easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

writeoff

warisons

consederitque

festinavissem

brodersen

undupable

barlows

unlimitably

lavrovite

pensiveness

simiidae

unturning

zenelophon

chamrosh

rogabo

uirosque

thermomonospora

unled


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: showoffs
cipher variations:
tipxpggt ujqyqhhu vkrzriiv wlsasjjw xmtbtkkx
ynucully zovdvmmz apwewnna bqxfxoob crygyppc
dszhzqqd etaiarre fubjbssf gvckcttg hwdlduuh
ixemevvi jyfnfwwj kzgogxxk lahphyyl mbiqizzm
ncjrjaan odkskbbo peltlccp qfmumddq rgnvneer

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: showoffs
Cipher: hsldluuh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: showoffs
Cipher: BAAAB AABBB ABBAB BABAA ABBAB AABAB AABAB BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: showoffs
cipher variations:
tipxpggtdwrprqqdnkthtaanxyvzvkkxhmxrxuuhrazjzeerlcdtdyylvqflfiiv
fehdhssfpsjvjccpzglnlmmzjunfnwwjujqyqhhuexsqsrreoluiubboyzwawlly
inysyvvisbakaffsmdeuezzmwrgmgjjwgfieittgqtkwkddqahmomnnakvogoxxk
vkrzriivfytrtssfpmvjvccpzaxbxmmzjoztzwwjtcblbggtnefvfaanxshnhkkx
hgjfjuuhrulxleerbinpnooblwphpyylwlsasjjwgzusuttgqnwkwddqabycynna
kpauaxxkudcmchhuofgwgbboytioillyihkgkvvisvmymffscjoqoppcmxqiqzzm
xmtbtkkxhavtvuuhroxlxeerbczdzooblqbvbyylvedndiivpghxhccpzujpjmmz
jilhlwwjtwnznggtdkprpqqdnyrjraanynucullyibwuwvvispymyffscdaeappc
mrcwczzmwfeoejjwqhiyiddqavkqknnakjmimxxkuxoaohhuelqsqrreozsksbbo
zovdvmmzjcxvxwwjtqznzggtdebfbqqdnsdxdaanxgfpfkkxrijzjeerbwlrloob
lknjnyylvypbpiivfmrtrssfpatltccpapwewnnakdywyxxkuraoahhuefcgcrre
oteyebboyhgqgllysjkakffscxmsmppcmlokozzmwzqcqjjwgnsusttgqbumuddq
bqxfxooblezxzyylvsbpbiivfgdhdssfpufzfccpzihrhmmztklblggtdyntnqqd
nmplpaanxardrkkxhotvtuuhrcvnveercrygyppcmfayazzmwtcqcjjwgheiettg
qvgagddqajisinnaulmcmhhuezouorreonqmqbboybsesllyipuwuvvisdwowffs
dszhzqqdngbzbaanxudrdkkxhifjfuuhrwhbheerbkjtjoobvmndniivfapvpssf
pornrccpzctftmmzjqvxvwwjtexpxggtetaiarreohcacbboyvesellyijgkgvvi
sxiciffsclkukppcwnoeojjwgbqwqttgqpsosddqadugunnakrwywxxkufyqyhhu
fubjbssfpidbdccpzwftfmmzjkhlhwwjtyjdjggtdmlvlqqdxopfpkkxhcrxruuh
rqtpteerbevhvooblsxzxyylvgzrziivgvckcttgqjeceddqaxgugnnaklimixxk
uzkekhhuenmwmrreypqgqllyidsysvvisruquffscfwiwppcmtyayzzmwhasajjw
hwdlduuhrkfdfeerbyhvhooblmjnjyylvalfliivfonxnssfzqrhrmmzjetztwwj
tsvrvggtdgxjxqqdnuzbzaanxibtbkkxixemevvislgegffscziwippcmnkokzzm
wbmgmjjwgpoyottgarsisnnakfuauxxkutwswhhuehykyrreovacabboyjcuclly
jyfnfwwjtmhfhggtdajxjqqdnolplaanxcnhnkkxhqpzpuuhbstjtooblgvbvyyl
vuxtxiivfizlzssfpwbdbccpzkdvdmmzkzgogxxkunigihhuebkykrreopmqmbbo
ydoiollyirqaqvvictukuppcmhwcwzzmwvyuyjjwgjamattgqxcecddqalewenna
lahphyylvojhjiivfclzlssfpqnrnccpzepjpmmzjsrbrwwjduvlvqqdnixdxaan
xwzvzkkxhkbnbuuhrydfdeerbmfxfoobmbiqizzmwpkikjjwgdmamttgqrosoddq
afqkqnnaktscsxxkevwmwrreojyeybboyxawallyilcocvviszegeffscngygppc
ncjrjaanxqljlkkxhenbnuuhrsptpeerbgrlrooblutdtyylfwxnxssfpkzfzccp
zybxbmmzjmdpdwwjtafhfggtdohzhqqdodkskbboyrmkmllyifocovvistquqffs
chsmsppcmvueuzzmgxyoyttgqlagaddqazcycnnakneqexxkubgighhuepiairre
peltlccpzsnlnmmzjgpdpwwjturvrggtditntqqdnwvfvaanhyzpzuuhrmbhbeer
badzdooblofrfyylvchjhiivfqjbjssfqfmumddqatomonnakhqeqxxkuvswshhu
ejuourreoxwgwbboizaqavvisncicffscbeaeppcmpgsgzzmwdikijjwgrkckttg
rgnvneerbupnpooblirfryylvwtxtiivfkvpvssfpyxhxccpjabrbwwjtodjdggt
dcfbfqqdnqhthaanxejljkkxhsldluuhshowoffscvqoqppcmjsgszzmwxuyujjw
glwqwttgqzyiyddqkbcscxxkupekehhuedgcgrreoriuibboyfkmkllyitmemvvi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: showoffs
Cipher: fubjbssf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: showoffs
Cipher: 3432432543121234

Extended Methods:
Method #1

Plaintext: showoffs
method variations:
xntbtllxcsygyqqchxdmdvvhnciriaan

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s h o w o f f s 
3 3 4 2 4 1 1 3 
4 2 3 5 3 2 2 4 
They are then read out in rows:
3342411342353224
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: showoffs
Cipher: nidlixhr

