuluuetrqe simuluuetreq simuluueterq simuluueteqr
simuluueeqtr simuluueeqrt simuluueetqr simuluueetrq simuluueertq simuluueerqt simulueerqut simulueerqtu simulueeruqt
simulueerutq simulueertuq simulueertqu simulueeqrut simulueeqrtu simulueequrt simulueequtr simulueeqtur simulueeqtru
simulueeuqrt simulueeuqtr simulueeurqt simulueeurtq simulueeutrq simulueeutqr simulueetqur simulueetqru simulueetuqr
simulueeturq simulueetruq simulueetrqu simuluerequt simuluereqtu simuluereuqt simuluereutq simulueretuq simulueretqu
simuluerqeut simuluerqetu simuluerquet simuluerqute simuluerqtue simuluerqteu simulueruqet simulueruqte simuluerueqt
simulueruetq simulueruteq simuluerutqe simuluertque simuluertqeu simuluertuqe simuluertueq simuluerteuq simuluertequ
simulueqreut simulueqretu simulueqruet simulueqrute simulueqrtue simulueqrteu simulueqerut simulueqertu simulueqeurt
simulueqeutr simulueqetur simulueqetru simuluequert simuluequetr simuluequret simuluequrte simuluequtre simuluequter
simulueqteur simulueqteru simulueqtuer simulueqture simulueqtrue simulueqtreu simulueurqet simulueurqte simulueureqt
simulueuretq simulueurteq simulueurtqe simulueuqret simulueuqrte simulueuqert simulueuqetr simulueuqter simulueuqtre
simulueueqrt simulueueqtr simulueuerqt simulueuertq simulueuetrq simulueuetqr simulueutqer simulueutqre simulueuteqr
simulueuterq simulueutreq simulueutrqe simuluetrque simuluetrqeu simuluetruqe simuluetrueq simuluetreuq simuluetrequ
simuluetqrue simuluetqreu simuluetqure simuluetquer simuluetqeur simuluetqeru simuluetuqre simuluetuqer simulueturqe
simuluetureq simuluetuerq simuluetueqr simuluetequr simulueteqru simulueteuqr simulueteurq simulueteruq simulueterqu
simulrtueque simulrtueqeu simulrtueuqe simulrtueueq simulrtueeuq simulrtueequ simulrtuqeue simulrtuqeeu simulrtuquee
simulrtuquee simulrtuqeue simulrtuqeeu simulrtuuqee simulrtuuqee simulrtuueqe simulrtuueeq simulrtuueeq simulrtuueqe
simulrtueque simulrtueqeu simulrtueuqe simulrtueueq simulrtueeuq simulrtueequ simulrteuque simulrteuqeu simulrteuuqe
simulrteuueq simulrteueuq simulrteuequ simulrtequue simulrtequeu simulrtequue simulrtequeu simulrteqeuu simulrteqeuu
simulrteuque simulrteuqeu simulrteuuqe simulrteuueq simulrteueuq simulrteuequ simulrteequu simulrteequu simulrteeuqu
simulrteeuuq simulrteeuuq simulrteeuqu simulrtqeuue simulrtqeueu simulrtqeuue simulrtqeueu simulrtqeeuu simulrtqeeuu
simulrtqueue simulrtqueeu simulrtquuee simulrtquuee simulrtqueue simulrtqueeu simulrtquuee simulrtquuee simulrtqueue
simulrtqueeu simulrtqueeu simulrtqueue simulrtqeuue simulrtqeueu simulrtqeuue simulrtqeueu simulrtqeeuu simulrtqeeuu
simulrtueque simulrtueqeu simulrtueuqe simulrtueueq simulrtueeuq simulrtueequ simulrtuqeue simulrtuqeeu simulrtuquee
simulrtuquee simulrtuqeue simulrtuqeeu simulrtuuqee simulrtuuqee simulrtuueqe simulrtuueeq simulrtuueeq simulrtuueqe
simulrtueque simulrtueqeu simulrtueuqe simulrtueueq simulrtueeuq simulrtueequ simulrteequu simulrteequu simulrteeuqu
simulrteeuuq simulrteeuuq simulrteeuqu simulrteqeuu simulrteqeuu simulrtequeu simulrtequue simulrtequue simulrtequeu
simulrteuqeu simulrteuque simulrteuequ simulrteueuq simulrteuueq simulrteuuqe simulrteuque simulrteuqeu simulrteuuqe
simulrteuueq simulrteueuq simulrteuequ simulruteque simulruteqeu simulruteuqe simulruteueq simulruteeuq simulruteequ
simulrutqeue simulrutqeeu simulrutquee simulrutquee simulrutqeue simulrutqeeu simulrutuqee simulrutuqee simulrutueqe
simulrutueeq simulrutueeq simulrutueqe simulruteque simulruteqeu simulruteuqe simulruteueq simulruteeuq simulruteequ
simulruetque simulruetqeu simulruetuqe simulruetueq simulrueteuq simulruetequ simulrueqtue simulrueqteu simulruequte
simulruequet simulrueqeut simulrueqetu simulrueuqte simulrueuqet simulrueutqe simulrueuteq simulrueuetq simulrueueqt
simulrueequt simulrueeqtu simulrueeuqt simulrueeutq simulrueetuq simulrueetqu simulruqetue simulruqeteu simulruqeute
simulruqeuet simulruqeeut simulruqeetu simulruqteue simulruqteeu simulruqtuee simulruqtuee simulruqteue simulruqteeu
simulruqutee simulruqutee simulruquete simulruqueet simulruqueet simulruquete simulruqetue simulruqeteu simulruqeute
simulruqeuet simulruqeeut simulruqeetu simulruueqte simulruueqet simulruuetqe simulruueteq simulruueetq simulruueeqt
simulruuqete simulruuqeet simulruuqtee simulruuqtee simulruuqete simulruuqeet simulruutqee simulruutqee simulruuteqe
simulruuteeq simulruuteeq simulruuteqe simulruueqte simulruueqet simulruuetqe simulruueteq simulruueetq simulruueeqt
simulrueequt simulrueeqtu simulrueeuqt simulrueeutq simulrueetuq simulrueetqu simulrueqeut simulrueqetu simulruequet
simulruequte simulrueqtue simulrueqteu simulrueuqet simulrueuqte simulrueueqt simulrueuetq simulrueuteq simulrueutqe
simulruetque simulruetqeu simulruetuqe simulruetueq simulrueteuq simulruetequ simulreutque simulreutqeu simulreutuqe
