easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

maternoque

achillean

crispin

submm

uriah

salutatorily

unifilar

gallehaut

unexternality

imitarer

urvashi

xeroxing

wryness

eventually

helminths

unthreads

transposed

gravitater


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: sideresque
cipher variations:
tjefsftrvf ukfgtguswg vlghuhvtxh wmhiviwuyi xnijwjxvzj
yojkxkywak zpklylzxbl aqlmzmaycm brmnanbzdn csnobocaeo
dtopcpdbfp eupqdqecgq fvqrerfdhr gwrsfsgeis hxstgthfjt
iytuhuigku jzuvivjhlv kavwjwkimw lbwxkxljnx mcxylymkoy
ndyzmznlpz oezanaomqa pfabobpnrb qgbcpcqosc rhcdqdrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: sideresque
Cipher: hrwvivhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: sideresque
Cipher: BAAAB ABAAA AAABB AABAA BAAAA AABAA BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: sideresque
cipher variations:
tjefsftrvfdzknandxjnnpqvivndxvxfwdqdxjldhvclylhpzlrlitgtrvntlrujwjlhpjvharervndr
fxgzmzftrzpnmhuhpzfhzdspcpzftpjtyxkxjlhxukfgtguswgealoboeykooqrwjwoeywygxereykme
iwdmzmiqamsmjuhuswoumsvkxkmiqkwibsfswoesgyhanagusaqoniviqagiaetqdqaguqkuzylykmiy
vlghuhvtxhfbmpcpfzlpprsxkxpfzxzhyfsfzlnfjxenanjrbntnkvivtxpvntwlylnjrlxjctgtxpft
hzibobhvtbrpojwjrbhjbfurerbhvrlvazmzlnjzwmhiviwuyigcnqdqgamqqstylyqgayaizgtgamog
kyfobokscouolwjwuyqwouxmzmoksmykduhuyqguiajcpciwucsqpkxkscikcgvsfsciwsmwbanamoka
xnijwjxvzjhdorerhbnrrtuzmzrhbzbjahuhbnphlzgpcpltdpvpmxkxvzrxpvynanpltnzlevivzrhv
jbkdqdjxvdtrqlyltdjldhwtgtdjxtnxcbobnplbyojkxkywakiepsfsicossuvanasicackbivicoqi
mahqdqmueqwqnylywasyqwzoboqmuoamfwjwasiwkclerekyweusrmzmuekmeixuhuekyuoydcpcoqmc
zpklylzxbljfqtgtjdpttvwbobtjdbdlcjwjdprjnbirernvfrxrozmzxbtzrxapcprnvpbngxkxbtjx
ldmfsflzxfvtsnanvflnfjyvivflzvpzedqdprndaqlmzmaycmkgruhukequuwxcpcukecemdkxkeqsk
ocjsfsowgsyspanaycuasybqdqsowqcohylycukymengtgmaygwutobowgmogkzwjwgmawqafereqsoe
brmnanbzdnlhsvivlfrvvxydqdvlfdfnelylfrtlpdktgtpxhtztqbobzdvbtzcrertpxrdpizmzdvlz
nfohuhnbzhxvupcpxhnphlaxkxhnbxrbgfsfrtpfcsnobocaeomitwjwmgswwyzerewmgegofmzmgsum
qeluhuqyiuaurcpcaewcuadsfsuqyseqjanaewmaogpiviocaiywvqdqyioqimbylyiocyschgtgsuqg
dtopcpdbfpnjuxkxnhtxxzafsfxnhfhpgnanhtvnrfmvivrzjvbvsdqdbfxdvbetgtvrztfrkbobfxnb
phqjwjpdbjzxwrerzjprjnczmzjpdztdihuhtvrheupqdqecgqokvylyoiuyyabgtgyoigiqhoboiuwo
sgnwjwsakwcwterecgyewcfuhuwsaugslcpcgyocqirkxkqeckayxsfsakqskodanakqeauejiviuwsi
fvqrerfdhrplwzmzpjvzzbchuhzpjhjripcpjvxpthoxkxtblxdxufsfdhzfxdgvivxtbvhtmdqdhzpd
rjslylrfdlbzytgtblrtlpeboblrfbvfkjwjvxtjgwrsfsgeisqmxanaqkwaacdiviaqkiksjqdqkwyq
uipylyucmyeyvgtgeiagyehwjwyucwiunereiaqesktmzmsgemcazuhucmsumqfcpcmsgcwglkxkwyuk
hxstgthfjtrnybobrlxbbdejwjbrljltkrerlxzrvjqzmzvdnzfzwhuhfjbhzfixkxzvdxjvofsfjbrf
tlunanthfndbavivdntvnrgdqdnthdxhmlylxzvliytuhuigkusozcpcsmyccefkxkcsmkmulsfsmyas
wkranaweoagaxivigkciagjylyaweykwpgtgkcsgumvobouigoecbwjweouwoshereouieyinmzmyawm
jzuvivjhlvtpadqdtnzddfglyldtnlnvmtgtnzbtxlsbobxfpbhbyjwjhldjbhkzmzbxfzlxqhuhldth
vnwpcpvjhpfdcxkxfpvxptifsfpvjfzjonanzbxnkavwjwkimwuqbereuoaeeghmzmeuomownuhuoacu
ymtcpcygqciczkxkimekcilanacygamyrivimeuiwoxqdqwkiqgedylygqwyqujgtgqwkgakpoboacyo
lbwxkxljnxvrcfsfvpbffhinanfvpnpxovivpbdvznudqdzhrdjdalyljnfldjmbobdzhbnzsjwjnfvj
xpyrerxljrhfezmzhrxzrvkhuhrxlhblqpcpbdzpmcxylymkoywsdgtgwqcggijobogwqoqypwjwqcew
aovereaisekebmzmkogmekncpceaicoatkxkogwkyqzsfsymksigfanaisyaswlivisymicmrqdqceaq
ndyzmznlpzxtehuhxrdhhjkpcphxrprzqxkxrdfxbpwfsfbjtflfcnanlphnflodqdfbjdpbulylphxl
zratgtznltjhgbobjtzbtxmjwjtznjdnsrerdfbroezanaomqayufiviyseiiklqdqiysqsarylysegy
cqxgtgckugmgdobomqiogmperegckeqcvmzmqiymasbuhuaomukihcpckuacuynkxkuaokeotsfsegcs
pfabobpnrbzvgjwjztfjjlmrerjztrtbszmztfhzdryhuhdlvhnhepcpnrjphnqfsfhdlfrdwnanrjzn
btcvivbpnvljidqdlvbdvzolylvbplfputgtfhdtqgbcpcqoscawhkxkaugkkmnsfskausuctanaugia
esziviemwioifqdqoskqiorgtgiemgsexoboskaocudwjwcqowmkjeremwcewapmzmwcqmgqvuhugieu
rhcdqdrptdbxilylbvhllnotgtlbvtvdubobvhjbftajwjfnxjpjgrerptlrjpshuhjfnhtfypcptlbp
dvexkxdrpxnlkfsfnxdfxbqnanxdrnhrwvivhjfvsideresquecyjmzmcwimmopuhumcwuwevcpcwikc
gubkxkgoykqkhsfsqumskqtivikgoiugzqdqumcqewfylyesqyomlgtgoyegycroboyesoisxwjwikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: sideresque
Cipher: fvqrerfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: sideresque
Cipher: 34424151245134145451

Extended Methods:
Method #1

Plaintext: sideresque
method variations:
xoikwkxvzkctopbpcaephytuguhfkundyzmznlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s i d e r e s q u e 
3 4 4 5 2 5 3 1 5 5 
4 2 1 1 4 1 4 4 4 1 
They are then read out in rows:
34452531554211414441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: sideresque
Cipher: sywcziadtd

Read more ...
Method #3

Plaintext: sideresque
method variations:
trvfyldyyl rvfyldyylt vfyldyyltr
fyldyyltrv yldyyltrvf ldyyltrvfy
dyyltrvfyl yyltrvfyld yltrvfyldy
ltrvfyldyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: sideresque