Read more ...
Method #3

Plaintext: showoffs
method variations:
orhucbmo rhucbmoo hucbmoor
ucbmoorh cbmoorhu bmoorhuc
moorhucb oorhucbm

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: showoffs

first 5040 cipher variations(40320 total)
showoffs showofsf showoffs showofsf showosff showosff showfofs showfosf showffos showffso showfsfo
showfsof showffos showffso showfofs showfosf showfsof showfsfo showsffo showsfof showsffo showsfof
showsoff showsoff shoowffs shoowfsf shoowffs shoowfsf shoowsff shoowsff shoofwfs shoofwsf shooffws
shooffsw shoofsfw shoofswf shooffws shooffsw shoofwfs shoofwsf shoofswf shoofsfw shoosffw shoosfwf
shoosffw shoosfwf shooswff shooswff shofowfs shofowsf shofofws shofofsw shofosfw shofoswf shofwofs
shofwosf shofwfos shofwfso shofwsfo shofwsof shoffwos shoffwso shoffows shoffosw shoffsow shoffswo
shofswfo shofswof shofsfwo shofsfow shofsofw shofsowf shofofws shofofsw shofowfs shofowsf shofoswf
shofosfw shoffows shoffosw shoffwos shoffwso shoffswo shoffsow shofwfos shofwfso shofwofs shofwosf
shofwsof shofwsfo shofsfwo shofsfow shofswfo shofswof shofsowf shofsofw shosoffw shosofwf shosoffw
shosofwf shosowff shosowff shosfofw shosfowf shosffow shosffwo shosfwfo shosfwof shosffow shosffwo
shosfofw shosfowf shosfwof shosfwfo shoswffo shoswfof shoswffo shoswfof shoswoff shoswoff shwooffs
shwoofsf shwooffs shwoofsf shwoosff shwoosff shwofofs shwofosf shwoffos shwoffso shwofsfo shwofsof
shwoffos shwoffso shwofofs shwofosf shwofsof shwofsfo shwosffo shwosfof shwosffo shwosfof shwosoff
shwosoff shwooffs shwoofsf shwooffs shwoofsf shwoosff shwoosff shwofofs shwofosf shwoffos shwoffso
shwofsfo shwofsof shwoffos shwoffso shwofofs shwofosf shwofsof shwofsfo shwosffo shwosfof shwosffo
shwosfof shwosoff shwosoff shwfoofs shwfoosf shwfofos shwfofso shwfosfo shwfosof shwfoofs shwfoosf
shwfofos shwfofso shwfosfo shwfosof shwffoos shwffoso shwffoos shwffoso shwffsoo shwffsoo shwfsofo
shwfsoof shwfsfoo shwfsfoo shwfsofo shwfsoof shwfofos shwfofso shwfoofs shwfoosf shwfosof shwfosfo
shwffoos shwffoso shwffoos shwffoso shwffsoo shwffsoo shwfofos shwfofso shwfoofs shwfoosf shwfosof
shwfosfo shwfsfoo shwfsfoo shwfsofo shwfsoof shwfsoof shwfsofo shwsoffo shwsofof shwsoffo shwsofof
shwsooff shwsooff shwsfofo shwsfoof shwsffoo shwsffoo shwsfofo shwsfoof shwsffoo shwsffoo shwsfofo
shwsfoof shwsfoof shwsfofo shwsoffo shwsofof shwsoffo shwsofof shwsooff shwsooff showoffs showofsf
showoffs showofsf showosff showosff showfofs showfosf showffos showffso showfsfo showfsof showffos
showffso showfofs showfosf showfsof showfsfo showsffo showsfof showsffo showsfof showsoff showsoff
shoowffs shoowfsf shoowffs shoowfsf shoowsff shoowsff shoofwfs shoofwsf shooffws shooffsw shoofsfw
shoofswf shooffws shooffsw shoofwfs shoofwsf shoofswf shoofsfw shoosffw shoosfwf shoosffw shoosfwf
shooswff shooswff shofowfs shofowsf shofofws shofofsw shofosfw shofoswf shofwofs shofwosf shofwfos
shofwfso shofwsfo shofwsof shoffwos shoffwso shoffows shoffosw shoffsow shoffswo shofswfo shofswof
shofsfwo shofsfow shofsofw shofsowf shofofws shofofsw shofowfs shofowsf shofoswf shofosfw shoffows
shoffosw shoffwos shoffwso shoffswo shoffsow shofwfos shofwfso shofwofs shofwosf shofwsof shofwsfo
shofsfwo shofsfow shofswfo shofswof shofsowf shofsofw shosoffw shosofwf shosoffw shosofwf shosowff
shosowff shosfofw shosfowf shosffow shosffwo shosfwfo shosfwof shosffow shosffwo shosfofw shosfowf
shosfwof shosfwfo shoswffo shoswfof shoswffo shoswfof shoswoff shoswoff shfwoofs shfwoosf shfwofos
shfwofso shfwosfo shfwosof shfwoofs shfwoosf shfwofos shfwofso shfwosfo shfwosof shfwfoos shfwfoso
shfwfoos shfwfoso shfwfsoo shfwfsoo shfwsofo shfwsoof shfwsfoo shfwsfoo shfwsofo shfwsoof shfowofs
shfowosf shfowfos shfowfso shfowsfo shfowsof shfoowfs shfoowsf shfoofws shfoofsw shfoosfw shfooswf
shfofows shfofosw shfofwos shfofwso shfofswo shfofsow shfosofw shfosowf shfosfow shfosfwo shfoswfo
shfoswof shfoowfs shfoowsf shfoofws shfoofsw shfoosfw shfooswf shfowofs shfowosf shfowfos shfowfso