simulreutueq simulreuteuq simulreutequ simulreuqtue simulreuqteu simulreuqute simulreuquet simulreuqeut simulreuqetu
simulreuuqte simulreuuqet simulreuutqe simulreuuteq simulreuuetq simulreuueqt simulreuequt simulreueqtu simulreueuqt
simulreueutq simulreuetuq simulreuetqu simulretuque simulretuqeu simulretuuqe simulretuueq simulretueuq simulretuequ
simulretquue simulretqueu simulretquue simulretqueu simulretqeuu simulretqeuu simulretuque simulretuqeu simulretuuqe
simulretuueq simulretueuq simulretuequ simulretequu simulretequu simulreteuqu simulreteuuq simulreteuuq simulreteuqu
simulreqtuue simulreqtueu simulreqtuue simulreqtueu simulreqteuu simulreqteuu simulrequtue simulrequteu simulrequute
simulrequuet simulrequeut simulrequetu simulrequute simulrequuet simulrequtue simulrequteu simulrequetu simulrequeut
simulreqeuut simulreqeutu simulreqeuut simulreqeutu simulreqetuu simulreqetuu simulreutque simulreutqeu simulreutuqe
simulreutueq simulreuteuq simulreutequ simulreuqtue simulreuqteu simulreuqute simulreuquet simulreuqeut simulreuqetu
simulreuuqte simulreuuqet simulreuutqe simulreuuteq simulreuuetq simulreuueqt simulreuequt simulreueqtu simulreueuqt
simulreueutq simulreuetuq simulreuetqu simulreetquu simulreetquu simulreetuqu simulreetuuq simulreetuuq simulreetuqu
simulreeqtuu simulreeqtuu simulreequtu simulreequut simulreequut simulreequtu simulreeuqtu simulreeuqut simulreeutqu
simulreeutuq simulreeuutq simulreeuuqt simulreeuqut simulreeuqtu simulreeuuqt simulreeuutq simulreeutuq simulreeutqu
simulrquetue simulrqueteu simulrqueute simulrqueuet simulrqueeut simulrqueetu simulrquteue simulrquteeu simulrqutuee
simulrqutuee simulrquteue simulrquteeu simulrquutee simulrquutee simulrquuete simulrquueet simulrquueet simulrquuete
simulrquetue simulrqueteu simulrqueute simulrqueuet simulrqueeut simulrqueetu simulrqeutue simulrqeuteu simulrqeuute
simulrqeuuet simulrqeueut simulrqeuetu simulrqetuue simulrqetueu simulrqetuue simulrqetueu simulrqeteuu simulrqeteuu
simulrqeutue simulrqeuteu simulrqeuute simulrqeuuet simulrqeueut simulrqeuetu simulrqeetuu simulrqeetuu simulrqeeutu
simulrqeeuut simulrqeeuut simulrqeeutu simulrqteuue simulrqteueu simulrqteuue simulrqteueu simulrqteeuu simulrqteeuu
simulrqtueue simulrqtueeu simulrqtuuee simulrqtuuee simulrqtueue simulrqtueeu simulrqtuuee simulrqtuuee simulrqtueue
simulrqtueeu simulrqtueeu simulrqtueue simulrqteuue simulrqteueu simulrqteuue simulrqteueu simulrqteeuu simulrqteeuu
simulrquetue simulrqueteu simulrqueute simulrqueuet simulrqueeut simulrqueetu simulrquteue simulrquteeu simulrqutuee
simulrqutuee simulrquteue simulrquteeu simulrquutee simulrquutee simulrquuete simulrquueet simulrquueet simulrquuete
simulrquetue simulrqueteu simulrqueute simulrqueuet simulrqueeut simulrqueetu simulrqeetuu simulrqeetuu simulrqeeutu
simulrqeeuut simulrqeeuut simulrqeeutu simulrqeteuu simulrqeteuu simulrqetueu simulrqetuue simulrqetuue simulrqetueu
simulrqeuteu simulrqeutue simulrqeuetu simulrqeueut simulrqeuuet simulrqeuute simulrqeutue simulrqeuteu simulrqeuute
simulrqeuuet simulrqeueut simulrqeuetu simulruueqte simulruueqet simulruuetqe simulruueteq simulruueetq simulruueeqt
simulruuqete simulruuqeet simulruuqtee simulruuqtee simulruuqete simulruuqeet simulruutqee simulruutqee simulruuteqe
simulruuteeq simulruuteeq simulruuteqe simulruueqte simulruueqet simulruuetqe simulruueteq simulruueetq simulruueeqt
simulrueuqte simulrueuqet simulrueutqe simulrueuteq simulrueuetq simulrueueqt simulruequte simulruequet simulrueqtue
simulrueqteu simulrueqetu simulrueqeut simulruetque simulruetqeu simulruetuqe simulruetueq simulrueteuq simulruetequ
simulrueeqtu simulrueequt simulrueetqu simulrueetuq simulrueeutq simulrueeuqt simulruqeute simulruqeuet simulruqetue
simulruqeteu simulruqeetu simulruqeeut simulruquete simulruqueet simulruqutee simulruqutee simulruquete simulruqueet
simulruqtuee simulruqtuee simulruqteue simulruqteeu simulruqteeu simulruqteue simulruqeute simulruqeuet simulruqetue
simulruqeteu simulruqeetu simulruqeeut simulruteque simulruteqeu simulruteuqe simulruteueq simulruteeuq simulruteequ
simulrutqeue simulrutqeeu simulrutquee simulrutquee simulrutqeue simulrutqeeu simulrutuqee simulrutuqee simulrutueqe
simulrutueeq simulrutueeq simulrutueqe simulruteque simulruteqeu simulruteuqe simulruteueq simulruteeuq simulruteequ
simulrueeqtu simulrueequt simulrueetqu simulrueetuq simulrueeutq simulrueeuqt simulrueqetu simulrueqeut simulrueqteu
simulrueqtue simulruequte simulruequet simulruetqeu simulruetque simulruetequ simulrueteuq simulruetueq simulruetuqe
simulrueuqte simulrueuqet simulrueutqe simulrueuteq simulrueuetq simulrueueqt simulreuequt simulreueqtu simulreueuqt
simulreueutq simulreuetuq simulreuetqu simulreuqeut simulreuqetu simulreuquet simulreuqute simulreuqtue simulreuqteu
simulreuuqet simulreuuqte simulreuueqt simulreuuetq simulreuuteq simulreuutqe simulreutque simulreutqeu simulreutuqe