first 5040 cipher variations(3628800 total)
sideresque sideresqeu sideresuqe sideresueq sidereseuq sideresequ sidereqsue sidereqseu siderequse sidereques sidereqeus
sidereqesu sidereuqse sidereuqes sidereusqe sidereuseq sidereuesq sidereueqs sidereequs sidereeqsu sidereeuqs sidereeusq
sidereesuq sidereesqu siderseque siderseqeu siderseuqe siderseueq siderseeuq siderseequ sidersqeue sidersqeeu sidersquee
sidersquee sidersqeue sidersqeeu sidersuqee sidersuqee sidersueqe sidersueeq sidersueeq sidersueqe siderseque siderseqeu
siderseuqe siderseueq siderseeuq siderseequ siderqseue siderqseeu siderqsuee siderqsuee siderqseue siderqseeu siderqesue
siderqeseu siderqeuse siderqeues siderqeeus siderqeesu siderquese siderquees siderqusee siderqusee siderquese siderquees
siderqeeus siderqeesu siderqeues siderqeuse siderqesue siderqeseu siderusqee siderusqee sideruseqe sideruseeq sideruseeq
sideruseqe sideruqsee sideruqsee sideruqese sideruqees sideruqees sideruqese siderueqse siderueqes sideruesqe siderueseq
siderueesq siderueeqs siderueqes siderueqse siderueeqs siderueesq siderueseq sideruesqe sideresque sideresqeu sideresuqe
sideresueq sidereseuq sideresequ sidereqsue sidereqseu siderequse sidereques sidereqeus sidereqesu sidereuqse sidereuqes
sidereusqe sidereuseq sidereuesq sidereueqs sidereequs sidereeqsu sidereeuqs sidereeusq sidereesuq sidereesqu sideersque
sideersqeu sideersuqe sideersueq sideerseuq sideersequ sideerqsue sideerqseu sideerquse sideerques sideerqeus sideerqesu
sideeruqse sideeruqes sideerusqe sideeruseq sideeruesq sideerueqs sideerequs sideereqsu sideereuqs sideereusq sideeresuq
sideeresqu sideesrque sideesrqeu sideesruqe sideesrueq sideesreuq sideesrequ sideesqrue sideesqreu sideesqure sideesquer
sideesqeur sideesqeru sideesuqre sideesuqer sideesurqe sideesureq sideesuerq sideesueqr sideesequr sideeseqru sideeseuqr
sideeseurq sideeseruq sideeserqu sideeqsrue sideeqsreu sideeqsure sideeqsuer sideeqseur sideeqseru sideeqrsue sideeqrseu
sideeqruse sideeqrues sideeqreus sideeqresu sideequrse sideequres sideequsre sideequser sideequesr sideequers sideeqerus
sideeqersu sideeqeurs sideeqeusr sideeqesur sideeqesru sideeusqre sideeusqer sideeusrqe sideeusreq sideeuserq sideeuseqr
sideeuqsre sideeuqser sideeuqrse sideeuqres sideeuqers sideeuqesr sideeurqse sideeurqes sideeursqe sideeurseq sideeuresq
sideeureqs sideeueqrs sideeueqsr sideeuerqs sideeuersq sideeuesrq sideeuesqr sideeesqur sideeesqru sideeesuqr sideeesurq
sideeesruq sideeesrqu sideeeqsur sideeeqsru sideeequsr sideeequrs sideeeqrus sideeeqrsu sideeeuqsr sideeeuqrs sideeeusqr
sideeeusrq sideeeursq sideeeurqs sideeerqus sideeerqsu sideeeruqs sideeerusq sideeersuq sideeersqu sideserque sideserqeu
sideseruqe sideserueq sidesereuq sideserequ sideseqrue sideseqreu sidesequre sidesequer sideseqeur sideseqeru sideseuqre
sideseuqer sideseurqe sideseureq sideseuerq sideseueqr sideseequr sideseeqru sideseeuqr sideseeurq sideseeruq sideseerqu
sidesreque sidesreqeu sidesreuqe sidesreueq sidesreeuq sidesreequ sidesrqeue sidesrqeeu sidesrquee sidesrquee sidesrqeue
sidesrqeeu sidesruqee sidesruqee sidesrueqe sidesrueeq sidesrueeq sidesrueqe sidesreque sidesreqeu sidesreuqe sidesreueq
sidesreeuq sidesreequ sidesqreue sidesqreeu sidesqruee sidesqruee sidesqreue sidesqreeu sidesqerue sidesqereu sidesqeure
sidesqeuer sidesqeeur sidesqeeru sidesquere sidesqueer sidesquree sidesquree sidesquere sidesqueer sidesqeeur sidesqeeru
sidesqeuer sidesqeure sidesqerue sidesqereu sidesurqee sidesurqee sidesureqe sidesureeq sidesureeq sidesureqe sidesuqree
sidesuqree sidesuqere sidesuqeer sidesuqeer sidesuqere sidesueqre sidesueqer sidesuerqe sidesuereq sidesueerq sidesueeqr
sidesueqer sidesueqre sidesueeqr sidesueerq sidesuereq sidesuerqe sideserque sideserqeu sideseruqe sideserueq sidesereuq
sideserequ sideseqrue sideseqreu sidesequre sidesequer sideseqeur sideseqeru sideseuqre sideseuqer sideseurqe sideseureq
sideseuerq sideseueqr sideseequr sideseeqru sideseeuqr sideseeurq sideseeruq sideseerqu sideqesrue sideqesreu sideqesure
sideqesuer sideqeseur sideqeseru sideqersue sideqerseu sideqeruse sideqerues sideqereus sideqeresu sideqeurse sideqeures
sideqeusre sideqeuser sideqeuesr sideqeuers sideqeerus sideqeersu sideqeeurs sideqeeusr sideqeesur sideqeesru sideqserue
sideqsereu sideqseure sideqseuer sideqseeur sideqseeru sideqsreue sideqsreeu sideqsruee sideqsruee sideqsreue sideqsreeu
sideqsuree sideqsuree sideqsuere sideqsueer sideqsueer sideqsuere sideqserue sideqsereu sideqseure sideqseuer sideqseeur
sideqseeru sideqrseue sideqrseeu sideqrsuee sideqrsuee sideqrseue sideqrseeu sideqresue sideqreseu sideqreuse sideqreues
sideqreeus sideqreesu sideqruese sideqruees sideqrusee sideqrusee sideqruese sideqruees sideqreeus sideqreesu sideqreues
sideqreuse sideqresue sideqreseu sidequsree sidequsree sidequsere sidequseer sidequseer sidequsere sideqursee sideqursee
sidequrese sidequrees sidequrees sidequrese sidequerse sidequeres sidequesre sidequeser sidequeesr sidequeers sidequeres
sidequerse sidequeers sidequeesr sidequeser sidequesre sideqesrue sideqesreu sideqesure sideqesuer sideqeseur sideqeseru
sideqersue sideqerseu sideqeruse sideqerues sideqereus sideqeresu sideqeurse sideqeures sideqeusre sideqeuser sideqeuesr
sideqeuers sideqeerus sideqeersu sideqeeurs sideqeeusr sideqeesur sideqeesru sideuesqre sideuesqer sideuesrqe sideuesreq
sideueserq sideueseqr sideueqsre sideueqser sideueqrse sideueqres sideueqers sideueqesr sideuerqse sideuerqes sideuersqe
sideuerseq sideueresq sideuereqs sideueeqrs sideueeqsr sideueerqs sideueersq sideueesrq sideueesqr sideuseqre sideuseqer
sideuserqe sideusereq sideuseerq sideuseeqr sideusqere sideusqeer sideusqree sideusqree sideusqere sideusqeer sideusrqee
sideusrqee sideusreqe sideusreeq sideusreeq sideusreqe sideuseqre sideuseqer sideuserqe sideusereq sideuseerq sideuseeqr
sideuqsere sideuqseer sideuqsree sideuqsree sideuqsere sideuqseer sideuqesre sideuqeser sideuqerse sideuqeres sideuqeers
sideuqeesr sideuqrese sideuqrees sideuqrsee sideuqrsee sideuqrese sideuqrees sideuqeers sideuqeesr sideuqeres sideuqerse
sideuqesre sideuqeser sideursqee sideursqee sideurseqe sideurseeq sideurseeq sideurseqe sideurqsee sideurqsee sideurqese
sideurqees sideurqees sideurqese sideureqse sideureqes sideuresqe sideureseq sideureesq sideureeqs sideureqes sideureqse
sideureeqs sideureesq sideureseq sideuresqe sideuesqre sideuesqer sideuesrqe sideuesreq sideueserq sideueseqr sideueqsre
sideueqser sideueqrse sideueqres sideueqers sideueqesr sideuerqse sideuerqes sideuersqe sideuerseq sideueresq sideuereqs
sideueeqrs sideueeqsr sideueerqs sideueersq sideueesrq sideueesqr sideeesqur sideeesqru sideeesuqr sideeesurq sideeesruq
sideeesrqu sideeeqsur sideeeqsru sideeequsr sideeequrs sideeeqrus sideeeqrsu sideeeuqsr sideeeuqrs sideeeusqr sideeeusrq
sideeeursq sideeeurqs sideeerqus sideeerqsu sideeeruqs sideeerusq sideeersuq sideeersqu sideesequr sideeseqru sideeseuqr
sideeseurq sideeseruq sideeserqu sideesqeur sideesqeru sideesquer sideesqure sideesqrue sideesqreu sideesuqer sideesuqre
sideesueqr sideesuerq sideesureq sideesurqe sideesrque sideesrqeu sideesruqe sideesrueq sideesreuq sideesrequ sideeqseur
sideeqseru sideeqsuer sideeqsure sideeqsrue sideeqsreu sideeqesur sideeqesru sideeqeusr sideeqeurs sideeqerus sideeqersu
sideequesr sideequers sideequser sideequsre sideequrse sideequres sideeqreus sideeqresu sideeqrues sideeqruse sideeqrsue
sideeqrseu sideeusqer sideeusqre sideeuseqr sideeuserq sideeusreq sideeusrqe sideeuqser sideeuqsre sideeuqesr sideeuqers
sideeuqres sideeuqrse sideeueqsr sideeueqrs sideeuesqr sideeuesrq sideeuersq sideeuerqs sideeurqes sideeurqse sideeureqs
sideeuresq sideeurseq sideeursqe sideersque sideersqeu sideersuqe sideersueq sideerseuq sideersequ sideerqsue sideerqseu
sideerquse sideerques sideerqeus sideerqesu sideeruqse sideeruqes sideerusqe sideeruseq sideeruesq sideerueqs sideerequs