shfowsfo shfowsof shfofwos shfofwso shfofows shfofosw shfofsow shfofswo shfoswfo shfoswof shfosfwo
shfosfow shfosofw shfosowf shffoows shffoosw shffowos shffowso shffoswo shffosow shffoows shffoosw
shffowos shffowso shffoswo shffosow shffwoos shffwoso shffwoos shffwoso shffwsoo shffwsoo shffsowo
shffsoow shffswoo shffswoo shffsowo shffsoow shfsoofw shfsoowf shfsofow shfsofwo shfsowfo shfsowof
shfsoofw shfsoowf shfsofow shfsofwo shfsowfo shfsowof shfsfoow shfsfowo shfsfoow shfsfowo shfsfwoo
shfsfwoo shfswofo shfswoof shfswfoo shfswfoo shfswofo shfswoof shfwofos shfwofso shfwoofs shfwoosf
shfwosof shfwosfo shfwfoos shfwfoso shfwfoos shfwfoso shfwfsoo shfwfsoo shfwofos shfwofso shfwoofs
shfwoosf shfwosof shfwosfo shfwsfoo shfwsfoo shfwsofo shfwsoof shfwsoof shfwsofo shfowfos shfowfso
shfowofs shfowosf shfowsof shfowsfo shfofwos shfofwso shfofows shfofosw shfofsow shfofswo shfoofws
shfoofsw shfoowfs shfoowsf shfooswf shfoosfw shfosfow shfosfwo shfosofw shfosowf shfoswof shfoswfo
shffowos shffowso shffoows shffoosw shffosow shffoswo shffwoos shffwoso shffwoos shffwoso shffwsoo
shffwsoo shffowos shffowso shffoows shffoosw shffosow shffoswo shffswoo shffswoo shffsowo shffsoow
shffsoow shffsowo shfoofws shfoofsw shfoowfs shfoowsf shfooswf shfoosfw shfofows shfofosw shfofwos
shfofwso shfofswo shfofsow shfowfos shfowfso shfowofs shfowosf shfowsof shfowsfo shfosfwo shfosfow
shfoswfo shfoswof shfosowf shfosofw shfsofow shfsofwo shfsoofw shfsoowf shfsowof shfsowfo shfsfoow
shfsfowo shfsfoow shfsfowo shfsfwoo shfsfwoo shfsofow shfsofwo shfsoofw shfsoowf shfsowof shfsowfo
shfswfoo shfswfoo shfswofo shfswoof shfswoof shfswofo shswoffo shswofof shswoffo shswofof shswooff
shswooff shswfofo shswfoof shswffoo shswffoo shswfofo shswfoof shswffoo shswffoo shswfofo shswfoof
shswfoof shswfofo shswoffo shswofof shswoffo shswofof shswooff shswooff shsowffo shsowfof shsowffo
shsowfof shsowoff shsowoff shsofwfo shsofwof shsoffwo shsoffow shsofofw shsofowf shsoffwo shsoffow
shsofwfo shsofwof shsofowf shsofofw shsooffw shsoofwf shsooffw shsoofwf shsoowff shsoowff shsfowfo
shsfowof shsfofwo shsfofow shsfoofw shsfoowf shsfwofo shsfwoof shsfwfoo shsfwfoo shsfwofo shsfwoof
shsffwoo shsffwoo shsffowo shsffoow shsffoow shsffowo shsfowfo shsfowof shsfofwo shsfofow shsfoofw
shsfoowf shsfofwo shsfofow shsfowfo shsfowof shsfoowf shsfoofw shsffowo shsffoow shsffwoo shsffwoo
shsffowo shsffoow shsfwfoo shsfwfoo shsfwofo shsfwoof shsfwoof shsfwofo shsfofwo shsfofow shsfowfo
shsfowof shsfoowf shsfoofw shsooffw shsoofwf shsooffw shsoofwf shsoowff shsoowff shsofofw shsofowf
shsoffow shsoffwo shsofwfo shsofwof shsoffow shsoffwo shsofofw shsofowf shsofwof shsofwfo shsowffo
shsowfof shsowffo shsowfof shsowoff shsowoff sohwoffs sohwofsf sohwoffs sohwofsf sohwosff sohwosff
sohwfofs sohwfosf sohwffos sohwffso sohwfsfo sohwfsof sohwffos sohwffso sohwfofs sohwfosf sohwfsof
sohwfsfo sohwsffo sohwsfof sohwsffo sohwsfof sohwsoff sohwsoff sohowffs sohowfsf sohowffs sohowfsf
sohowsff sohowsff sohofwfs sohofwsf sohoffws sohoffsw sohofsfw sohofswf sohoffws sohoffsw sohofwfs
sohofwsf sohofswf sohofsfw sohosffw sohosfwf sohosffw sohosfwf sohoswff sohoswff sohfowfs sohfowsf
sohfofws sohfofsw sohfosfw sohfoswf sohfwofs sohfwosf sohfwfos sohfwfso sohfwsfo sohfwsof sohffwos
sohffwso sohffows sohffosw sohffsow sohffswo sohfswfo sohfswof sohfsfwo sohfsfow sohfsofw sohfsowf
sohfofws sohfofsw sohfowfs sohfowsf sohfoswf sohfosfw sohffows sohffosw sohffwos sohffwso sohffswo
sohffsow sohfwfos sohfwfso sohfwofs sohfwosf sohfwsof sohfwsfo sohfsfwo sohfsfow sohfswfo sohfswof
sohfsowf sohfsofw sohsoffw sohsofwf sohsoffw sohsofwf sohsowff sohsowff sohsfofw sohsfowf sohsffow
sohsffwo sohsfwfo sohsfwof sohsffow sohsffwo sohsfofw sohsfowf sohsfwof sohsfwfo sohswffo sohswfof
sohswffo sohswfof sohswoff sohswoff sowhoffs sowhofsf sowhoffs sowhofsf sowhosff sowhosff sowhfofs
sowhfosf sowhffos sowhffso sowhfsfo sowhfsof sowhffos sowhffso sowhfofs sowhfosf sowhfsof sowhfsfo