simulreutueq simulreuteuq simulreutequ simulreeuqut simulreeuqtu simulreeuuqt simulreeuutq simulreeutuq simulreeutqu
simulreequut simulreequtu simulreequut simulreequtu simulreeqtuu simulreeqtuu simulreeuqut simulreeuqtu simulreeuuqt
simulreeuutq simulreeutuq simulreeutqu simulreetquu simulreetquu simulreetuqu simulreetuuq simulreetuuq simulreetuqu
simulreqeuut simulreqeutu simulreqeuut simulreqeutu simulreqetuu simulreqetuu simulrequeut simulrequetu simulrequuet
simulrequute simulrequtue simulrequteu simulrequuet simulrequute simulrequeut simulrequetu simulrequteu simulrequtue
simulreqtuue simulreqtueu simulreqtuue simulreqtueu simulreqteuu simulreqteuu simulreuequt simulreueqtu simulreueuqt
simulreueutq simulreuetuq simulreuetqu simulreuqeut simulreuqetu simulreuquet simulreuqute simulreuqtue simulreuqteu
simulreuuqet simulreuuqte simulreuueqt simulreuuetq simulreuuteq simulreuutqe simulreutque simulreutqeu simulreutuqe
simulreutueq simulreuteuq simulreutequ simulretequu simulretequu simulreteuqu simulreteuuq simulreteuuq simulreteuqu
simulretqeuu simulretqeuu simulretqueu simulretquue simulretquue simulretqueu simulretuqeu simulretuque simulretuequ
simulretueuq simulretuueq simulretuuqe simulretuque simulretuqeu simulretuuqe simulretuueq simulretueuq simulretuequ
simulqtureue simulqtureeu simulqturuee simulqturuee simulqtureue simulqtureeu simulqtuerue simulqtuereu simulqtueure
simulqtueuer simulqtueeur simulqtueeru simulqtuuere simulqtuueer simulqtuuree simulqtuuree simulqtuuere simulqtuueer
simulqtueeur simulqtueeru simulqtueuer simulqtueure simulqtuerue simulqtuereu simulqtrueue simulqtrueeu simulqtruuee
simulqtruuee simulqtrueue simulqtrueeu simulqtreuue simulqtreueu simulqtreuue simulqtreueu simulqtreeuu simulqtreeuu
simulqtrueue simulqtrueeu simulqtruuee simulqtruuee simulqtrueue simulqtrueeu simulqtreeuu simulqtreeuu simulqtreueu
simulqtreuue simulqtreuue simulqtreueu simulqteruue simulqterueu simulqteruue simulqterueu simulqtereuu simulqtereuu
simulqteurue simulqteureu simulqteuure simulqteuuer simulqteueur simulqteueru simulqteuure simulqteuuer simulqteurue
simulqteureu simulqteueru simulqteueur simulqteeuur simulqteeuru simulqteeuur simulqteeuru simulqteeruu simulqteeruu
simulqtureue simulqtureeu simulqturuee simulqturuee simulqtureue simulqtureeu simulqtuerue simulqtuereu simulqtueure
simulqtueuer simulqtueeur simulqtueeru simulqtuuere simulqtuueer simulqtuuree simulqtuuree simulqtuuere simulqtuueer
simulqtueeur simulqtueeru simulqtueuer simulqtueure simulqtuerue simulqtuereu simulqtereuu simulqtereuu simulqterueu
simulqteruue simulqteruue simulqterueu simulqteeruu simulqteeruu simulqteeuru simulqteeuur simulqteeuur simulqteeuru
simulqteueru simulqteueur simulqteureu simulqteurue simulqteuure simulqteuuer simulqteueur simulqteueru simulqteuuer
simulqteuure simulqteurue simulqteureu simulqutreue simulqutreeu simulqutruee simulqutruee simulqutreue simulqutreeu
simulquterue simulqutereu simulquteure simulquteuer simulquteeur simulquteeru simulqutuere simulqutueer simulquturee
simulquturee simulqutuere simulqutueer simulquteeur simulquteeru simulquteuer simulquteure simulquterue simulqutereu
simulqurteue simulqurteeu simulqurtuee simulqurtuee simulqurteue simulqurteeu simulquretue simulqureteu simulqureute
simulqureuet simulqureeut simulqureetu simulquruete simulqurueet simulqurutee simulqurutee simulquruete simulqurueet
simulqureeut simulqureetu simulqureuet simulqureute simulquretue simulqureteu simulquertue simulquerteu simulquerute
simulqueruet simulquereut simulqueretu simulquetrue simulquetreu simulqueture simulquetuer simulqueteur simulqueteru
simulqueutre simulqueuter simulqueurte simulqueuret simulqueuert simulqueuetr simulqueetur simulqueetru simulqueeutr
simulqueeurt simulqueerut simulqueertu simulquurete simulquureet simulquurtee simulquurtee simulquurete simulquureet
simulquuerte simulquueret simulquuetre simulquueter simulquueetr simulquueert simulquutere simulquuteer simulquutree
simulquutree simulquutere simulquuteer simulquueetr simulquueert simulquueter simulquuetre simulquuerte simulquueret
simulquereut simulqueretu simulqueruet simulquerute simulquertue simulquerteu simulqueerut simulqueertu simulqueeurt
simulqueeutr simulqueetur simulqueetru simulqueuert simulqueuetr simulqueuret simulqueurte simulqueutre simulqueuter
simulqueteur simulqueteru simulquetuer simulqueture simulquetrue simulquetreu simulqruteue simulqruteeu simulqrutuee
simulqrutuee simulqruteue simulqruteeu simulqruetue simulqrueteu simulqrueute simulqrueuet simulqrueeut simulqrueetu
simulqruuete simulqruueet simulqruutee simulqruutee simulqruuete simulqruueet simulqrueeut simulqrueetu simulqrueuet
simulqrueute simulqruetue simulqrueteu simulqrtueue simulqrtueeu simulqrtuuee simulqrtuuee simulqrtueue simulqrtueeu
simulqrteuue simulqrteueu simulqrteuue simulqrteueu simulqrteeuu simulqrteeuu simulqrtueue simulqrtueeu simulqrtuuee