sideereqsu sideereuqs sideereusq sideeresuq sideeresqu sidreesque sidreesqeu sidreesuqe sidreesueq sidreeseuq sidreesequ
sidreeqsue sidreeqseu sidreequse sidreeques sidreeqeus sidreeqesu sidreeuqse sidreeuqes sidreeusqe sidreeuseq sidreeuesq
sidreeueqs sidreeequs sidreeeqsu sidreeeuqs sidreeeusq sidreeesuq sidreeesqu sidreseque sidreseqeu sidreseuqe sidreseueq
sidreseeuq sidreseequ sidresqeue sidresqeeu sidresquee sidresquee sidresqeue sidresqeeu sidresuqee sidresuqee sidresueqe
sidresueeq sidresueeq sidresueqe sidreseque sidreseqeu sidreseuqe sidreseueq sidreseeuq sidreseequ sidreqseue sidreqseeu
sidreqsuee sidreqsuee sidreqseue sidreqseeu sidreqesue sidreqeseu sidreqeuse sidreqeues sidreqeeus sidreqeesu sidrequese
sidrequees sidrequsee sidrequsee sidrequese sidrequees sidreqeeus sidreqeesu sidreqeues sidreqeuse sidreqesue sidreqeseu
sidreusqee sidreusqee sidreuseqe sidreuseeq sidreuseeq sidreuseqe sidreuqsee sidreuqsee sidreuqese sidreuqees sidreuqees
sidreuqese sidreueqse sidreueqes sidreuesqe sidreueseq sidreueesq sidreueeqs sidreueqes sidreueqse sidreueeqs sidreueesq
sidreueseq sidreuesqe sidreesque sidreesqeu sidreesuqe sidreesueq sidreeseuq sidreesequ sidreeqsue sidreeqseu sidreequse
sidreeques sidreeqeus sidreeqesu sidreeuqse sidreeuqes sidreeusqe sidreeuseq sidreeuesq sidreeueqs sidreeequs sidreeeqsu
sidreeeuqs sidreeeusq sidreeesuq sidreeesqu sidreesque sidreesqeu sidreesuqe sidreesueq sidreeseuq sidreesequ sidreeqsue
sidreeqseu sidreequse sidreeques sidreeqeus sidreeqesu sidreeuqse sidreeuqes sidreeusqe sidreeuseq sidreeuesq sidreeueqs
sidreeequs sidreeeqsu sidreeeuqs sidreeeusq sidreeesuq sidreeesqu sidreseque sidreseqeu sidreseuqe sidreseueq sidreseeuq
sidreseequ sidresqeue sidresqeeu sidresquee sidresquee sidresqeue sidresqeeu sidresuqee sidresuqee sidresueqe sidresueeq
sidresueeq sidresueqe sidreseque sidreseqeu sidreseuqe sidreseueq sidreseeuq sidreseequ sidreqseue sidreqseeu sidreqsuee
sidreqsuee sidreqseue sidreqseeu sidreqesue sidreqeseu sidreqeuse sidreqeues sidreqeeus sidreqeesu sidrequese sidrequees
sidrequsee sidrequsee sidrequese sidrequees sidreqeeus sidreqeesu sidreqeues sidreqeuse sidreqesue sidreqeseu sidreusqee
sidreusqee sidreuseqe sidreuseeq sidreuseeq sidreuseqe sidreuqsee sidreuqsee sidreuqese sidreuqees sidreuqees sidreuqese
sidreueqse sidreueqes sidreuesqe sidreueseq sidreueesq sidreueeqs sidreueqes sidreueqse sidreueeqs sidreueesq sidreueseq
sidreuesqe sidreesque sidreesqeu sidreesuqe sidreesueq sidreeseuq sidreesequ sidreeqsue sidreeqseu sidreequse sidreeques
sidreeqeus sidreeqesu sidreeuqse sidreeuqes sidreeusqe sidreeuseq sidreeuesq sidreeueqs sidreeequs sidreeeqsu sidreeeuqs
sidreeeusq sidreeesuq sidreeesqu sidrseeque sidrseeqeu sidrseeuqe sidrseeueq sidrseeeuq sidrseeequ sidrseqeue sidrseqeeu
sidrsequee sidrsequee sidrseqeue sidrseqeeu sidrseuqee sidrseuqee sidrseueqe sidrseueeq sidrseueeq sidrseueqe sidrseeque
sidrseeqeu sidrseeuqe sidrseeueq sidrseeeuq sidrseeequ sidrseeque sidrseeqeu sidrseeuqe sidrseeueq sidrseeeuq sidrseeequ
sidrseqeue sidrseqeeu sidrsequee sidrsequee sidrseqeue sidrseqeeu sidrseuqee sidrseuqee sidrseueqe sidrseueeq sidrseueeq
sidrseueqe sidrseeque sidrseeqeu sidrseeuqe sidrseeueq sidrseeeuq sidrseeequ sidrsqeeue sidrsqeeeu sidrsqeuee sidrsqeuee
sidrsqeeue sidrsqeeeu sidrsqeeue sidrsqeeeu sidrsqeuee sidrsqeuee sidrsqeeue sidrsqeeeu sidrsqueee sidrsqueee sidrsqueee
sidrsqueee sidrsqueee sidrsqueee sidrsqeeue sidrsqeeeu sidrsqeuee sidrsqeuee sidrsqeeue sidrsqeeeu sidrsueqee sidrsueqee
sidrsueeqe sidrsueeeq sidrsueeeq sidrsueeqe sidrsuqeee sidrsuqeee sidrsuqeee sidrsuqeee sidrsuqeee sidrsuqeee sidrsueqee
sidrsueqee sidrsueeqe sidrsueeeq sidrsueeeq sidrsueeqe sidrsueqee sidrsueqee sidrsueeqe sidrsueeeq sidrsueeeq sidrsueeqe
sidrseeque sidrseeqeu sidrseeuqe sidrseeueq sidrseeeuq sidrseeequ sidrseqeue sidrseqeeu sidrsequee sidrsequee sidrseqeue
sidrseqeeu sidrseuqee sidrseuqee sidrseueqe sidrseueeq sidrseueeq sidrseueqe sidrseeque sidrseeqeu sidrseeuqe sidrseeueq
sidrseeeuq sidrseeequ sidrqeseue sidrqeseeu sidrqesuee sidrqesuee sidrqeseue sidrqeseeu sidrqeesue sidrqeeseu sidrqeeuse
sidrqeeues sidrqeeeus sidrqeeesu sidrqeuese sidrqeuees sidrqeusee sidrqeusee sidrqeuese sidrqeuees sidrqeeeus sidrqeeesu
sidrqeeues sidrqeeuse sidrqeesue sidrqeeseu sidrqseeue sidrqseeeu sidrqseuee sidrqseuee sidrqseeue sidrqseeeu sidrqseeue
sidrqseeeu sidrqseuee sidrqseuee sidrqseeue sidrqseeeu sidrqsueee sidrqsueee sidrqsueee sidrqsueee sidrqsueee sidrqsueee
sidrqseeue sidrqseeeu sidrqseuee sidrqseuee sidrqseeue sidrqseeeu sidrqeseue sidrqeseeu sidrqesuee sidrqesuee sidrqeseue
sidrqeseeu sidrqeesue sidrqeeseu sidrqeeuse sidrqeeues sidrqeeeus sidrqeeesu sidrqeuese sidrqeuees sidrqeusee sidrqeusee
sidrqeuese sidrqeuees sidrqeeeus sidrqeeesu sidrqeeues sidrqeeuse sidrqeesue sidrqeeseu sidrquseee sidrquseee sidrquseee
sidrquseee sidrquseee sidrquseee sidrquesee sidrquesee sidrqueese sidrqueees sidrqueees sidrqueese sidrqueese sidrqueees
sidrquesee sidrquesee sidrqueese sidrqueees sidrqueees sidrqueese sidrqueees sidrqueese sidrquesee sidrquesee sidrqeseue
sidrqeseeu sidrqesuee sidrqesuee sidrqeseue sidrqeseeu sidrqeesue sidrqeeseu sidrqeeuse sidrqeeues sidrqeeeus sidrqeeesu
sidrqeuese sidrqeuees sidrqeusee sidrqeusee sidrqeuese sidrqeuees sidrqeeeus sidrqeeesu sidrqeeues sidrqeeuse sidrqeesue
sidrqeeseu sidruesqee sidruesqee sidrueseqe sidrueseeq sidrueseeq sidrueseqe sidrueqsee sidrueqsee sidrueqese sidrueqees
sidrueqees sidrueqese sidrueeqse sidrueeqes sidrueesqe sidrueeseq sidrueeesq sidrueeeqs sidrueeqes sidrueeqse sidrueeeqs
sidrueeesq sidrueeseq sidrueesqe sidruseqee sidruseqee sidruseeqe sidruseeeq sidruseeeq sidruseeqe sidrusqeee sidrusqeee
sidrusqeee sidrusqeee sidrusqeee sidrusqeee sidruseqee sidruseqee sidruseeqe sidruseeeq sidruseeeq sidruseeqe sidruseqee
sidruseqee sidruseeqe sidruseeeq sidruseeeq sidruseeqe sidruqseee sidruqseee sidruqseee sidruqseee sidruqseee sidruqseee
sidruqesee sidruqesee sidruqeese sidruqeees sidruqeees sidruqeese sidruqeese sidruqeees sidruqesee sidruqesee sidruqeese
sidruqeees sidruqeees sidruqeese sidruqeees sidruqeese sidruqesee sidruqesee sidruesqee sidruesqee sidrueseqe sidrueseeq
sidrueseeq sidrueseqe sidrueqsee sidrueqsee sidrueqese sidrueqees sidrueqees sidrueqese sidrueeqse sidrueeqes sidrueesqe
sidrueeseq sidrueeesq sidrueeeqs sidrueeqes sidrueeqse sidrueeeqs sidrueeesq sidrueeseq sidrueesqe sidruesqee sidruesqee
sidrueseqe sidrueseeq sidrueseeq sidrueseqe sidrueqsee sidrueqsee sidrueqese sidrueqees sidrueqees sidrueqese sidrueeqse
sidrueeqes sidrueesqe sidrueeseq sidrueeesq sidrueeeqs sidrueeqes sidrueeqse sidrueeeqs sidrueeesq sidrueeseq sidrueesqe
sidreesque sidreesqeu sidreesuqe sidreesueq sidreeseuq sidreesequ sidreeqsue sidreeqseu sidreequse sidreeques sidreeqeus
sidreeqesu sidreeuqse sidreeuqes sidreeusqe sidreeuseq sidreeuesq sidreeueqs sidreeequs sidreeeqsu sidreeeuqs sidreeeusq
sidreeesuq sidreeesqu sidreseque sidreseqeu sidreseuqe sidreseueq sidreseeuq sidreseequ sidresqeue sidresqeeu sidresquee
sidresquee sidresqeue sidresqeeu sidresuqee sidresuqee sidresueqe sidresueeq sidresueeq sidresueqe sidreseque sidreseqeu
sidreseuqe sidreseueq sidreseeuq sidreseequ sidreqseue sidreqseeu sidreqsuee sidreqsuee sidreqseue sidreqseeu sidreqesue
sidreqeseu sidreqeuse sidreqeues sidreqeeus sidreqeesu sidrequese sidrequees sidrequsee sidrequsee sidrequese sidrequees
sidreqeeus sidreqeesu sidreqeues sidreqeuse sidreqesue sidreqeseu sidreusqee sidreusqee sidreuseqe sidreuseeq sidreuseeq
sidreuseqe sidreuqsee sidreuqsee sidreuqese sidreuqees sidreuqees sidreuqese sidreueqse sidreueqes sidreuesqe sidreueseq
sidreueesq sidreueeqs sidreueqes sidreueqse sidreueeqs sidreueesq sidreueseq sidreuesqe sidreesque sidreesqeu sidreesuqe
sidreesueq sidreeseuq sidreesequ sidreeqsue sidreeqseu sidreequse sidreeques sidreeqeus sidreeqesu sidreeuqse sidreeuqes
sidreeusqe sidreeuseq sidreeuesq sidreeueqs sidreeequs sidreeeqsu sidreeeuqs sidreeeusq sidreeesuq sidreeesqu sideresque