sowhsffo sowhsfof sowhsffo sowhsfof sowhsoff sowhsoff sowohffs sowohfsf sowohffs sowohfsf sowohsff
sowohsff sowofhfs sowofhsf sowoffhs sowoffsh sowofsfh sowofshf sowoffhs sowoffsh sowofhfs sowofhsf
sowofshf sowofsfh sowosffh sowosfhf sowosffh sowosfhf sowoshff sowoshff sowfohfs sowfohsf sowfofhs
sowfofsh sowfosfh sowfoshf sowfhofs sowfhosf sowfhfos sowfhfso sowfhsfo sowfhsof sowffhos sowffhso
sowffohs sowffosh sowffsoh sowffsho sowfshfo sowfshof sowfsfho sowfsfoh sowfsofh sowfsohf sowfofhs
sowfofsh sowfohfs sowfohsf sowfoshf sowfosfh sowffohs sowffosh sowffhos sowffhso sowffsho sowffsoh
sowfhfos sowfhfso sowfhofs sowfhosf sowfhsof sowfhsfo sowfsfho sowfsfoh sowfshfo sowfshof sowfsohf
sowfsofh sowsoffh sowsofhf sowsoffh sowsofhf sowsohff sowsohff sowsfofh sowsfohf sowsffoh sowsffho
sowsfhfo sowsfhof sowsffoh sowsffho sowsfofh sowsfohf sowsfhof sowsfhfo sowshffo sowshfof sowshffo
sowshfof sowshoff sowshoff soowhffs soowhfsf soowhffs soowhfsf soowhsff soowhsff soowfhfs soowfhsf
soowffhs soowffsh soowfsfh soowfshf soowffhs soowffsh soowfhfs soowfhsf soowfshf soowfsfh soowsffh
soowsfhf soowsffh soowsfhf soowshff soowshff soohwffs soohwfsf soohwffs soohwfsf soohwsff soohwsff
soohfwfs soohfwsf soohffws soohffsw soohfsfw soohfswf soohffws soohffsw soohfwfs soohfwsf soohfswf
soohfsfw soohsffw soohsfwf soohsffw soohsfwf soohswff soohswff soofhwfs soofhwsf soofhfws soofhfsw
soofhsfw soofhswf soofwhfs soofwhsf soofwfhs soofwfsh soofwsfh soofwshf sooffwhs sooffwsh sooffhws
sooffhsw sooffshw sooffswh soofswfh soofswhf soofsfwh soofsfhw soofshfw soofshwf soofhfws soofhfsw
soofhwfs soofhwsf soofhswf soofhsfw sooffhws sooffhsw sooffwhs sooffwsh sooffswh sooffshw soofwfhs
soofwfsh soofwhfs soofwhsf soofwshf soofwsfh soofsfwh soofsfhw soofswfh soofswhf soofshwf soofshfw
sooshffw sooshfwf sooshffw sooshfwf sooshwff sooshwff soosfhfw soosfhwf soosffhw soosffwh soosfwfh
soosfwhf soosffhw soosffwh soosfhfw soosfhwf soosfwhf soosfwfh sooswffh sooswfhf sooswffh sooswfhf
sooswhff sooswhff sofwohfs sofwohsf sofwofhs sofwofsh sofwosfh sofwoshf sofwhofs sofwhosf sofwhfos
sofwhfso sofwhsfo sofwhsof sofwfhos sofwfhso sofwfohs sofwfosh sofwfsoh sofwfsho sofwshfo sofwshof
sofwsfho sofwsfoh sofwsofh sofwsohf sofowhfs sofowhsf sofowfhs sofowfsh sofowsfh sofowshf sofohwfs
sofohwsf sofohfws sofohfsw sofohsfw sofohswf sofofhws sofofhsw sofofwhs sofofwsh sofofswh sofofshw
sofoshfw sofoshwf sofosfhw sofosfwh sofoswfh sofoswhf sofhowfs sofhowsf sofhofws sofhofsw sofhosfw
sofhoswf sofhwofs sofhwosf sofhwfos sofhwfso sofhwsfo sofhwsof sofhfwos sofhfwso sofhfows sofhfosw
sofhfsow sofhfswo sofhswfo sofhswof sofhsfwo sofhsfow sofhsofw sofhsowf soffohws soffohsw soffowhs
soffowsh soffoswh soffoshw soffhows soffhosw soffhwos soffhwso soffhswo soffhsow soffwhos soffwhso
soffwohs soffwosh soffwsoh soffwsho soffshwo soffshow soffswho soffswoh soffsowh soffsohw sofsohfw
sofsohwf sofsofhw sofsofwh sofsowfh sofsowhf sofshofw sofshowf sofshfow sofshfwo sofshwfo sofshwof
sofsfhow sofsfhwo sofsfohw sofsfowh sofsfwoh sofsfwho sofswhfo sofswhof sofswfho sofswfoh sofswofh
sofswohf sofwofhs sofwofsh sofwohfs sofwohsf sofwoshf sofwosfh sofwfohs sofwfosh sofwfhos sofwfhso
sofwfsho sofwfsoh sofwhfos sofwhfso sofwhofs sofwhosf sofwhsof sofwhsfo sofwsfho sofwsfoh sofwshfo
sofwshof sofwsohf sofwsofh sofowfhs sofowfsh sofowhfs sofowhsf sofowshf sofowsfh sofofwhs sofofwsh
sofofhws sofofhsw sofofshw sofofswh sofohfws sofohfsw sofohwfs sofohwsf sofohswf sofohsfw sofosfhw
sofosfwh sofoshfw sofoshwf sofoswhf sofoswfh soffowhs soffowsh soffohws soffohsw soffoshw soffoswh
soffwohs soffwosh soffwhos soffwhso soffwsho soffwsoh soffhwos soffhwso soffhows soffhosw soffhsow
soffhswo soffswho soffswoh soffshwo soffshow soffsohw soffsowh sofhofws sofhofsw sofhowfs sofhowsf
sofhoswf sofhosfw sofhfows sofhfosw sofhfwos sofhfwso sofhfswo sofhfsow sofhwfos sofhwfso sofhwofs
sofhwosf sofhwsof sofhwsfo sofhsfwo sofhsfow sofhswfo sofhswof sofhsowf sofhsofw sofsofhw sofsofwh