simulqrtuuee simulqrtueue simulqrtueeu simulqrteeuu simulqrteeuu simulqrteueu simulqrteuue simulqrteuue simulqrteueu
simulqretuue simulqretueu simulqretuue simulqretueu simulqreteuu simulqreteuu simulqreutue simulqreuteu simulqreuute
simulqreuuet simulqreueut simulqreuetu simulqreuute simulqreuuet simulqreutue simulqreuteu simulqreuetu simulqreueut
simulqreeuut simulqreeutu simulqreeuut simulqreeutu simulqreetuu simulqreetuu simulqruteue simulqruteeu simulqrutuee
simulqrutuee simulqruteue simulqruteeu simulqruetue simulqrueteu simulqrueute simulqrueuet simulqrueeut simulqrueetu
simulqruuete simulqruueet simulqruutee simulqruutee simulqruuete simulqruueet simulqrueeut simulqrueetu simulqrueuet
simulqrueute simulqruetue simulqrueteu simulqreteuu simulqreteuu simulqretueu simulqretuue simulqretuue simulqretueu
simulqreetuu simulqreetuu simulqreeutu simulqreeuut simulqreeuut simulqreeutu simulqreuetu simulqreueut simulqreuteu
simulqreutue simulqreuute simulqreuuet simulqreueut simulqreuetu simulqreuuet simulqreuute simulqreutue simulqreuteu
simulqeurtue simulqeurteu simulqeurute simulqeuruet simulqeureut simulqeuretu simulqeutrue simulqeutreu simulqeuture
simulqeutuer simulqeuteur simulqeuteru simulqeuutre simulqeuuter simulqeuurte simulqeuuret simulqeuuert simulqeuuetr
simulqeuetur simulqeuetru simulqeueutr simulqeueurt simulqeuerut simulqeuertu simulqerutue simulqeruteu simulqeruute
simulqeruuet simulqerueut simulqeruetu simulqertuue simulqertueu simulqertuue simulqertueu simulqerteuu simulqerteuu
simulqerutue simulqeruteu simulqeruute simulqeruuet simulqerueut simulqeruetu simulqeretuu simulqeretuu simulqereutu
simulqereuut simulqereuut simulqereutu simulqetruue simulqetrueu simulqetruue simulqetrueu simulqetreuu simulqetreuu
simulqeturue simulqetureu simulqetuure simulqetuuer simulqetueur simulqetueru simulqetuure simulqetuuer simulqeturue
simulqetureu simulqetueru simulqetueur simulqeteuur simulqeteuru simulqeteuur simulqeteuru simulqeteruu simulqeteruu
simulqeurtue simulqeurteu simulqeurute simulqeuruet simulqeureut simulqeuretu simulqeutrue simulqeutreu simulqeuture
simulqeutuer simulqeuteur simulqeuteru simulqeuutre simulqeuuter simulqeuurte simulqeuuret simulqeuuert simulqeuuetr
simulqeuetur simulqeuetru simulqeueutr simulqeueurt simulqeuerut simulqeuertu simulqeertuu simulqeertuu simulqeerutu
simulqeeruut simulqeeruut simulqeerutu simulqeetruu simulqeetruu simulqeeturu simulqeetuur simulqeetuur simulqeeturu
simulqeeutru simulqeeutur simulqeeurtu simulqeeurut simulqeeuurt simulqeeuutr simulqeeutur simulqeeutru simulqeeuutr
simulqeeuurt simulqeeurut simulqeeurtu simulquurete simulquureet simulquurtee simulquurtee simulquurete simulquureet
simulquuerte simulquueret simulquuetre simulquueter simulquueetr simulquueert simulquutere simulquuteer simulquutree
simulquutree simulquutere simulquuteer simulquueetr simulquueert simulquueter simulquuetre simulquuerte simulquueret
simulquruete simulqurueet simulqurutee simulqurutee simulquruete simulqurueet simulqureute simulqureuet simulquretue
simulqureteu simulqureetu simulqureeut simulqurteue simulqurteeu simulqurtuee simulqurtuee simulqurteue simulqurteeu
simulqureetu simulqureeut simulqureteu simulquretue simulqureute simulqureuet simulquerute simulqueruet simulquertue
simulquerteu simulqueretu simulquereut simulqueurte simulqueuret simulqueutre simulqueuter simulqueuetr simulqueuert
simulqueture simulquetuer simulquetrue simulquetreu simulqueteru simulqueteur simulqueeutr simulqueeurt simulqueetur
simulqueetru simulqueertu simulqueerut simulqutreue simulqutreeu simulqutruee simulqutruee simulqutreue simulqutreeu
simulquterue simulqutereu simulquteure simulquteuer simulquteeur simulquteeru simulqutuere simulqutueer simulquturee
simulquturee simulqutuere simulqutueer simulquteeur simulquteeru simulquteuer simulquteure simulquterue simulqutereu
simulqueretu simulquereut simulquerteu simulquertue simulquerute simulqueruet simulqueertu simulqueerut simulqueetru
simulqueetur simulqueeutr simulqueeurt simulqueteru simulqueteur simulquetreu simulquetrue simulqueture simulquetuer
simulqueuetr simulqueuert simulqueuter simulqueutre simulqueurte simulqueuret simulqeureut simulqeuretu simulqeuruet
simulqeurute simulqeurtue simulqeurteu simulqeuerut simulqeuertu simulqeueurt simulqeueutr simulqeuetur simulqeuetru
simulqeuuert simulqeuuetr simulqeuuret simulqeuurte simulqeuutre simulqeuuter simulqeuteur simulqeuteru simulqeutuer
simulqeuture simulqeutrue simulqeutreu simulqerueut simulqeruetu simulqeruuet simulqeruute simulqerutue simulqeruteu
simulqereuut simulqereutu simulqereuut simulqereutu simulqeretuu simulqeretuu simulqerueut simulqeruetu simulqeruuet
simulqeruute simulqerutue simulqeruteu simulqerteuu simulqerteuu simulqertueu simulqertuue simulqertuue simulqertueu
simulqeeruut simulqeerutu simulqeeruut simulqeerutu simulqeertuu simulqeertuu simulqeeurut simulqeeurtu simulqeeuurt