sideresqeu sideresuqe sideresueq sidereseuq sideresequ sidereqsue sidereqseu siderequse sidereques sidereqeus sidereqesu
sidereuqse sidereuqes sidereusqe sidereuseq sidereuesq sidereueqs sidereequs sidereeqsu sidereeuqs sidereeusq sidereesuq
sidereesqu siderseque siderseqeu siderseuqe siderseueq siderseeuq siderseequ sidersqeue sidersqeeu sidersquee sidersquee
sidersqeue sidersqeeu sidersuqee sidersuqee sidersueqe sidersueeq sidersueeq sidersueqe siderseque siderseqeu siderseuqe
siderseueq siderseeuq siderseequ siderqseue siderqseeu siderqsuee siderqsuee siderqseue siderqseeu siderqesue siderqeseu
siderqeuse siderqeues siderqeeus siderqeesu siderquese siderquees siderqusee siderqusee siderquese siderquees siderqeeus
siderqeesu siderqeues siderqeuse siderqesue siderqeseu siderusqee siderusqee sideruseqe sideruseeq sideruseeq sideruseqe
sideruqsee sideruqsee sideruqese sideruqees sideruqees sideruqese siderueqse siderueqes sideruesqe siderueseq siderueesq
siderueeqs siderueqes siderueqse siderueeqs siderueesq siderueseq sideruesqe sideresque sideresqeu sideresuqe sideresueq
sidereseuq sideresequ sidereqsue sidereqseu siderequse sidereques sidereqeus sidereqesu sidereuqse sidereuqes sidereusqe
sidereuseq sidereuesq sidereueqs sidereequs sidereeqsu sidereeuqs sidereeusq sidereesuq sidereesqu sideersque sideersqeu
sideersuqe sideersueq sideerseuq sideersequ sideerqsue sideerqseu sideerquse sideerques sideerqeus sideerqesu sideeruqse
sideeruqes sideerusqe sideeruseq sideeruesq sideerueqs sideerequs sideereqsu sideereuqs sideereusq sideeresuq sideeresqu
sideesrque sideesrqeu sideesruqe sideesrueq sideesreuq sideesrequ sideesqrue sideesqreu sideesqure sideesquer sideesqeur
sideesqeru sideesuqre sideesuqer sideesurqe sideesureq sideesuerq sideesueqr sideesequr sideeseqru sideeseuqr sideeseurq
sideeseruq sideeserqu sideeqsrue sideeqsreu sideeqsure sideeqsuer sideeqseur sideeqseru sideeqrsue sideeqrseu sideeqruse
sideeqrues sideeqreus sideeqresu sideequrse sideequres sideequsre sideequser sideequesr sideequers sideeqerus sideeqersu
sideeqeurs sideeqeusr sideeqesur sideeqesru sideeusqre sideeusqer sideeusrqe sideeusreq sideeuserq sideeuseqr sideeuqsre
sideeuqser sideeuqrse sideeuqres sideeuqers sideeuqesr sideeurqse sideeurqes sideeursqe sideeurseq sideeuresq sideeureqs
sideeueqrs sideeueqsr sideeuerqs sideeuersq sideeuesrq sideeuesqr sideeesqur sideeesqru sideeesuqr sideeesurq sideeesruq
sideeesrqu sideeeqsur sideeeqsru sideeequsr sideeequrs sideeeqrus sideeeqrsu sideeeuqsr sideeeuqrs sideeeusqr sideeeusrq
sideeeursq sideeeurqs sideeerqus sideeerqsu sideeeruqs sideeerusq sideeersuq sideeersqu sideserque sideserqeu sideseruqe
sideserueq sidesereuq sideserequ sideseqrue sideseqreu sidesequre sidesequer sideseqeur sideseqeru sideseuqre sideseuqer
sideseurqe sideseureq sideseuerq sideseueqr sideseequr sideseeqru sideseeuqr sideseeurq sideseeruq sideseerqu sidesreque
sidesreqeu sidesreuqe sidesreueq sidesreeuq sidesreequ sidesrqeue sidesrqeeu sidesrquee sidesrquee sidesrqeue sidesrqeeu
sidesruqee sidesruqee sidesrueqe sidesrueeq sidesrueeq sidesrueqe sidesreque sidesreqeu sidesreuqe sidesreueq sidesreeuq
sidesreequ sidesqreue sidesqreeu sidesqruee sidesqruee sidesqreue sidesqreeu sidesqerue sidesqereu sidesqeure sidesqeuer
sidesqeeur sidesqeeru sidesquere sidesqueer sidesquree sidesquree sidesquere sidesqueer sidesqeeur sidesqeeru sidesqeuer
sidesqeure sidesqerue sidesqereu sidesurqee sidesurqee sidesureqe sidesureeq sidesureeq sidesureqe sidesuqree sidesuqree
sidesuqere sidesuqeer sidesuqeer sidesuqere sidesueqre sidesueqer sidesuerqe sidesuereq sidesueerq sidesueeqr sidesueqer
sidesueqre sidesueeqr sidesueerq sidesuereq sidesuerqe sideserque sideserqeu sideseruqe sideserueq sidesereuq sideserequ
sideseqrue sideseqreu sidesequre sidesequer sideseqeur sideseqeru sideseuqre sideseuqer sideseurqe sideseureq sideseuerq
sideseueqr sideseequr sideseeqru sideseeuqr sideseeurq sideseeruq sideseerqu sideqesrue sideqesreu sideqesure sideqesuer
sideqeseur sideqeseru sideqersue sideqerseu sideqeruse sideqerues sideqereus sideqeresu sideqeurse sideqeures sideqeusre
sideqeuser sideqeuesr sideqeuers sideqeerus sideqeersu sideqeeurs sideqeeusr sideqeesur sideqeesru sideqserue sideqsereu
sideqseure sideqseuer sideqseeur sideqseeru sideqsreue sideqsreeu sideqsruee sideqsruee sideqsreue sideqsreeu sideqsuree
sideqsuree sideqsuere sideqsueer sideqsueer sideqsuere sideqserue sideqsereu sideqseure sideqseuer sideqseeur sideqseeru
sideqrseue sideqrseeu sideqrsuee sideqrsuee sideqrseue sideqrseeu sideqresue sideqreseu sideqreuse sideqreues sideqreeus
sideqreesu sideqruese sideqruees sideqrusee sideqrusee sideqruese sideqruees sideqreeus sideqreesu sideqreues sideqreuse
sideqresue sideqreseu sidequsree sidequsree sidequsere sidequseer sidequseer sidequsere sideqursee sideqursee sidequrese
sidequrees sidequrees sidequrese sidequerse sidequeres sidequesre sidequeser sidequeesr sidequeers sidequeres sidequerse
sidequeers sidequeesr sidequeser sidequesre sideqesrue sideqesreu sideqesure sideqesuer sideqeseur sideqeseru sideqersue
sideqerseu sideqeruse sideqerues sideqereus sideqeresu sideqeurse sideqeures sideqeusre sideqeuser sideqeuesr sideqeuers
sideqeerus sideqeersu sideqeeurs sideqeeusr sideqeesur sideqeesru sideuesqre sideuesqer sideuesrqe sideuesreq sideueserq
sideueseqr sideueqsre sideueqser sideueqrse sideueqres sideueqers sideueqesr sideuerqse sideuerqes sideuersqe sideuerseq
sideueresq sideuereqs sideueeqrs sideueeqsr sideueerqs sideueersq sideueesrq sideueesqr sideuseqre sideuseqer sideuserqe
sideusereq sideuseerq sideuseeqr sideusqere sideusqeer sideusqree sideusqree sideusqere sideusqeer sideusrqee sideusrqee
sideusreqe sideusreeq sideusreeq sideusreqe sideuseqre sideuseqer sideuserqe sideusereq sideuseerq sideuseeqr sideuqsere
sideuqseer sideuqsree sideuqsree sideuqsere sideuqseer sideuqesre sideuqeser sideuqerse sideuqeres sideuqeers sideuqeesr
sideuqrese sideuqrees sideuqrsee sideuqrsee sideuqrese sideuqrees sideuqeers sideuqeesr sideuqeres sideuqerse sideuqesre
sideuqeser sideursqee sideursqee sideurseqe sideurseeq sideurseeq sideurseqe sideurqsee sideurqsee sideurqese sideurqees
sideurqees sideurqese sideureqse sideureqes sideuresqe sideureseq sideureesq sideureeqs sideureqes sideureqse sideureeqs
sideureesq sideureseq sideuresqe sideuesqre sideuesqer sideuesrqe sideuesreq sideueserq sideueseqr sideueqsre sideueqser
sideueqrse sideueqres sideueqers sideueqesr sideuerqse sideuerqes sideuersqe sideuerseq sideueresq sideuereqs sideueeqrs
sideueeqsr sideueerqs sideueersq sideueesrq sideueesqr sideeesqur sideeesqru sideeesuqr sideeesurq sideeesruq sideeesrqu
sideeeqsur sideeeqsru sideeequsr sideeequrs sideeeqrus sideeeqrsu sideeeuqsr sideeeuqrs sideeeusqr sideeeusrq sideeeursq
sideeeurqs sideeerqus sideeerqsu sideeeruqs sideeerusq sideeersuq sideeersqu sideesequr sideeseqru sideeseuqr sideeseurq
sideeseruq sideeserqu sideesqeur sideesqeru sideesquer sideesqure sideesqrue sideesqreu sideesuqer sideesuqre sideesueqr
sideesuerq sideesureq sideesurqe sideesrque sideesrqeu sideesruqe sideesrueq sideesreuq sideesrequ sideeqseur sideeqseru
sideeqsuer sideeqsure sideeqsrue sideeqsreu sideeqesur sideeqesru sideeqeusr sideeqeurs sideeqerus sideeqersu sideequesr
sideequers sideequser sideequsre sideequrse sideequres sideeqreus sideeqresu sideeqrues sideeqruse sideeqrsue sideeqrseu
sideeusqer sideeusqre sideeuseqr sideeuserq sideeusreq sideeusrqe sideeuqser sideeuqsre sideeuqesr sideeuqers sideeuqres
sideeuqrse sideeueqsr sideeueqrs sideeuesqr sideeuesrq sideeuersq sideeuerqs sideeurqes sideeurqse sideeureqs sideeuresq
sideeurseq sideeursqe sideersque sideersqeu sideersuqe sideersueq sideerseuq sideersequ sideerqsue sideerqseu sideerquse
sideerques sideerqeus sideerqesu sideeruqse sideeruqes sideerusqe sideeruseq sideeruesq sideerueqs sideerequs sideereqsu