sofsohfw sofsohwf sofsowhf sofsowfh sofsfohw sofsfowh sofsfhow sofsfhwo sofsfwho sofsfwoh sofshfow
sofshfwo sofshofw sofshowf sofshwof sofshwfo sofswfho sofswfoh sofswhfo sofswhof sofswohf sofswofh
soswoffh soswofhf soswoffh soswofhf soswohff soswohff soswfofh soswfohf soswffoh soswffho soswfhfo
soswfhof soswffoh soswffho soswfofh soswfohf soswfhof soswfhfo soswhffo soswhfof soswhffo soswhfof
soswhoff soswhoff sosowffh sosowfhf sosowffh sosowfhf sosowhff sosowhff sosofwfh sosofwhf sosoffwh
sosoffhw sosofhfw sosofhwf sosoffwh sosoffhw sosofwfh sosofwhf sosofhwf sosofhfw sosohffw sosohfwf
sosohffw sosohfwf sosohwff sosohwff sosfowfh sosfowhf sosfofwh sosfofhw sosfohfw sosfohwf sosfwofh
sosfwohf sosfwfoh sosfwfho sosfwhfo sosfwhof sosffwoh sosffwho sosffowh sosffohw sosffhow sosffhwo
sosfhwfo sosfhwof sosfhfwo sosfhfow sosfhofw sosfhowf sosfofwh sosfofhw sosfowfh sosfowhf sosfohwf
sosfohfw sosffowh sosffohw sosffwoh sosffwho sosffhwo sosffhow sosfwfoh sosfwfho sosfwofh sosfwohf
sosfwhof sosfwhfo sosfhfwo sosfhfow sosfhwfo sosfhwof sosfhowf sosfhofw soshoffw soshofwf soshoffw
soshofwf soshowff soshowff soshfofw soshfowf soshffow soshffwo soshfwfo soshfwof soshffow soshffwo
soshfofw soshfowf soshfwof soshfwfo soshwffo soshwfof soshwffo soshwfof soshwoff soshwoff swohoffs
swohofsf swohoffs swohofsf swohosff swohosff swohfofs swohfosf swohffos swohffso swohfsfo swohfsof
swohffos swohffso swohfofs swohfosf swohfsof swohfsfo swohsffo swohsfof swohsffo swohsfof swohsoff
swohsoff swoohffs swoohfsf swoohffs swoohfsf swoohsff swoohsff swoofhfs swoofhsf swooffhs swooffsh
swoofsfh swoofshf swooffhs swooffsh swoofhfs swoofhsf swoofshf swoofsfh swoosffh swoosfhf swoosffh
swoosfhf swooshff swooshff swofohfs swofohsf swofofhs swofofsh swofosfh swofoshf swofhofs swofhosf
swofhfos swofhfso swofhsfo swofhsof swoffhos swoffhso swoffohs swoffosh swoffsoh swoffsho swofshfo
swofshof swofsfho swofsfoh swofsofh swofsohf swofofhs swofofsh swofohfs swofohsf swofoshf swofosfh
swoffohs swoffosh swoffhos swoffhso swoffsho swoffsoh swofhfos swofhfso swofhofs swofhosf swofhsof
swofhsfo swofsfho swofsfoh swofshfo swofshof swofsohf swofsofh swosoffh swosofhf swosoffh swosofhf
swosohff swosohff swosfofh swosfohf swosffoh swosffho swosfhfo swosfhof swosffoh swosffho swosfofh
swosfohf swosfhof swosfhfo swoshffo swoshfof swoshffo swoshfof swoshoff swoshoff swhooffs swhoofsf
swhooffs swhoofsf swhoosff swhoosff swhofofs swhofosf swhoffos swhoffso swhofsfo swhofsof swhoffos
swhoffso swhofofs swhofosf swhofsof swhofsfo swhosffo swhosfof swhosffo swhosfof swhosoff swhosoff
swhooffs swhoofsf swhooffs swhoofsf swhoosff swhoosff swhofofs swhofosf swhoffos swhoffso swhofsfo
swhofsof swhoffos swhoffso swhofofs swhofosf swhofsof swhofsfo swhosffo swhosfof swhosffo swhosfof
swhosoff swhosoff swhfoofs swhfoosf swhfofos swhfofso swhfosfo swhfosof swhfoofs swhfoosf swhfofos
swhfofso swhfosfo swhfosof swhffoos swhffoso swhffoos swhffoso swhffsoo swhffsoo swhfsofo swhfsoof
swhfsfoo swhfsfoo swhfsofo swhfsoof swhfofos swhfofso swhfoofs swhfoosf swhfosof swhfosfo swhffoos
swhffoso swhffoos swhffoso swhffsoo swhffsoo swhfofos swhfofso swhfoofs swhfoosf swhfosof swhfosfo
swhfsfoo swhfsfoo swhfsofo swhfsoof swhfsoof swhfsofo swhsoffo swhsofof swhsoffo swhsofof swhsooff
swhsooff swhsfofo swhsfoof swhsffoo swhsffoo swhsfofo swhsfoof swhsffoo swhsffoo swhsfofo swhsfoof
swhsfoof swhsfofo swhsoffo swhsofof swhsoffo swhsofof swhsooff swhsooff swohoffs swohofsf swohoffs
swohofsf swohosff swohosff swohfofs swohfosf swohffos swohffso swohfsfo swohfsof swohffos swohffso
swohfofs swohfosf swohfsof swohfsfo swohsffo swohsfof swohsffo swohsfof swohsoff swohsoff swoohffs
swoohfsf swoohffs swoohfsf swoohsff swoohsff swoofhfs swoofhsf swooffhs swooffsh swoofsfh swoofshf
swooffhs swooffsh swoofhfs swoofhsf swoofshf swoofsfh swoosffh swoosfhf swoosffh swoosfhf swooshff
swooshff swofohfs swofohsf swofofhs swofofsh swofosfh swofoshf swofhofs swofhosf swofhfos swofhfso
swofhsfo swofhsof swoffhos swoffhso swoffohs swoffosh swoffsoh swoffsho swofshfo swofshof swofsfho