simulqeeuutr simulqeeutur simulqeeutru simulqeeuurt simulqeeuutr simulqeeurut simulqeeurtu simulqeeutru simulqeeutur
simulqeetuur simulqeeturu simulqeetuur simulqeeturu simulqeetruu simulqeetruu simulqeureut simulqeuretu simulqeuruet
simulqeurute simulqeurtue simulqeurteu simulqeuerut simulqeuertu simulqeueurt simulqeueutr simulqeuetur simulqeuetru
simulqeuuert simulqeuuetr simulqeuuret simulqeuurte simulqeuutre simulqeuuter simulqeuteur simulqeuteru simulqeutuer
simulqeuture simulqeutrue simulqeutreu simulqetreuu simulqetreuu simulqetrueu simulqetruue simulqetruue simulqetrueu
simulqeteruu simulqeteruu simulqeteuru simulqeteuur simulqeteuur simulqeteuru simulqetueru simulqetueur simulqetureu
simulqeturue simulqetuure simulqetuuer simulqetueur simulqetueru simulqetuuer simulqetuure simulqeturue simulqetureu
simuluturqee simuluturqee simulutureqe simulutureeq simulutureeq simulutureqe simulutuqree simulutuqree simulutuqere
simulutuqeer simulutuqeer simulutuqere simulutueqre simulutueqer simulutuerqe simulutuereq simulutueerq simulutueeqr
simulutueqer simulutueqre simulutueeqr simulutueerq simulutuereq simulutuerqe simulutruqee simulutruqee simulutrueqe
simulutrueeq simulutrueeq simulutrueqe simulutrquee simulutrquee simulutrqeue simulutrqeeu simulutrqeeu simulutrqeue
simulutreque simulutreqeu simulutreuqe simulutreueq simulutreeuq simulutreequ simulutreqeu simulutreque simulutreequ
simulutreeuq simulutreueq simulutreuqe simulutqruee simulutqruee simulutqreue simulutqreeu simulutqreeu simulutqreue
simulutquree simulutquree simulutquere simulutqueer simulutqueer simulutquere simulutqeure simulutqeuer simulutqerue
simulutqereu simulutqeeru simulutqeeur simulutqeuer simulutqeure simulutqeeur simulutqeeru simulutqereu simulutqerue
simuluterque simuluterqeu simuluteruqe simuluterueq simulutereuq simuluterequ simuluteqrue simuluteqreu simulutequre
simulutequer simuluteqeur simuluteqeru simuluteuqre simuluteuqer simuluteurqe simuluteureq simuluteuerq simuluteueqr
simuluteequr simuluteeqru simuluteeuqr simuluteeurq simuluteeruq simuluteerqu simuluterqeu simuluterque simuluterequ
simulutereuq simuluterueq simuluteruqe simuluteqreu simuluteqrue simuluteqeru simuluteqeur simulutequer simulutequre
simuluteeqru simuluteequr simuluteerqu simuluteeruq simuluteeurq simuluteeuqr simuluteuqer simuluteuqre simuluteueqr
simuluteuerq simuluteureq simuluteurqe simuluutrqee simuluutrqee simuluutreqe simuluutreeq simuluutreeq simuluutreqe
simuluutqree simuluutqree simuluutqere simuluutqeer simuluutqeer simuluutqere simuluuteqre simuluuteqer simuluuterqe
simuluutereq simuluuteerq simuluuteeqr simuluuteqer simuluuteqre simuluuteeqr simuluuteerq simuluutereq simuluuterqe
simuluurtqee simuluurtqee simuluurteqe simuluurteeq simuluurteeq simuluurteqe simuluurqtee simuluurqtee simuluurqete
simuluurqeet simuluurqeet simuluurqete simuluureqte simuluureqet simuluuretqe simuluureteq simuluureetq simuluureeqt
simuluureqet simuluureqte simuluureeqt simuluureetq simuluureteq simuluuretqe simuluuqrtee simuluuqrtee simuluuqrete
simuluuqreet simuluuqreet simuluuqrete simuluuqtree simuluuqtree simuluuqtere simuluuqteer simuluuqteer simuluuqtere
simuluuqetre simuluuqeter simuluuqerte simuluuqeret simuluuqeert simuluuqeetr simuluuqeter simuluuqetre simuluuqeetr
simuluuqeert simuluuqeret simuluuqerte simuluuerqte simuluuerqet simuluuertqe simuluuerteq simuluueretq simuluuereqt
simuluueqrte simuluueqret simuluueqtre simuluueqter simuluueqetr simuluueqert simuluuetqre simuluuetqer simuluuetrqe
simuluuetreq simuluueterq simuluueteqr simuluueeqtr simuluueeqrt simuluueetqr simuluueetrq simuluueertq simuluueerqt
simuluuerqet simuluuerqte simuluuereqt simuluueretq simuluuerteq simuluuertqe simuluueqret simuluueqrte simuluueqert
simuluueqetr simuluueqter simuluueqtre simuluueeqrt simuluueeqtr simuluueerqt simuluueertq simuluueetrq simuluueetqr
simuluuetqer simuluuetqre simuluueteqr simuluueterq simuluuetreq simuluuetrqe simulurutqee simulurutqee simuluruteqe
simuluruteeq simuluruteeq simuluruteqe simuluruqtee simuluruqtee simuluruqete simuluruqeet simuluruqeet simuluruqete
simulurueqte simulurueqet simuluruetqe simulurueteq simulurueetq simulurueeqt simulurueqet simulurueqte simulurueeqt
simulurueetq simulurueteq simuluruetqe simulurtuqee simulurtuqee simulurtueqe simulurtueeq simulurtueeq simulurtueqe
simulurtquee simulurtquee simulurtqeue simulurtqeeu simulurtqeeu simulurtqeue simulurteque simulurteqeu simulurteuqe
simulurteueq simulurteeuq simulurteequ simulurteqeu simulurteque simulurteequ simulurteeuq simulurteueq simulurteuqe
simulurqtuee simulurqtuee simulurqteue simulurqteeu simulurqteeu simulurqteue simulurqutee simulurqutee simulurquete
simulurqueet simulurqueet simulurquete simulurqeute simulurqeuet simulurqetue simulurqeteu simulurqeetu simulurqeeut
simulurqeuet simulurqeute simulurqeeut simulurqeetu simulurqeteu simulurqetue simuluretque simuluretqeu simuluretuqe