sideereuqs sideereusq sideeresuq sideeresqu sidsreeque sidsreeqeu sidsreeuqe sidsreeueq sidsreeeuq sidsreeequ sidsreqeue
sidsreqeeu sidsrequee sidsrequee sidsreqeue sidsreqeeu sidsreuqee sidsreuqee sidsreueqe sidsreueeq sidsreueeq sidsreueqe
sidsreeque sidsreeqeu sidsreeuqe sidsreeueq sidsreeeuq sidsreeequ sidsreeque sidsreeqeu sidsreeuqe sidsreeueq sidsreeeuq
sidsreeequ sidsreqeue sidsreqeeu sidsrequee sidsrequee sidsreqeue sidsreqeeu sidsreuqee sidsreuqee sidsreueqe sidsreueeq
sidsreueeq sidsreueqe sidsreeque sidsreeqeu sidsreeuqe sidsreeueq sidsreeeuq sidsreeequ sidsrqeeue sidsrqeeeu sidsrqeuee
sidsrqeuee sidsrqeeue sidsrqeeeu sidsrqeeue sidsrqeeeu sidsrqeuee sidsrqeuee sidsrqeeue sidsrqeeeu sidsrqueee sidsrqueee
sidsrqueee sidsrqueee sidsrqueee sidsrqueee sidsrqeeue sidsrqeeeu sidsrqeuee sidsrqeuee sidsrqeeue sidsrqeeeu sidsrueqee
sidsrueqee sidsrueeqe sidsrueeeq sidsrueeeq sidsrueeqe sidsruqeee sidsruqeee sidsruqeee sidsruqeee sidsruqeee sidsruqeee
sidsrueqee sidsrueqee sidsrueeqe sidsrueeeq sidsrueeeq sidsrueeqe sidsrueqee sidsrueqee sidsrueeqe sidsrueeeq sidsrueeeq
sidsrueeqe sidsreeque sidsreeqeu sidsreeuqe sidsreeueq sidsreeeuq sidsreeequ sidsreqeue sidsreqeeu sidsrequee sidsrequee
sidsreqeue sidsreqeeu sidsreuqee sidsreuqee sidsreueqe sidsreueeq sidsreueeq sidsreueqe sidsreeque sidsreeqeu sidsreeuqe
sidsreeueq sidsreeeuq sidsreeequ sidsereque sidsereqeu sidsereuqe sidsereueq sidsereeuq sidsereequ sidserqeue sidserqeeu
sidserquee sidserquee sidserqeue sidserqeeu sidseruqee sidseruqee sidserueqe sidserueeq sidserueeq sidserueqe sidsereque
sidsereqeu sidsereuqe sidsereueq sidsereeuq sidsereequ sidseerque sidseerqeu sidseeruqe sidseerueq sidseereuq sidseerequ
sidseeqrue sidseeqreu sidseequre sidseequer sidseeqeur sidseeqeru sidseeuqre sidseeuqer sidseeurqe sidseeureq sidseeuerq
sidseeueqr sidseeequr sidseeeqru sidseeeuqr sidseeeurq sidseeeruq sidseeerqu sidseqerue sidseqereu sidseqeure sidseqeuer
sidseqeeur sidseqeeru sidseqreue sidseqreeu sidseqruee sidseqruee sidseqreue sidseqreeu sidsequree sidsequree sidsequere
sidsequeer sidsequeer sidsequere sidseqerue sidseqereu sidseqeure sidseqeuer sidseqeeur sidseqeeru sidseueqre sidseueqer
sidseuerqe sidseuereq sidseueerq sidseueeqr sidseuqere sidseuqeer sidseuqree sidseuqree sidseuqere sidseuqeer sidseurqee
sidseurqee sidseureqe sidseureeq sidseureeq sidseureqe sidseueqre sidseueqer sidseuerqe sidseuereq sidseueerq sidseueeqr
sidseeequr sidseeeqru sidseeeuqr sidseeeurq sidseeeruq sidseeerqu sidseeqeur sidseeqeru sidseequer sidseequre sidseeqrue
sidseeqreu sidseeuqer sidseeuqre sidseeueqr sidseeuerq sidseeureq sidseeurqe sidseerque sidseerqeu sidseeruqe sidseerueq
sidseereuq sidseerequ sidseerque sidseerqeu sidseeruqe sidseerueq sidseereuq sidseerequ sidseeqrue sidseeqreu sidseequre
sidseequer sidseeqeur sidseeqeru sidseeuqre sidseeuqer sidseeurqe sidseeureq sidseeuerq sidseeueqr sidseeequr sidseeeqru
sidseeeuqr sidseeeurq sidseeeruq sidseeerqu sidsereque sidsereqeu sidsereuqe sidsereueq sidsereeuq sidsereequ sidserqeue
sidserqeeu sidserquee sidserquee sidserqeue sidserqeeu sidseruqee sidseruqee sidserueqe sidserueeq sidserueeq sidserueqe
sidsereque sidsereqeu sidsereuqe sidsereueq sidsereeuq sidsereequ sidseqreue sidseqreeu sidseqruee sidseqruee sidseqreue
sidseqreeu sidseqerue sidseqereu sidseqeure sidseqeuer sidseqeeur sidseqeeru sidsequere sidsequeer sidsequree sidsequree
sidsequere sidsequeer sidseqeeur sidseqeeru sidseqeuer sidseqeure sidseqerue sidseqereu sidseurqee sidseurqee sidseureqe
sidseureeq sidseureeq sidseureqe sidseuqree sidseuqree sidseuqere sidseuqeer sidseuqeer sidseuqere sidseueqre sidseueqer
sidseuerqe sidseuereq sidseueerq sidseueeqr sidseueqer sidseueqre sidseueeqr sidseueerq sidseuereq sidseuerqe sidseerque
sidseerqeu sidseeruqe sidseerueq sidseereuq sidseerequ sidseeqrue sidseeqreu sidseequre sidseequer sidseeqeur sidseeqeru
sidseeuqre sidseeuqer sidseeurqe sidseeureq sidseeuerq sidseeueqr sidseeequr sidseeeqru sidseeeuqr sidseeeurq sidseeeruq
sidseeerqu sidsqeerue sidsqeereu sidsqeeure sidsqeeuer sidsqeeeur sidsqeeeru sidsqereue sidsqereeu sidsqeruee sidsqeruee
sidsqereue sidsqereeu sidsqeuree sidsqeuree sidsqeuere sidsqeueer sidsqeueer sidsqeuere sidsqeerue sidsqeereu sidsqeeure
sidsqeeuer sidsqeeeur sidsqeeeru sidsqeerue sidsqeereu sidsqeeure sidsqeeuer sidsqeeeur sidsqeeeru sidsqereue sidsqereeu
sidsqeruee sidsqeruee sidsqereue sidsqereeu sidsqeuree sidsqeuree sidsqeuere sidsqeueer sidsqeueer sidsqeuere sidsqeerue
sidsqeereu sidsqeeure sidsqeeuer sidsqeeeur sidsqeeeru sidsqreeue sidsqreeeu sidsqreuee sidsqreuee sidsqreeue sidsqreeeu
sidsqreeue sidsqreeeu sidsqreuee sidsqreuee sidsqreeue sidsqreeeu sidsqrueee sidsqrueee sidsqrueee sidsqrueee sidsqrueee
sidsqrueee sidsqreeue sidsqreeeu sidsqreuee sidsqreuee sidsqreeue sidsqreeeu sidsqueree sidsqueree sidsqueere sidsqueeer
sidsqueeer sidsqueere sidsqureee sidsqureee sidsqureee sidsqureee sidsqureee sidsqureee sidsqueree sidsqueree sidsqueere
sidsqueeer sidsqueeer sidsqueere sidsqueree sidsqueree sidsqueere sidsqueeer sidsqueeer sidsqueere sidsqeerue sidsqeereu
sidsqeeure sidsqeeuer sidsqeeeur sidsqeeeru sidsqereue sidsqereeu sidsqeruee sidsqeruee sidsqereue sidsqereeu sidsqeuree
sidsqeuree sidsqeuere sidsqeueer sidsqeueer sidsqeuere sidsqeerue sidsqeereu sidsqeeure sidsqeeuer sidsqeeeur sidsqeeeru
sidsueeqre sidsueeqer sidsueerqe sidsueereq sidsueeerq sidsueeeqr sidsueqere sidsueqeer sidsueqree sidsueqree sidsueqere
sidsueqeer sidsuerqee sidsuerqee sidsuereqe sidsuereeq sidsuereeq sidsuereqe sidsueeqre sidsueeqer sidsueerqe sidsueereq
sidsueeerq sidsueeeqr sidsueeqre sidsueeqer sidsueerqe sidsueereq sidsueeerq sidsueeeqr sidsueqere sidsueqeer sidsueqree
sidsueqree sidsueqere sidsueqeer sidsuerqee sidsuerqee sidsuereqe sidsuereeq sidsuereeq sidsuereqe sidsueeqre sidsueeqer
sidsueerqe sidsueereq sidsueeerq sidsueeeqr sidsuqeere sidsuqeeer sidsuqeree sidsuqeree sidsuqeere sidsuqeeer sidsuqeere
sidsuqeeer sidsuqeree sidsuqeree sidsuqeere sidsuqeeer sidsuqreee sidsuqreee sidsuqreee sidsuqreee sidsuqreee sidsuqreee
sidsuqeere sidsuqeeer sidsuqeree sidsuqeree sidsuqeere sidsuqeeer sidsureqee sidsureqee sidsureeqe sidsureeeq sidsureeeq
sidsureeqe sidsurqeee sidsurqeee sidsurqeee sidsurqeee sidsurqeee sidsurqeee sidsureqee sidsureqee sidsureeqe sidsureeeq
sidsureeeq sidsureeqe sidsureqee sidsureqee sidsureeqe sidsureeeq sidsureeeq sidsureeqe sidsueeqre sidsueeqer sidsueerqe
sidsueereq sidsueeerq sidsueeeqr sidsueqere sidsueqeer sidsueqree sidsueqree sidsueqere sidsueqeer sidsuerqee sidsuerqee
sidsuereqe sidsuereeq sidsuereeq sidsuereqe sidsueeqre sidsueeqer sidsueerqe sidsueereq sidsueeerq sidsueeeqr sidseeequr
sidseeeqru sidseeeuqr sidseeeurq sidseeeruq sidseeerqu sidseeqeur sidseeqeru sidseequer sidseequre sidseeqrue sidseeqreu
sidseeuqer sidseeuqre sidseeueqr sidseeuerq sidseeureq sidseeurqe sidseerque sidseerqeu sidseeruqe sidseerueq sidseereuq
sidseerequ sidseeequr sidseeeqru sidseeeuqr sidseeeurq sidseeeruq sidseeerqu sidseeqeur sidseeqeru sidseequer sidseequre
sidseeqrue sidseeqreu sidseeuqer sidseeuqre sidseeueqr sidseeuerq sidseeureq sidseeurqe sidseerque sidseerqeu sidseeruqe
sidseerueq sidseereuq sidseerequ sidseqeeur sidseqeeru sidseqeuer sidseqeure sidseqerue sidseqereu sidseqeeur sidseqeeru
sidseqeuer sidseqeure sidseqerue sidseqereu sidsequeer sidsequere sidsequeer sidsequere sidsequree sidsequree sidseqreue
sidseqreeu sidseqruee sidseqruee sidseqreue sidseqreeu sidseueqer sidseueqre sidseueeqr sidseueerq sidseuereq sidseuerqe
sidseuqeer sidseuqere sidseuqeer sidseuqere sidseuqree sidseuqree sidseueqer sidseueqre sidseueeqr sidseueerq sidseuereq
sidseuerqe sidseurqee sidseurqee sidseureqe sidseureeq sidseureeq sidseureqe sidsereque sidsereqeu sidsereuqe sidsereueq
sidsereeuq sidsereequ sidserqeue sidserqeeu sidserquee sidserquee sidserqeue sidserqeeu sidseruqee sidseruqee sidserueqe
sidserueeq sidserueeq sidserueqe sidsereque sidsereqeu sidsereuqe sidsereueq sidsereeuq sidsereequ sidqreseue sidqreseeu