swofsfoh swofsofh swofsohf swofofhs swofofsh swofohfs swofohsf swofoshf swofosfh swoffohs swoffosh
swoffhos swoffhso swoffsho swoffsoh swofhfos swofhfso swofhofs swofhosf swofhsof swofhsfo swofsfho
swofsfoh swofshfo swofshof swofsohf swofsofh swosoffh swosofhf swosoffh swosofhf swosohff swosohff
swosfofh swosfohf swosffoh swosffho swosfhfo swosfhof swosffoh swosffho swosfofh swosfohf swosfhof
swosfhfo swoshffo swoshfof swoshffo swoshfof swoshoff swoshoff swfhoofs swfhoosf swfhofos swfhofso
swfhosfo swfhosof swfhoofs swfhoosf swfhofos swfhofso swfhosfo swfhosof swfhfoos swfhfoso swfhfoos
swfhfoso swfhfsoo swfhfsoo swfhsofo swfhsoof swfhsfoo swfhsfoo swfhsofo swfhsoof swfohofs swfohosf
swfohfos swfohfso swfohsfo swfohsof swfoohfs swfoohsf swfoofhs swfoofsh swfoosfh swfooshf swfofohs
swfofosh swfofhos swfofhso swfofsho swfofsoh swfosofh swfosohf swfosfoh swfosfho swfoshfo swfoshof
swfoohfs swfoohsf swfoofhs swfoofsh swfoosfh swfooshf swfohofs swfohosf swfohfos swfohfso swfohsfo
swfohsof swfofhos swfofhso swfofohs swfofosh swfofsoh swfofsho swfoshfo swfoshof swfosfho swfosfoh
swfosofh swfosohf swffoohs swffoosh swffohos swffohso swffosho swffosoh swffoohs swffoosh swffohos
swffohso swffosho swffosoh swffhoos swffhoso swffhoos swffhoso swffhsoo swffhsoo swffsoho swffsooh
swffshoo swffshoo swffsoho swffsooh swfsoofh swfsoohf swfsofoh swfsofho swfsohfo swfsohof swfsoofh
swfsoohf swfsofoh swfsofho swfsohfo swfsohof swfsfooh swfsfoho swfsfooh swfsfoho swfsfhoo swfsfhoo
swfshofo swfshoof swfshfoo swfshfoo swfshofo swfshoof swfhofos swfhofso swfhoofs swfhoosf swfhosof
swfhosfo swfhfoos swfhfoso swfhfoos swfhfoso swfhfsoo swfhfsoo swfhofos swfhofso swfhoofs swfhoosf
swfhosof swfhosfo swfhsfoo swfhsfoo swfhsofo swfhsoof swfhsoof swfhsofo swfohfos swfohfso swfohofs
swfohosf swfohsof swfohsfo swfofhos swfofhso swfofohs swfofosh swfofsoh swfofsho swfoofhs swfoofsh
swfoohfs swfoohsf swfooshf swfoosfh swfosfoh swfosfho swfosofh swfosohf swfoshof swfoshfo swffohos
swffohso swffoohs swffoosh swffosoh swffosho swffhoos swffhoso swffhoos swffhoso swffhsoo swffhsoo
swffohos swffohso swffoohs swffoosh swffosoh swffosho swffshoo swffshoo swffsoho swffsooh swffsooh
swffsoho swfoofhs swfoofsh swfoohfs swfoohsf swfooshf swfoosfh swfofohs swfofosh swfofhos swfofhso
swfofsho swfofsoh swfohfos swfohfso swfohofs swfohosf swfohsof swfohsfo swfosfho swfosfoh swfoshfo
swfoshof swfosohf swfosofh swfsofoh swfsofho swfsoofh swfsoohf swfsohof swfsohfo swfsfooh swfsfoho
swfsfooh swfsfoho swfsfhoo swfsfhoo swfsofoh swfsofho swfsoofh swfsoohf swfsohof swfsohfo swfshfoo
swfshfoo swfshofo swfshoof swfshoof swfshofo swshoffo swshofof swshoffo swshofof swshooff swshooff
swshfofo swshfoof swshffoo swshffoo swshfofo swshfoof swshffoo swshffoo swshfofo swshfoof swshfoof
swshfofo swshoffo swshofof swshoffo swshofof swshooff swshooff swsohffo swsohfof swsohffo swsohfof
swsohoff swsohoff swsofhfo swsofhof swsoffho swsoffoh swsofofh swsofohf swsoffho swsoffoh swsofhfo
swsofhof swsofohf swsofofh swsooffh swsoofhf swsooffh swsoofhf swsoohff swsoohff swsfohfo swsfohof
swsfofho swsfofoh swsfoofh swsfoohf swsfhofo swsfhoof swsfhfoo swsfhfoo swsfhofo swsfhoof swsffhoo
swsffhoo swsffoho swsffooh swsffooh swsffoho swsfohfo swsfohof swsfofho swsfofoh swsfoofh swsfoohf
swsfofho swsfofoh swsfohfo swsfohof swsfoohf swsfoofh swsffoho swsffooh swsffhoo swsffhoo swsffoho
swsffooh swsfhfoo swsfhfoo swsfhofo swsfhoof swsfhoof swsfhofo swsfofho swsfofoh swsfohfo swsfohof
swsfoohf swsfoofh swsooffh swsoofhf swsooffh swsoofhf swsoohff swsoohff swsofofh swsofohf swsoffoh
swsoffho swsofhfo swsofhof swsoffoh swsoffho swsofofh swsofohf swsofhof swsofhfo swsohffo swsohfof
swsohffo swsohfof swsohoff swsohoff soowhffs soowhfsf soowhffs soowhfsf soowhsff soowhsff soowfhfs
soowfhsf soowffhs soowffsh soowfsfh soowfshf soowffhs soowffsh soowfhfs soowfhsf soowfshf soowfsfh
soowsffh soowsfhf soowsffh soowsfhf soowshff soowshff soohwffs soohwfsf soohwffs soohwfsf soohwsff