simuluretueq simulureteuq simuluretequ simulureqtue simulureqteu simulurequte simulurequet simulureqeut simulureqetu
simulureuqte simulureuqet simulureutqe simulureuteq simulureuetq simulureueqt simulureequt simulureeqtu simulureeuqt
simulureeutq simulureetuq simulureetqu simuluretqeu simuluretque simuluretequ simulureteuq simuluretueq simuluretuqe
simulureqteu simulureqtue simulureqetu simulureqeut simulurequet simulurequte simulureeqtu simulureequt simulureetqu
simulureetuq simulureeutq simulureeuqt simulureuqet simulureuqte simulureueqt simulureuetq simulureuteq simulureutqe
simuluqurtee simuluqurtee simuluqurete simuluqureet simuluqureet simuluqurete simuluqutree simuluqutree simuluqutere
simuluquteer simuluquteer simuluqutere simuluquetre simuluqueter simuluquerte simuluqueret simuluqueert simuluqueetr
simuluqueter simuluquetre simuluqueetr simuluqueert simuluqueret simuluquerte simuluqrutee simuluqrutee simuluqruete
simuluqrueet simuluqrueet simuluqruete simuluqrtuee simuluqrtuee simuluqrteue simuluqrteeu simuluqrteeu simuluqrteue
simuluqretue simuluqreteu simuluqreute simuluqreuet simuluqreeut simuluqreetu simuluqreteu simuluqretue simuluqreetu
simuluqreeut simuluqreuet simuluqreute simuluqtruee simuluqtruee simuluqtreue simuluqtreeu simuluqtreeu simuluqtreue
simuluqturee simuluqturee simuluqtuere simuluqtueer simuluqtueer simuluqtuere simuluqteure simuluqteuer simuluqterue
simuluqtereu simuluqteeru simuluqteeur simuluqteuer simuluqteure simuluqteeur simuluqteeru simuluqtereu simuluqterue
simuluqertue simuluqerteu simuluqerute simuluqeruet simuluqereut simuluqeretu simuluqetrue simuluqetreu simuluqeture
simuluqetuer simuluqeteur simuluqeteru simuluqeutre simuluqeuter simuluqeurte simuluqeuret simuluqeuert simuluqeuetr
simuluqeetur simuluqeetru simuluqeeutr simuluqeeurt simuluqeerut simuluqeertu simuluqerteu simuluqertue simuluqeretu
simuluqereut simuluqeruet simuluqerute simuluqetreu simuluqetrue simuluqeteru simuluqeteur simuluqetuer simuluqeture
simuluqeetru simuluqeetur simuluqeertu simuluqeerut simuluqeeurt simuluqeeutr simuluqeuter simuluqeutre simuluqeuetr
simuluqeuert simuluqeuret simuluqeurte simulueurqte simulueurqet simulueurtqe simulueurteq simulueuretq simulueureqt
simulueuqrte simulueuqret simulueuqtre simulueuqter simulueuqetr simulueuqert simulueutqre simulueutqer simulueutrqe
simulueutreq simulueuterq simulueuteqr simulueueqtr simulueueqrt simulueuetqr simulueuetrq simulueuertq simulueuerqt
simulueruqte simulueruqet simuluerutqe simulueruteq simulueruetq simuluerueqt simuluerqute simuluerquet simuluerqtue
simuluerqteu simuluerqetu simuluerqeut simuluertque simuluertqeu simuluertuqe simuluertueq simuluerteuq simuluertequ
simuluereqtu simuluerequt simulueretqu simulueretuq simuluereutq simuluereuqt simulueqrute simulueqruet simulueqrtue
simulueqrteu simulueqretu simulueqreut simuluequrte simuluequret simuluequtre simuluequter simuluequetr simuluequert
simulueqture simulueqtuer simulueqtrue simulueqtreu simulueqteru simulueqteur simulueqeutr simulueqeurt simulueqetur
simulueqetru simulueqertu simulueqerut simuluetrque simuluetrqeu simuluetruqe simuluetrueq simuluetreuq simuluetrequ
simuluetqrue simuluetqreu simuluetqure simuluetquer simuluetqeur simuluetqeru simuluetuqre simuluetuqer simulueturqe
simuluetureq simuluetuerq simuluetueqr simuluetequr simulueteqru simulueteuqr simulueteurq simulueteruq simulueterqu
simulueerqtu simulueerqut simulueertqu simulueertuq simulueerutq simulueeruqt simulueeqrtu simulueeqrut simulueeqtru
simulueeqtur simulueequtr simulueequrt simulueetqru simulueetqur simulueetrqu simulueetruq simulueeturq simulueetuqr
simulueeuqtr simulueeuqrt simulueeutqr simulueeutrq simulueeurtq simulueeurqt simulueurqet simulueurqte simulueureqt
simulueuretq simulueurteq simulueurtqe simulueuqret simulueuqrte simulueuqert simulueuqetr simulueuqter simulueuqtre
simulueueqrt simulueueqtr simulueuerqt simulueuertq simulueuetrq simulueuetqr simulueutqer simulueutqre simulueuteqr
simulueuterq simulueutreq simulueutrqe simulueruqet simulueruqte simuluerueqt simulueruetq simulueruteq simuluerutqe
simuluerquet simuluerqute simuluerqeut simuluerqetu simuluerqteu simuluerqtue simuluerequt simuluereqtu simuluereuqt
simuluereutq simulueretuq simulueretqu simuluertqeu simuluertque simuluertequ simuluerteuq simuluertueq simuluertuqe
simulueqruet simulueqrute simulueqreut simulueqretu simulueqrteu simulueqrtue simuluequret simuluequrte simuluequert
simuluequetr simuluequter simuluequtre simulueqeurt simulueqeutr simulueqerut simulueqertu simulueqetru simulueqetur
simulueqtuer simulueqture simulueqteur simulueqteru simulueqtreu simulueqtrue simulueerqut simulueerqtu simulueeruqt
simulueerutq simulueertuq simulueertqu simulueeqrut simulueeqrtu simulueequrt simulueequtr simulueeqtur simulueeqtru
simulueeuqrt simulueeuqtr simulueeurqt simulueeurtq simulueeutrq simulueeutqr simulueetqur simulueetqru simulueetuqr