sidqresuee sidqresuee sidqreseue sidqreseeu sidqreesue sidqreeseu sidqreeuse sidqreeues sidqreeeus sidqreeesu sidqreuese
sidqreuees sidqreusee sidqreusee sidqreuese sidqreuees sidqreeeus sidqreeesu sidqreeues sidqreeuse sidqreesue sidqreeseu
sidqrseeue sidqrseeeu sidqrseuee sidqrseuee sidqrseeue sidqrseeeu sidqrseeue sidqrseeeu sidqrseuee sidqrseuee sidqrseeue
sidqrseeeu sidqrsueee sidqrsueee sidqrsueee sidqrsueee sidqrsueee sidqrsueee sidqrseeue sidqrseeeu sidqrseuee sidqrseuee
sidqrseeue sidqrseeeu sidqreseue sidqreseeu sidqresuee sidqresuee sidqreseue sidqreseeu sidqreesue sidqreeseu sidqreeuse
sidqreeues sidqreeeus sidqreeesu sidqreuese sidqreuees sidqreusee sidqreusee sidqreuese sidqreuees sidqreeeus sidqreeesu
sidqreeues sidqreeuse sidqreesue sidqreeseu sidqruseee sidqruseee sidqruseee sidqruseee sidqruseee sidqruseee sidqruesee
sidqruesee sidqrueese sidqrueees sidqrueees sidqrueese sidqrueese sidqrueees sidqruesee sidqruesee sidqrueese sidqrueees
sidqrueees sidqrueese sidqrueees sidqrueese sidqruesee sidqruesee sidqreseue sidqreseeu sidqresuee sidqresuee sidqreseue
sidqreseeu sidqreesue sidqreeseu sidqreeuse sidqreeues sidqreeeus sidqreeesu sidqreuese sidqreuees sidqreusee sidqreusee
sidqreuese sidqreuees sidqreeeus sidqreeesu sidqreeues sidqreeuse sidqreesue sidqreeseu sidqerseue sidqerseeu sidqersuee
sidqersuee sidqerseue sidqerseeu sidqeresue sidqereseu sidqereuse sidqereues sidqereeus sidqereesu sidqeruese sidqeruees
sidqerusee sidqerusee sidqeruese sidqeruees sidqereeus sidqereesu sidqereues sidqereuse sidqeresue sidqereseu sidqesreue
sidqesreeu sidqesruee sidqesruee sidqesreue sidqesreeu sidqeserue sidqesereu sidqeseure sidqeseuer sidqeseeur sidqeseeru
sidqesuere sidqesueer sidqesuree sidqesuree sidqesuere sidqesueer sidqeseeur sidqeseeru sidqeseuer sidqeseure sidqeserue
sidqesereu sidqeesrue sidqeesreu sidqeesure sidqeesuer sidqeeseur sidqeeseru sidqeersue sidqeerseu sidqeeruse sidqeerues
sidqeereus sidqeeresu sidqeeurse sidqeeures sidqeeusre sidqeeuser sidqeeuesr sidqeeuers sidqeeerus sidqeeersu sidqeeeurs
sidqeeeusr sidqeeesur sidqeeesru sidqeusere sidqeuseer sidqeusree sidqeusree sidqeusere sidqeuseer sidqeuesre sidqeueser
sidqeuerse sidqeueres sidqeueers sidqeueesr sidqeurese sidqeurees sidqeursee sidqeursee sidqeurese sidqeurees sidqeueers
sidqeueesr sidqeueres sidqeuerse sidqeuesre sidqeueser sidqeeseur sidqeeseru sidqeesuer sidqeesure sidqeesrue sidqeesreu
sidqeeesur sidqeeesru sidqeeeusr sidqeeeurs sidqeeerus sidqeeersu sidqeeuesr sidqeeuers sidqeeuser sidqeeusre sidqeeurse
sidqeeures sidqeereus sidqeeresu sidqeerues sidqeeruse sidqeersue sidqeerseu sidqsereue sidqsereeu sidqseruee sidqseruee
sidqsereue sidqsereeu sidqseerue sidqseereu sidqseeure sidqseeuer sidqseeeur sidqseeeru sidqseuere sidqseueer sidqseuree
sidqseuree sidqseuere sidqseueer sidqseeeur sidqseeeru sidqseeuer sidqseeure sidqseerue sidqseereu sidqsreeue sidqsreeeu
sidqsreuee sidqsreuee sidqsreeue sidqsreeeu sidqsreeue sidqsreeeu sidqsreuee sidqsreuee sidqsreeue sidqsreeeu sidqsrueee
sidqsrueee sidqsrueee sidqsrueee sidqsrueee sidqsrueee sidqsreeue sidqsreeeu sidqsreuee sidqsreuee sidqsreeue sidqsreeeu
sidqsereue sidqsereeu sidqseruee sidqseruee sidqsereue sidqsereeu sidqseerue sidqseereu sidqseeure sidqseeuer sidqseeeur
sidqseeeru sidqseuere sidqseueer sidqseuree sidqseuree sidqseuere sidqseueer sidqseeeur sidqseeeru sidqseeuer sidqseeure
sidqseerue sidqseereu sidqsureee sidqsureee sidqsureee sidqsureee sidqsureee sidqsureee sidqsueree sidqsueree sidqsueere
sidqsueeer sidqsueeer sidqsueere sidqsueere sidqsueeer sidqsueree sidqsueree sidqsueere sidqsueeer sidqsueeer sidqsueere
sidqsueeer sidqsueere sidqsueree sidqsueree sidqsereue sidqsereeu sidqseruee sidqseruee sidqsereue sidqsereeu sidqseerue
sidqseereu sidqseeure sidqseeuer sidqseeeur sidqseeeru sidqseuere sidqseueer sidqseuree sidqseuree sidqseuere sidqseueer
sidqseeeur sidqseeeru sidqseeuer sidqseeure sidqseerue sidqseereu sidqeesrue sidqeesreu sidqeesure sidqeesuer sidqeeseur
sidqeeseru sidqeersue sidqeerseu sidqeeruse sidqeerues sidqeereus sidqeeresu sidqeeurse sidqeeures sidqeeusre sidqeeuser
sidqeeuesr sidqeeuers sidqeeerus sidqeeersu sidqeeeurs sidqeeeusr sidqeeesur sidqeeesru sidqeserue sidqesereu sidqeseure
sidqeseuer sidqeseeur sidqeseeru sidqesreue sidqesreeu sidqesruee sidqesruee sidqesreue sidqesreeu sidqesuree sidqesuree
sidqesuere sidqesueer sidqesueer sidqesuere sidqeserue sidqesereu sidqeseure sidqeseuer sidqeseeur sidqeseeru sidqerseue
sidqerseeu sidqersuee sidqersuee sidqerseue sidqerseeu sidqeresue sidqereseu sidqereuse sidqereues sidqereeus sidqereesu
sidqeruese sidqeruees sidqerusee sidqerusee sidqeruese sidqeruees sidqereeus sidqereesu sidqereues sidqereuse sidqeresue
sidqereseu sidqeusree sidqeusree sidqeusere sidqeuseer sidqeuseer sidqeusere sidqeursee sidqeursee sidqeurese sidqeurees
sidqeurees sidqeurese sidqeuerse sidqeueres sidqeuesre sidqeueser sidqeueesr sidqeueers sidqeueres sidqeuerse sidqeueers
sidqeueesr sidqeueser sidqeuesre sidqeesrue sidqeesreu sidqeesure sidqeesuer sidqeeseur sidqeeseru sidqeersue sidqeerseu
sidqeeruse sidqeerues sidqeereus sidqeeresu sidqeeurse sidqeeures sidqeeusre sidqeeuser sidqeeuesr sidqeeuers sidqeeerus
sidqeeersu sidqeeeurs sidqeeeusr sidqeeesur sidqeeesru sidquesere sidqueseer sidquesree sidquesree sidquesere sidqueseer
sidqueesre sidqueeser sidqueerse sidqueeres sidqueeers sidqueeesr sidquerese sidquerees sidquersee sidquersee sidquerese
sidquerees sidqueeers sidqueeesr sidqueeres sidqueerse sidqueesre sidqueeser sidquseere sidquseeer sidquseree sidquseree
sidquseere sidquseeer sidquseere sidquseeer sidquseree sidquseree sidquseere sidquseeer sidqusreee sidqusreee sidqusreee
sidqusreee sidqusreee sidqusreee sidquseere sidquseeer sidquseree sidquseree sidquseere sidquseeer sidquesere sidqueseer
sidquesree sidquesree sidquesere sidqueseer sidqueesre sidqueeser sidqueerse sidqueeres sidqueeers sidqueeesr sidquerese
sidquerees sidquersee sidquersee sidquerese sidquerees sidqueeers sidqueeesr sidqueeres sidqueerse sidqueesre sidqueeser
sidqurseee sidqurseee sidqurseee sidqurseee sidqurseee sidqurseee sidquresee sidquresee sidqureese sidqureees sidqureees
sidqureese sidqureese sidqureees sidquresee sidquresee sidqureese sidqureees sidqureees sidqureese sidqureees sidqureese
sidquresee sidquresee sidquesere sidqueseer sidquesree sidquesree sidquesere sidqueseer sidqueesre sidqueeser sidqueerse
sidqueeres sidqueeers sidqueeesr sidquerese sidquerees sidquersee sidquersee sidquerese sidquerees sidqueeers sidqueeesr
sidqueeres sidqueerse sidqueesre sidqueeser sidqeeseur sidqeeseru sidqeesuer sidqeesure sidqeesrue sidqeesreu sidqeeesur
sidqeeesru sidqeeeusr sidqeeeurs sidqeeerus sidqeeersu sidqeeuesr sidqeeuers sidqeeuser sidqeeusre sidqeeurse sidqeeures
sidqeereus sidqeeresu sidqeerues sidqeeruse sidqeersue sidqeerseu sidqeseeur sidqeseeru sidqeseuer sidqeseure sidqeserue
sidqesereu sidqeseeur sidqeseeru sidqeseuer sidqeseure sidqeserue sidqesereu sidqesueer sidqesuere sidqesueer sidqesuere
sidqesuree sidqesuree sidqesreue sidqesreeu sidqesruee sidqesruee sidqesreue sidqesreeu sidqeeseur sidqeeseru sidqeesuer
sidqeesure sidqeesrue sidqeesreu sidqeeesur sidqeeesru sidqeeeusr sidqeeeurs sidqeeerus sidqeeersu sidqeeuesr sidqeeuers
sidqeeuser sidqeeusre sidqeeurse sidqeeures sidqeereus sidqeeresu sidqeerues sidqeeruse sidqeersue sidqeerseu sidqeuseer
sidqeusere sidqeuseer sidqeusere sidqeusree sidqeusree sidqeueser sidqeuesre sidqeueesr sidqeueers sidqeueres sidqeuerse
sidqeueesr sidqeueers sidqeueser sidqeuesre sidqeuerse sidqeueres sidqeurees sidqeurese sidqeurees sidqeurese sidqeursee
sidqeursee sidqerseue sidqerseeu sidqersuee sidqersuee sidqerseue sidqerseeu sidqeresue sidqereseu sidqereuse sidqereues
sidqereeus sidqereesu sidqeruese sidqeruees sidqerusee sidqerusee sidqeruese sidqeruees sidqereeus sidqereesu sidqereues