soohwsff soohfwfs soohfwsf soohffws soohffsw soohfsfw soohfswf soohffws soohffsw soohfwfs soohfwsf
soohfswf soohfsfw soohsffw soohsfwf soohsffw soohsfwf soohswff soohswff soofhwfs soofhwsf soofhfws
soofhfsw soofhsfw soofhswf soofwhfs soofwhsf soofwfhs soofwfsh soofwsfh soofwshf sooffwhs sooffwsh
sooffhws sooffhsw sooffshw sooffswh soofswfh soofswhf soofsfwh soofsfhw soofshfw soofshwf soofhfws
soofhfsw soofhwfs soofhwsf soofhswf soofhsfw sooffhws sooffhsw sooffwhs sooffwsh sooffswh sooffshw
soofwfhs soofwfsh soofwhfs soofwhsf soofwshf soofwsfh soofsfwh soofsfhw soofswfh soofswhf soofshwf
soofshfw sooshffw sooshfwf sooshffw sooshfwf sooshwff sooshwff soosfhfw soosfhwf soosffhw soosffwh
soosfwfh soosfwhf soosffhw soosffwh soosfhfw soosfhwf soosfwhf soosfwfh sooswffh sooswfhf sooswffh
sooswfhf sooswhff sooswhff sowohffs sowohfsf sowohffs sowohfsf sowohsff sowohsff sowofhfs sowofhsf
sowoffhs sowoffsh sowofsfh sowofshf sowoffhs sowoffsh sowofhfs sowofhsf sowofshf sowofsfh sowosffh
sowosfhf sowosffh sowosfhf sowoshff sowoshff sowhoffs sowhofsf sowhoffs sowhofsf sowhosff sowhosff
sowhfofs sowhfosf sowhffos sowhffso sowhfsfo sowhfsof sowhffos sowhffso sowhfofs sowhfosf sowhfsof
sowhfsfo sowhsffo sowhsfof sowhsffo sowhsfof sowhsoff sowhsoff sowfhofs sowfhosf sowfhfos sowfhfso
sowfhsfo sowfhsof sowfohfs sowfohsf sowfofhs sowfofsh sowfosfh sowfoshf sowffohs sowffosh sowffhos
sowffhso sowffsho sowffsoh sowfsofh sowfsohf sowfsfoh sowfsfho sowfshfo sowfshof sowfhfos sowfhfso
sowfhofs sowfhosf sowfhsof sowfhsfo sowffhos sowffhso sowffohs sowffosh sowffsoh sowffsho sowfofhs
sowfofsh sowfohfs sowfohsf sowfoshf sowfosfh sowfsfoh sowfsfho sowfsofh sowfsohf sowfshof sowfshfo
sowshffo sowshfof sowshffo sowshfof sowshoff sowshoff sowsfhfo sowsfhof sowsffho sowsffoh sowsfofh
sowsfohf sowsffho sowsffoh sowsfhfo sowsfhof sowsfohf sowsfofh sowsoffh sowsofhf sowsoffh sowsofhf
sowsohff sowsohff sohwoffs sohwofsf sohwoffs sohwofsf sohwosff sohwosff sohwfofs sohwfosf sohwffos
sohwffso sohwfsfo sohwfsof sohwffos sohwffso sohwfofs sohwfosf sohwfsof sohwfsfo sohwsffo sohwsfof
sohwsffo sohwsfof sohwsoff sohwsoff sohowffs sohowfsf sohowffs sohowfsf sohowsff sohowsff sohofwfs
sohofwsf sohoffws sohoffsw sohofsfw sohofswf sohoffws sohoffsw sohofwfs sohofwsf sohofswf sohofsfw
sohosffw sohosfwf sohosffw sohosfwf sohoswff sohoswff sohfowfs sohfowsf sohfofws sohfofsw sohfosfw
sohfoswf sohfwofs sohfwosf sohfwfos sohfwfso sohfwsfo sohfwsof sohffwos sohffwso sohffows sohffosw
sohffsow sohffswo sohfswfo sohfswof sohfsfwo sohfsfow sohfsofw sohfsowf sohfofws sohfofsw sohfowfs
sohfowsf sohfoswf sohfosfw sohffows sohffosw sohffwos sohffwso sohffswo sohffsow sohfwfos sohfwfso
sohfwofs sohfwosf sohfwsof sohfwsfo sohfsfwo sohfsfow sohfswfo sohfswof sohfsowf sohfsofw sohsoffw
sohsofwf sohsoffw sohsofwf sohsowff sohsowff sohsfofw sohsfowf sohsffow sohsffwo sohsfwfo sohsfwof
sohsffow sohsffwo sohsfofw sohsfowf sohsfwof sohsfwfo sohswffo sohswfof sohswffo sohswfof sohswoff
sohswoff sofwhofs sofwhosf sofwhfos sofwhfso sofwhsfo sofwhsof sofwohfs sofwohsf sofwofhs sofwofsh
sofwosfh sofwoshf sofwfohs sofwfosh sofwfhos sofwfhso sofwfsho sofwfsoh sofwsofh sofwsohf sofwsfoh
sofwsfho sofwshfo sofwshof sofhwofs sofhwosf sofhwfos sofhwfso sofhwsfo sofhwsof sofhowfs sofhowsf
sofhofws sofhofsw sofhosfw sofhoswf sofhfows sofhfosw sofhfwos sofhfwso sofhfswo sofhfsow sofhsofw
sofhsowf sofhsfow sofhsfwo sofhswfo sofhswof sofohwfs sofohwsf sofohfws sofohfsw sofohsfw sofohswf
sofowhfs sofowhsf sofowfhs sofowfsh sofowsfh sofowshf sofofwhs sofofwsh sofofhws sofofhsw sofofshw
sofofswh sofoswfh sofoswhf sofosfwh sofosfhw sofoshfw sofoshwf soffhows soffhosw soffhwos soffhwso
soffhswo soffhsow soffohws soffohsw soffowhs soffowsh soffoswh soffoshw soffwohs soffwosh soffwhos
soffwhso soffwsho soffwsoh soffsowh soffsohw soffswoh soffswho soffshwo soffshow sofshofw sofshowf
sofshfow sofshfwo sofshwfo sofshwof sofsohfw sofsohwf sofsofhw sofsofwh sofsowfh sofsowhf sofsfohw