simulueeturq simulueetruq simulueetrqu simuluetrqeu simuluetrque simuluetrequ simuluetreuq simuluetrueq simuluetruqe
simuluetqreu simuluetqrue simuluetqeru simuluetqeur simuluetquer simuluetqure simulueteqru simuluetequr simulueterqu
simulueteruq simulueteurq simulueteuqr simuluetuqer simuluetuqre simuluetueqr simuluetuerq simuluetureq simulueturqe
simuleturque simuleturqeu simuleturuqe simuleturueq simuletureuq simuleturequ simuletuqrue simuletuqreu simuletuqure
simuletuquer simuletuqeur simuletuqeru simuletuuqre simuletuuqer simuletuurqe simuletuureq simuletuuerq simuletuueqr
simuletuequr simuletueqru simuletueuqr simuletueurq simuletueruq simuletuerqu simuletruque simuletruqeu simuletruuqe
simuletruueq simuletrueuq simuletruequ simuletrquue simuletrqueu simuletrquue simuletrqueu simuletrqeuu simuletrqeuu
simuletruque simuletruqeu simuletruuqe simuletruueq simuletrueuq simuletruequ simuletrequu simuletrequu simuletreuqu
simuletreuuq simuletreuuq simuletreuqu simuletqruue simuletqrueu simuletqruue simuletqrueu simuletqreuu simuletqreuu
simuletqurue simuletqureu simuletquure simuletquuer simuletqueur simuletqueru simuletquure simuletquuer simuletqurue
simuletqureu simuletqueru simuletqueur simuletqeuur simuletqeuru simuletqeuur simuletqeuru simuletqeruu simuletqeruu
simuleturque simuleturqeu simuleturuqe simuleturueq simuletureuq simuleturequ simuletuqrue simuletuqreu simuletuqure
simuletuquer simuletuqeur simuletuqeru simuletuuqre simuletuuqer simuletuurqe simuletuureq simuletuuerq simuletuueqr
simuletuequr simuletueqru simuletueuqr simuletueurq simuletueruq simuletuerqu simuleterquu simuleterquu simuleteruqu
simuleteruuq simuleteruuq simuleteruqu simuleteqruu simuleteqruu simuletequru simuletequur simuletequur simuletequru
simuleteuqru simuleteuqur simuleteurqu simuleteuruq simuleteuurq simuleteuuqr simuleteuqur simuleteuqru simuleteuuqr
simuleteuurq simuleteuruq simuleteurqu simuleutrque simuleutrqeu simuleutruqe simuleutrueq simuleutreuq simuleutrequ
simuleutqrue simuleutqreu simuleutqure simuleutquer simuleutqeur simuleutqeru simuleutuqre simuleutuqer simuleuturqe
simuleutureq simuleutuerq simuleutueqr simuleutequr simuleuteqru simuleuteuqr simuleuteurq simuleuteruq simuleuterqu
simuleurtque simuleurtqeu simuleurtuqe simuleurtueq simuleurteuq simuleurtequ simuleurqtue simuleurqteu simuleurqute
simuleurquet simuleurqeut simuleurqetu simuleuruqte simuleuruqet simuleurutqe simuleuruteq simuleuruetq simuleurueqt
simuleurequt simuleureqtu simuleureuqt simuleureutq simuleuretuq simuleuretqu simuleuqrtue simuleuqrteu simuleuqrute
simuleuqruet simuleuqreut simuleuqretu simuleuqtrue simuleuqtreu simuleuqture simuleuqtuer simuleuqteur simuleuqteru
simuleuqutre simuleuquter simuleuqurte simuleuquret simuleuquert simuleuquetr simuleuqetur simuleuqetru simuleuqeutr
simuleuqeurt simuleuqerut simuleuqertu simuleuurqte simuleuurqet simuleuurtqe simuleuurteq simuleuuretq simuleuureqt
simuleuuqrte simuleuuqret simuleuuqtre simuleuuqter simuleuuqetr simuleuuqert simuleuutqre simuleuutqer simuleuutrqe
simuleuutreq simuleuuterq simuleuuteqr simuleuueqtr simuleuueqrt simuleuuetqr simuleuuetrq simuleuuertq simuleuuerqt
simuleuerqut simuleuerqtu simuleueruqt simuleuerutq simuleuertuq simuleuertqu simuleueqrut simuleueqrtu simuleuequrt
simuleuequtr simuleueqtur simuleueqtru simuleueuqrt simuleueuqtr simuleueurqt simuleueurtq simuleueutrq simuleueutqr
simuleuetqur simuleuetqru simuleuetuqr simuleueturq simuleuetruq simuleuetrqu simulerutque simulerutqeu simulerutuqe
simulerutueq simuleruteuq simulerutequ simuleruqtue simuleruqteu simuleruqute simuleruquet simuleruqeut simuleruqetu
simuleruuqte simuleruuqet simuleruutqe simuleruuteq simuleruuetq simuleruueqt simuleruequt simulerueqtu simulerueuqt
simulerueutq simuleruetuq simuleruetqu simulertuque simulertuqeu simulertuuqe simulertuueq simulertueuq simulertuequ
simulertquue simulertqueu simulertquue simulertqueu simulertqeuu simulertqeuu simulertuque simulertuqeu simulertuuqe
simulertuueq simulertueuq simulertuequ simulertequu simulertequu simulerteuqu simulerteuuq simulerteuuq simulerteuqu
simulerqtuue simulerqtueu simulerqtuue simulerqtueu simulerqteuu simulerqteuu simulerqutue simulerquteu simulerquute
simulerquuet simulerqueut simulerquetu simulerquute simulerquuet simulerqutue simulerquteu simulerquetu simulerqueut
simulerqeuut simulerqeutu simulerqeuut simulerqeutu simulerqetuu simulerqetuu simulerutque simulerutqeu simulerutuqe
simulerutueq simuleruteuq simulerutequ simuleruqtue simuleruqteu simuleruqute simuleruquet simuleruqeut simuleruqetu
simuleruuqte simuleruuqet simuleruutqe simuleruuteq simuleruuetq simuleruueqt simuleruequt simulerueqtu simulerueuqt
simulerueutq simuleruetuq simuleruetqu simuleretquu simuleretquu simuleretuqu simuleretuuq simuleretuuq simuleretuqu
simulereqtuu simulereqtuu simulerequtu simulerequut simulerequut simulerequtu simulereuqtu simulereuqut simulereutqu