sidqereuse sidqeresue sidqereseu siduresqee siduresqee sidureseqe sidureseeq sidureseeq sidureseqe sidureqsee sidureqsee
sidureqese sidureqees sidureqees sidureqese sidureeqse sidureeqes sidureesqe sidureeseq sidureeesq sidureeeqs sidureeqes
sidureeqse sidureeeqs sidureeesq sidureeseq sidureesqe sidurseqee sidurseqee sidurseeqe sidurseeeq sidurseeeq sidurseeqe
sidursqeee sidursqeee sidursqeee sidursqeee sidursqeee sidursqeee sidurseqee sidurseqee sidurseeqe sidurseeeq sidurseeeq
sidurseeqe sidurseqee sidurseqee sidurseeqe sidurseeeq sidurseeeq sidurseeqe sidurqseee sidurqseee sidurqseee sidurqseee
sidurqseee sidurqseee sidurqesee sidurqesee sidurqeese sidurqeees sidurqeees sidurqeese sidurqeese sidurqeees sidurqesee
sidurqesee sidurqeese sidurqeees sidurqeees sidurqeese sidurqeees sidurqeese sidurqesee sidurqesee siduresqee siduresqee
sidureseqe sidureseeq sidureseeq sidureseqe sidureqsee sidureqsee sidureqese sidureqees sidureqees sidureqese sidureeqse
sidureeqes sidureesqe sidureeseq sidureeesq sidureeeqs sidureeqes sidureeqse sidureeeqs sidureeesq sidureeseq sidureesqe
siduresqee siduresqee sidureseqe sidureseeq sidureseeq sidureseqe sidureqsee sidureqsee sidureqese sidureqees sidureqees
sidureqese sidureeqse sidureeqes sidureesqe sidureeseq sidureeesq sidureeeqs sidureeqes sidureeqse sidureeeqs sidureeesq
sidureeseq sidureesqe siduersqee siduersqee siduerseqe siduerseeq siduerseeq siduerseqe siduerqsee siduerqsee siduerqese
siduerqees siduerqees siduerqese siduereqse siduereqes sidueresqe siduereseq siduereesq siduereeqs siduereqes siduereqse
siduereeqs siduereesq siduereseq sidueresqe siduesrqee siduesrqee siduesreqe siduesreeq siduesreeq siduesreqe siduesqree
siduesqree siduesqere siduesqeer siduesqeer siduesqere sidueseqre sidueseqer sidueserqe siduesereq sidueseerq sidueseeqr
sidueseqer sidueseqre sidueseeqr sidueseerq siduesereq sidueserqe sidueqsree sidueqsree sidueqsere sidueqseer sidueqseer
sidueqsere sidueqrsee sidueqrsee sidueqrese sidueqrees sidueqrees sidueqrese sidueqerse sidueqeres sidueqesre sidueqeser
sidueqeesr sidueqeers sidueqeres sidueqerse sidueqeers sidueqeesr sidueqeser sidueqesre sidueesqre sidueesqer sidueesrqe
sidueesreq sidueeserq sidueeseqr sidueeqsre sidueeqser sidueeqrse sidueeqres sidueeqers sidueeqesr sidueerqse sidueerqes
sidueersqe sidueerseq sidueeresq sidueereqs sidueeeqrs sidueeeqsr sidueeerqs sidueeersq sidueeesrq sidueeesqr sidueesqer
sidueesqre sidueeseqr sidueeserq sidueesreq sidueesrqe sidueeqser sidueeqsre sidueeqesr sidueeqers sidueeqres sidueeqrse
sidueeeqsr sidueeeqrs sidueeesqr sidueeesrq sidueeersq sidueeerqs sidueerqes sidueerqse sidueereqs sidueeresq sidueerseq
sidueersqe siduserqee siduserqee sidusereqe sidusereeq sidusereeq sidusereqe siduseqree siduseqree siduseqere siduseqeer
siduseqeer siduseqere siduseeqre siduseeqer siduseerqe siduseereq siduseeerq siduseeeqr siduseeqer siduseeqre siduseeeqr
siduseeerq siduseereq siduseerqe sidusreqee sidusreqee sidusreeqe sidusreeeq sidusreeeq sidusreeqe sidusrqeee sidusrqeee
sidusrqeee sidusrqeee sidusrqeee sidusrqeee sidusreqee sidusreqee sidusreeqe sidusreeeq sidusreeeq sidusreeqe sidusreqee
sidusreqee sidusreeqe sidusreeeq sidusreeeq sidusreeqe sidusqreee sidusqreee sidusqreee sidusqreee sidusqreee sidusqreee
sidusqeree sidusqeree sidusqeere sidusqeeer sidusqeeer sidusqeere sidusqeere sidusqeeer sidusqeree sidusqeree sidusqeere
sidusqeeer sidusqeeer sidusqeere sidusqeeer sidusqeere sidusqeree sidusqeree siduserqee siduserqee sidusereqe sidusereeq
sidusereeq sidusereqe siduseqree siduseqree siduseqere siduseqeer siduseqeer siduseqere siduseeqre siduseeqer siduseerqe
siduseereq siduseeerq siduseeeqr siduseeqer siduseeqre siduseeeqr siduseeerq siduseereq siduseerqe siduserqee siduserqee
sidusereqe sidusereeq sidusereeq sidusereqe siduseqree siduseqree siduseqere siduseqeer siduseqeer siduseqere siduseeqre
siduseeqer siduseerqe siduseereq siduseeerq siduseeeqr siduseeqer siduseeqre siduseeeqr siduseeerq siduseereq siduseerqe
siduqesree siduqesree siduqesere siduqeseer siduqeseer siduqesere siduqersee siduqersee siduqerese siduqerees siduqerees
siduqerese siduqeerse siduqeeres siduqeesre siduqeeser siduqeeesr siduqeeers siduqeeres siduqeerse siduqeeers siduqeeesr
siduqeeser siduqeesre siduqseree siduqseree siduqseere siduqseeer siduqseeer siduqseere siduqsreee siduqsreee siduqsreee
siduqsreee siduqsreee siduqsreee siduqseree siduqseree siduqseere siduqseeer siduqseeer siduqseere siduqseree siduqseree
siduqseere siduqseeer siduqseeer siduqseere siduqrseee siduqrseee siduqrseee siduqrseee siduqrseee siduqrseee siduqresee
siduqresee siduqreese siduqreees siduqreees siduqreese siduqreese siduqreees siduqresee siduqresee siduqreese siduqreees
siduqreees siduqreese siduqreees siduqreese siduqresee siduqresee siduqesree siduqesree siduqesere siduqeseer siduqeseer
siduqesere siduqersee siduqersee siduqerese siduqerees siduqerees siduqerese siduqeerse siduqeeres siduqeesre siduqeeser
siduqeeesr siduqeeers siduqeeres siduqeerse siduqeeers siduqeeesr siduqeeser siduqeesre siduqesree siduqesree siduqesere
siduqeseer siduqeseer siduqesere siduqersee siduqersee siduqerese siduqerees siduqerees siduqerese siduqeerse siduqeeres
siduqeesre siduqeeser siduqeeesr siduqeeers siduqeeres siduqeerse siduqeeers siduqeeesr siduqeeser siduqeesre sidueesqre
sidueesqer sidueesrqe sidueesreq sidueeserq sidueeseqr sidueeqsre sidueeqser sidueeqrse sidueeqres sidueeqers sidueeqesr
sidueerqse sidueerqes sidueersqe sidueerseq sidueeresq sidueereqs sidueeeqrs sidueeeqsr sidueeerqs sidueeersq sidueeesrq
sidueeesqr sidueseqre sidueseqer sidueserqe siduesereq sidueseerq sidueseeqr siduesqere siduesqeer siduesqree siduesqree
siduesqere siduesqeer siduesrqee siduesrqee siduesreqe siduesreeq siduesreeq siduesreqe sidueseqre sidueseqer sidueserqe
siduesereq sidueseerq sidueseeqr sidueqsere sidueqseer sidueqsree sidueqsree sidueqsere sidueqseer sidueqesre sidueqeser
sidueqerse sidueqeres sidueqeers sidueqeesr sidueqrese sidueqrees sidueqrsee sidueqrsee sidueqrese sidueqrees sidueqeers
sidueqeesr sidueqeres sidueqerse sidueqesre sidueqeser siduersqee siduersqee siduerseqe siduerseeq siduerseeq siduerseqe
siduerqsee siduerqsee siduerqese siduerqees siduerqees siduerqese siduereqse siduereqes sidueresqe siduereseq siduereesq
siduereeqs siduereqes siduereqse siduereeqs siduereesq siduereseq sidueresqe sidueesqre sidueesqer sidueesrqe sidueesreq
sidueeserq sidueeseqr sidueeqsre sidueeqser sidueeqrse sidueeqres sidueeqers sidueeqesr sidueerqse sidueerqes sidueersqe
sidueerseq sidueeresq sidueereqs sidueeeqrs sidueeeqsr sidueeerqs sidueeersq sidueeesrq sidueeesqr sidueesqer sidueesqre
sidueeseqr sidueeserq sidueesreq sidueesrqe sidueeqser sidueeqsre sidueeqesr sidueeqers sidueeqres sidueeqrse sidueeeqsr
sidueeeqrs sidueeesqr sidueeesrq sidueeersq sidueeerqs sidueerqes sidueerqse sidueereqs sidueeresq sidueerseq sidueersqe
sidueseqer sidueseqre sidueseeqr sidueseerq siduesereq sidueserqe siduesqeer siduesqere siduesqeer siduesqere siduesqree
siduesqree sidueseqer sidueseqre sidueseeqr sidueseerq siduesereq sidueserqe siduesrqee siduesrqee siduesreqe siduesreeq
siduesreeq siduesreqe sidueqseer sidueqsere sidueqseer sidueqsere sidueqsree sidueqsree sidueqeser sidueqesre sidueqeesr
sidueqeers sidueqeres sidueqerse sidueqeesr sidueqeers sidueqeser sidueqesre sidueqerse sidueqeres sidueqrees sidueqrese
sidueqrees sidueqrese sidueqrsee sidueqrsee sidueesqer sidueesqre sidueeseqr sidueeserq sidueesreq sidueesrqe sidueeqser
sidueeqsre sidueeqesr sidueeqers sidueeqres sidueeqrse sidueeeqsr sidueeeqrs sidueeesqr sidueeesrq sidueeersq sidueeerqs
sidueerqes sidueerqse sidueereqs sidueeresq sidueerseq sidueersqe siduersqee siduersqee siduerseqe siduerseeq siduerseeq
siduerseqe siduerqsee siduerqsee siduerqese siduerqees siduerqees siduerqese siduereqse siduereqes sidueresqe siduereseq
siduereesq siduereeqs siduereqes siduereqse siduereeqs siduereesq siduereseq sidueresqe sideresque sideresqeu sideresuqe