simulereutuq simulereuutq simulereuuqt simulereuqut simulereuqtu simulereuuqt simulereuutq simulereutuq simulereutqu
simulequrtue simulequrteu simulequrute simulequruet simulequreut simulequretu simulequtrue simulequtreu simulequture
simulequtuer simulequteur simulequteru simulequutre simulequuter simulequurte simulequuret simulequuert simulequuetr
simulequetur simulequetru simulequeutr simulequeurt simulequerut simulequertu simuleqrutue simuleqruteu simuleqruute
simuleqruuet simuleqrueut simuleqruetu simuleqrtuue simuleqrtueu simuleqrtuue simuleqrtueu simuleqrteuu simuleqrteuu
simuleqrutue simuleqruteu simuleqruute simuleqruuet simuleqrueut simuleqruetu simuleqretuu simuleqretuu simuleqreutu
simuleqreuut simuleqreuut simuleqreutu simuleqtruue simuleqtrueu simuleqtruue simuleqtrueu simuleqtreuu simuleqtreuu
simuleqturue simuleqtureu simuleqtuure simuleqtuuer simuleqtueur simuleqtueru simuleqtuure simuleqtuuer simuleqturue
simuleqtureu simuleqtueru simuleqtueur simuleqteuur simuleqteuru simuleqteuur simuleqteuru simuleqteruu simuleqteruu
simulequrtue simulequrteu simulequrute simulequruet simulequreut simulequretu simulequtrue simulequtreu simulequture
simulequtuer simulequteur simulequteru simulequutre simulequuter simulequurte simulequuret simulequuert simulequuetr
simulequetur simulequetru simulequeutr simulequeurt simulequerut simulequertu simuleqertuu simuleqertuu simuleqerutu
simuleqeruut simuleqeruut simuleqerutu simuleqetruu simuleqetruu simuleqeturu simuleqetuur simuleqetuur simuleqeturu
simuleqeutru simuleqeutur simuleqeurtu simuleqeurut simuleqeuurt simuleqeuutr simuleqeutur simuleqeutru simuleqeuutr
simuleqeuurt simuleqeurut simuleqeurtu simuleuurqte simuleuurqet simuleuurtqe simuleuurteq simuleuuretq simuleuureqt
simuleuuqrte simuleuuqret simuleuuqtre simuleuuqter simuleuuqetr simuleuuqert simuleuutqre simuleuutqer simuleuutrqe
simuleuutreq simuleuuterq simuleuuteqr simuleuueqtr simuleuueqrt simuleuuetqr simuleuuetrq simuleuuertq simuleuuerqt
simuleuruqte simuleuruqet simuleurutqe simuleuruteq simuleuruetq simuleurueqt simuleurqute simuleurquet simuleurqtue
simuleurqteu simuleurqetu simuleurqeut simuleurtque simuleurtqeu simuleurtuqe simuleurtueq simuleurteuq simuleurtequ
simuleureqtu simuleurequt simuleuretqu simuleuretuq simuleureutq simuleureuqt simuleuqrute simuleuqruet simuleuqrtue
simuleuqrteu simuleuqretu simuleuqreut simuleuqurte simuleuquret simuleuqutre simuleuquter simuleuquetr simuleuquert
simuleuqture simuleuqtuer simuleuqtrue simuleuqtreu simuleuqteru simuleuqteur simuleuqeutr simuleuqeurt simuleuqetur
simuleuqetru simuleuqertu simuleuqerut simuleutrque simuleutrqeu simuleutruqe simuleutrueq simuleutreuq simuleutrequ
simuleutqrue simuleutqreu simuleutqure simuleutquer simuleutqeur simuleutqeru simuleutuqre simuleutuqer simuleuturqe
simuleutureq simuleutuerq simuleutueqr simuleutequr simuleuteqru simuleuteuqr simuleuteurq simuleuteruq simuleuterqu
simuleuerqtu simuleuerqut simuleuertqu simuleuertuq simuleuerutq simuleueruqt simuleueqrtu simuleueqrut simuleueqtru
simuleueqtur simuleuequtr simuleuequrt simuleuetqru simuleuetqur simuleuetrqu simuleuetruq simuleueturq simuleuetuqr
simuleueuqtr simuleueuqrt simuleueutqr simuleueutrq simuleueurtq simuleueurqt simuleeurqut simuleeurqtu simuleeuruqt
simuleeurutq simuleeurtuq simuleeurtqu simuleeuqrut simuleeuqrtu simuleeuqurt simuleeuqutr simuleeuqtur simuleeuqtru
simuleeuuqrt simuleeuuqtr simuleeuurqt simuleeuurtq simuleeuutrq simuleeuutqr simuleeutqur simuleeutqru simuleeutuqr
simuleeuturq simuleeutruq simuleeutrqu simuleeruqut simuleeruqtu simuleeruuqt simuleeruutq simuleerutuq simuleerutqu
simuleerquut simuleerqutu simuleerquut simuleerqutu simuleerqtuu simuleerqtuu simuleeruqut simuleeruqtu simuleeruuqt
simuleeruutq simuleerutuq simuleerutqu simuleertquu simuleertquu simuleertuqu simuleertuuq simuleertuuq simuleertuqu
simuleeqruut simuleeqrutu simuleeqruut simuleeqrutu simuleeqrtuu simuleeqrtuu simuleequrut simuleequrtu simuleequurt
simuleequutr simuleequtur simuleequtru simuleequurt simuleequutr simuleequrut simuleequrtu simuleequtru simuleequtur
simuleeqtuur simuleeqturu simuleeqtuur simuleeqturu simuleeqtruu simuleeqtruu simuleeurqut simuleeurqtu simuleeuruqt
simuleeurutq simuleeurtuq simuleeurtqu simuleeuqrut simuleeuqrtu simuleeuqurt simuleeuqutr simuleeuqtur simuleeuqtru
simuleeuuqrt simuleeuuqtr simuleeuurqt simuleeuurtq simuleeuutrq simuleeuutqr simuleeutqur simuleeutqru simuleeutuqr
simuleeuturq simuleeutruq simuleeutrqu simuleetrquu simuleetrquu simuleetruqu simuleetruuq simuleetruuq simuleetruqu
simuleetqruu simuleetqruu simuleetquru simuleetquur simuleetquur simuleetquru simuleetuqru simuleetuqur simuleeturqu
simuleeturuq simuleetuurq simuleetuuqr simuleetuqur simuleetuqru simuleetuuqr simuleetuurq simuleeturuq simuleeturqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us