sideresueq sidereseuq sideresequ sidereqsue sidereqseu siderequse sidereques sidereqeus sidereqesu sidereuqse sidereuqes
sidereusqe sidereuseq sidereuesq sidereueqs sidereequs sidereeqsu sidereeuqs sidereeusq sidereesuq sidereesqu siderseque
siderseqeu siderseuqe siderseueq siderseeuq siderseequ sidersqeue sidersqeeu sidersquee sidersquee sidersqeue sidersqeeu
sidersuqee sidersuqee sidersueqe sidersueeq sidersueeq sidersueqe siderseque siderseqeu siderseuqe siderseueq siderseeuq
siderseequ siderqseue siderqseeu siderqsuee siderqsuee siderqseue siderqseeu siderqesue siderqeseu siderqeuse siderqeues
siderqeeus siderqeesu siderquese siderquees siderqusee siderqusee siderquese siderquees siderqeeus siderqeesu siderqeues
siderqeuse siderqesue siderqeseu siderusqee siderusqee sideruseqe sideruseeq sideruseeq sideruseqe sideruqsee sideruqsee
sideruqese sideruqees sideruqees sideruqese siderueqse siderueqes sideruesqe siderueseq siderueesq siderueeqs siderueqes
siderueqse siderueeqs siderueesq siderueseq sideruesqe sideresque sideresqeu sideresuqe sideresueq sidereseuq sideresequ
sidereqsue sidereqseu siderequse sidereques sidereqeus sidereqesu sidereuqse sidereuqes sidereusqe sidereuseq sidereuesq
sidereueqs sidereequs sidereeqsu sidereeuqs sidereeusq sidereesuq sidereesqu sideersque sideersqeu sideersuqe sideersueq
sideerseuq sideersequ sideerqsue sideerqseu sideerquse sideerques sideerqeus sideerqesu sideeruqse sideeruqes sideerusqe
sideeruseq sideeruesq sideerueqs sideerequs sideereqsu sideereuqs sideereusq sideeresuq sideeresqu sideesrque sideesrqeu
sideesruqe sideesrueq sideesreuq sideesrequ sideesqrue sideesqreu sideesqure sideesquer sideesqeur sideesqeru sideesuqre
sideesuqer sideesurqe sideesureq sideesuerq sideesueqr sideesequr sideeseqru sideeseuqr sideeseurq sideeseruq sideeserqu
sideeqsrue sideeqsreu sideeqsure sideeqsuer sideeqseur sideeqseru sideeqrsue sideeqrseu sideeqruse sideeqrues sideeqreus
sideeqresu sideequrse sideequres sideequsre sideequser sideequesr sideequers sideeqerus sideeqersu sideeqeurs sideeqeusr
sideeqesur sideeqesru sideeusqre sideeusqer sideeusrqe sideeusreq sideeuserq sideeuseqr sideeuqsre sideeuqser sideeuqrse
sideeuqres sideeuqers sideeuqesr sideeurqse sideeurqes sideeursqe sideeurseq sideeuresq sideeureqs sideeueqrs sideeueqsr
sideeuerqs sideeuersq sideeuesrq sideeuesqr sideeesqur sideeesqru sideeesuqr sideeesurq sideeesruq sideeesrqu sideeeqsur
sideeeqsru sideeequsr sideeequrs sideeeqrus sideeeqrsu sideeeuqsr sideeeuqrs sideeeusqr sideeeusrq sideeeursq sideeeurqs
sideeerqus sideeerqsu sideeeruqs sideeerusq sideeersuq sideeersqu sideserque sideserqeu sideseruqe sideserueq sidesereuq
sideserequ sideseqrue sideseqreu sidesequre sidesequer sideseqeur sideseqeru sideseuqre sideseuqer sideseurqe sideseureq
sideseuerq sideseueqr sideseequr sideseeqru sideseeuqr sideseeurq sideseeruq sideseerqu sidesreque sidesreqeu sidesreuqe
sidesreueq sidesreeuq sidesreequ sidesrqeue sidesrqeeu sidesrquee sidesrquee sidesrqeue sidesrqeeu sidesruqee sidesruqee
sidesrueqe sidesrueeq sidesrueeq sidesrueqe sidesreque sidesreqeu sidesreuqe sidesreueq sidesreeuq sidesreequ sidesqreue
sidesqreeu sidesqruee sidesqruee sidesqreue sidesqreeu sidesqerue sidesqereu sidesqeure sidesqeuer sidesqeeur sidesqeeru
sidesquere sidesqueer sidesquree sidesquree sidesquere sidesqueer sidesqeeur sidesqeeru sidesqeuer sidesqeure sidesqerue
sidesqereu sidesurqee sidesurqee sidesureqe sidesureeq sidesureeq sidesureqe sidesuqree sidesuqree sidesuqere sidesuqeer
sidesuqeer sidesuqere sidesueqre sidesueqer sidesuerqe sidesuereq sidesueerq sidesueeqr sidesueqer sidesueqre sidesueeqr
sidesueerq sidesuereq sidesuerqe sideserque sideserqeu sideseruqe sideserueq sidesereuq sideserequ sideseqrue sideseqreu
sidesequre sidesequer sideseqeur sideseqeru sideseuqre sideseuqer sideseurqe sideseureq sideseuerq sideseueqr sideseequr
sideseeqru sideseeuqr sideseeurq sideseeruq sideseerqu sideqesrue sideqesreu sideqesure sideqesuer sideqeseur sideqeseru
sideqersue sideqerseu sideqeruse sideqerues sideqereus sideqeresu sideqeurse sideqeures sideqeusre sideqeuser sideqeuesr
sideqeuers sideqeerus sideqeersu sideqeeurs sideqeeusr sideqeesur sideqeesru sideqserue sideqsereu sideqseure sideqseuer
sideqseeur sideqseeru sideqsreue sideqsreeu sideqsruee sideqsruee sideqsreue sideqsreeu sideqsuree sideqsuree sideqsuere
sideqsueer sideqsueer sideqsuere sideqserue sideqsereu sideqseure sideqseuer sideqseeur sideqseeru sideqrseue sideqrseeu
sideqrsuee sideqrsuee sideqrseue sideqrseeu sideqresue sideqreseu sideqreuse sideqreues sideqreeus sideqreesu sideqruese
sideqruees sideqrusee sideqrusee sideqruese sideqruees sideqreeus sideqreesu sideqreues sideqreuse sideqresue sideqreseu
sidequsree sidequsree sidequsere sidequseer sidequseer sidequsere sideqursee sideqursee sidequrese sidequrees sidequrees
sidequrese sidequerse sidequeres sidequesre sidequeser sidequeesr sidequeers sidequeres sidequerse sidequeers sidequeesr
sidequeser sidequesre sideqesrue sideqesreu sideqesure sideqesuer sideqeseur sideqeseru sideqersue sideqerseu sideqeruse
sideqerues sideqereus sideqeresu sideqeurse sideqeures sideqeusre sideqeuser sideqeuesr sideqeuers sideqeerus sideqeersu
sideqeeurs sideqeeusr sideqeesur sideqeesru sideuesqre sideuesqer sideuesrqe sideuesreq sideueserq sideueseqr sideueqsre
sideueqser sideueqrse sideueqres sideueqers sideueqesr sideuerqse sideuerqes sideuersqe sideuerseq sideueresq sideuereqs
sideueeqrs sideueeqsr sideueerqs sideueersq sideueesrq sideueesqr sideuseqre sideuseqer sideuserqe sideusereq sideuseerq
sideuseeqr sideusqere sideusqeer sideusqree sideusqree sideusqere sideusqeer sideusrqee sideusrqee sideusreqe sideusreeq
sideusreeq sideusreqe sideuseqre sideuseqer sideuserqe sideusereq sideuseerq sideuseeqr sideuqsere sideuqseer sideuqsree
sideuqsree sideuqsere sideuqseer sideuqesre sideuqeser sideuqerse sideuqeres sideuqeers sideuqeesr sideuqrese sideuqrees
sideuqrsee sideuqrsee sideuqrese sideuqrees sideuqeers sideuqeesr sideuqeres sideuqerse sideuqesre sideuqeser sideursqee
sideursqee sideurseqe sideurseeq sideurseeq sideurseqe sideurqsee sideurqsee sideurqese sideurqees sideurqees sideurqese
sideureqse sideureqes sideuresqe sideureseq sideureesq sideureeqs sideureqes sideureqse sideureeqs sideureesq sideureseq
sideuresqe sideuesqre sideuesqer sideuesrqe sideuesreq sideueserq sideueseqr sideueqsre sideueqser sideueqrse sideueqres
sideueqers sideueqesr sideuerqse sideuerqes sideuersqe sideuerseq sideueresq sideuereqs sideueeqrs sideueeqsr sideueerqs
sideueersq sideueesrq sideueesqr sideeesqur sideeesqru sideeesuqr sideeesurq sideeesruq sideeesrqu sideeeqsur sideeeqsru
sideeequsr sideeequrs sideeeqrus sideeeqrsu sideeeuqsr sideeeuqrs sideeeusqr sideeeusrq sideeeursq sideeeurqs sideeerqus
sideeerqsu sideeeruqs sideeerusq sideeersuq sideeersqu sideesequr sideeseqru sideeseuqr sideeseurq sideeseruq sideeserqu
sideesqeur sideesqeru sideesquer sideesqure sideesqrue sideesqreu sideesuqer sideesuqre sideesueqr sideesuerq sideesureq
sideesurqe sideesrque sideesrqeu sideesruqe sideesrueq sideesreuq sideesrequ sideeqseur sideeqseru sideeqsuer sideeqsure
sideeqsrue sideeqsreu sideeqesur sideeqesru sideeqeusr sideeqeurs sideeqerus sideeqersu sideequesr sideequers sideequser
sideequsre sideequrse sideequres sideeqreus sideeqresu sideeqrues sideeqruse sideeqrsue sideeqrseu sideeusqer sideeusqre
sideeuseqr sideeuserq sideeusreq sideeusrqe sideeuqser sideeuqsre sideeuqesr sideeuqers sideeuqres sideeuqrse sideeueqsr
sideeueqrs sideeuesqr sideeuesrq sideeuersq sideeuerqs sideeurqes sideeurqse sideeureqs sideeuresq sideeurseq sideeursqe
sideersque sideersqeu sideersuqe sideersueq sideerseuq sideersequ sideerqsue sideerqseu sideerquse sideerques sideerqeus
sideerqesu sideeruqse sideeruqes sideerusqe sideeruseq sideeruesq sideerueqs sideerequs sideereqsu sideereuqs sideereusq
sideeresuq sideeresqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us