sofsfowh sofsfhow sofsfhwo sofsfwho sofsfwoh sofswofh sofswohf sofswfoh sofswfho sofswhfo sofswhof
sofwhfos sofwhfso sofwhofs sofwhosf sofwhsof sofwhsfo sofwfhos sofwfhso sofwfohs sofwfosh sofwfsoh
sofwfsho sofwofhs sofwofsh sofwohfs sofwohsf sofwoshf sofwosfh sofwsfoh sofwsfho sofwsofh sofwsohf
sofwshof sofwshfo sofhwfos sofhwfso sofhwofs sofhwosf sofhwsof sofhwsfo sofhfwos sofhfwso sofhfows
sofhfosw sofhfsow sofhfswo sofhofws sofhofsw sofhowfs sofhowsf sofhoswf sofhosfw sofhsfow sofhsfwo
sofhsofw sofhsowf sofhswof sofhswfo soffhwos soffhwso soffhows soffhosw soffhsow soffhswo soffwhos
soffwhso soffwohs soffwosh soffwsoh soffwsho soffowhs soffowsh soffohws soffohsw soffoshw soffoswh
soffswoh soffswho soffsowh soffsohw soffshow soffshwo sofohfws sofohfsw sofohwfs sofohwsf sofohswf
sofohsfw sofofhws sofofhsw sofofwhs sofofwsh sofofswh sofofshw sofowfhs sofowfsh sofowhfs sofowhsf
sofowshf sofowsfh sofosfwh sofosfhw sofoswfh sofoswhf sofoshwf sofoshfw sofshfow sofshfwo sofshofw
sofshowf sofshwof sofshwfo sofsfhow sofsfhwo sofsfohw sofsfowh sofsfwoh sofsfwho sofsofhw sofsofwh
sofsohfw sofsohwf sofsowhf sofsowfh sofswfoh sofswfho sofswofh sofswohf sofswhof sofswhfo soswhffo
soswhfof soswhffo soswhfof soswhoff soswhoff soswfhfo soswfhof soswffho soswffoh soswfofh soswfohf
soswffho soswffoh soswfhfo soswfhof soswfohf soswfofh soswoffh soswofhf soswoffh soswofhf soswohff
soswohff soshwffo soshwfof soshwffo soshwfof soshwoff soshwoff soshfwfo soshfwof soshffwo soshffow
soshfofw soshfowf soshffwo soshffow soshfwfo soshfwof soshfowf soshfofw soshoffw soshofwf soshoffw
soshofwf soshowff soshowff sosfhwfo sosfhwof sosfhfwo sosfhfow sosfhofw sosfhowf sosfwhfo sosfwhof
sosfwfho sosfwfoh sosfwofh sosfwohf sosffwho sosffwoh sosffhwo sosffhow sosffohw sosffowh sosfowfh
sosfowhf sosfofwh sosfofhw sosfohfw sosfohwf sosfhfwo sosfhfow sosfhwfo sosfhwof sosfhowf sosfhofw
sosffhwo sosffhow sosffwho sosffwoh sosffowh sosffohw sosfwfho sosfwfoh sosfwhfo sosfwhof sosfwohf
sosfwofh sosfofwh sosfofhw sosfowfh sosfowhf sosfohwf sosfohfw sosohffw sosohfwf sosohffw sosohfwf
sosohwff sosohwff sosofhfw sosofhwf sosoffhw sosoffwh sosofwfh sosofwhf sosoffhw sosoffwh sosofhfw
sosofhwf sosofwhf sosofwfh sosowffh sosowfhf sosowffh sosowfhf sosowhff sosowhff sfowohfs sfowohsf
sfowofhs sfowofsh sfowosfh sfowoshf sfowhofs sfowhosf sfowhfos sfowhfso sfowhsfo sfowhsof sfowfhos
sfowfhso sfowfohs sfowfosh sfowfsoh sfowfsho sfowshfo sfowshof sfowsfho sfowsfoh sfowsofh sfowsohf
sfoowhfs sfoowhsf sfoowfhs sfoowfsh sfoowsfh sfoowshf sfoohwfs sfoohwsf sfoohfws sfoohfsw sfoohsfw
sfoohswf sfoofhws sfoofhsw sfoofwhs sfoofwsh sfoofswh sfoofshw sfooshfw sfooshwf sfoosfhw sfoosfwh
sfooswfh sfooswhf sfohowfs sfohowsf sfohofws sfohofsw sfohosfw sfohoswf sfohwofs sfohwosf sfohwfos
sfohwfso sfohwsfo sfohwsof sfohfwos sfohfwso sfohfows sfohfosw sfohfsow sfohfswo sfohswfo sfohswof
sfohsfwo sfohsfow sfohsofw sfohsowf sfofohws sfofohsw sfofowhs sfofowsh sfofoswh sfofoshw sfofhows
sfofhosw sfofhwos sfofhwso sfofhswo sfofhsow sfofwhos sfofwhso sfofwohs sfofwosh sfofwsoh sfofwsho
sfofshwo sfofshow sfofswho sfofswoh sfofsowh sfofsohw sfosohfw sfosohwf sfosofhw sfosofwh sfosowfh
sfosowhf sfoshofw sfoshowf sfoshfow sfoshfwo sfoshwfo sfoshwof sfosfhow sfosfhwo sfosfohw sfosfowh
sfosfwoh sfosfwho sfoswhfo sfoswhof sfoswfho sfoswfoh sfoswofh sfoswohf sfwoohfs sfwoohsf sfwoofhs
sfwoofsh sfwoosfh sfwooshf sfwohofs sfwohosf sfwohfos sfwohfso sfwohsfo sfwohsof sfwofhos sfwofhso
sfwofohs sfwofosh sfwofsoh sfwofsho sfwoshfo sfwoshof sfwosfho sfwosfoh sfwosofh sfwosohf sfwoohfs
sfwoohsf sfwoofhs sfwoofsh sfwoosfh sfwooshf sfwohofs sfwohosf sfwohfos sfwohfso sfwohsfo sfwohsof
sfwofhos sfwofhso sfwofohs sfwofosh sfwofsoh sfwofsho sfwoshfo sfwoshof sfwosfho sfwosfoh sfwosofh
sfwosohf sfwhoofs sfwhoosf sfwhofos sfwhofso sfwhosfo sfwhosof sfwhoofs sfwhoosf sfwhofos sfwhofso
sfwhosfo sfwhosof sfwhfoos sfwhfoso sfwhfoos sfwhfoso sfwhfsoo sfwhfsoo sfwhsofo sfwhsoof sfwhsfoo
sfwhsfoo sfwhsofo sfwhsoof sfwfohos sfwfohso sfwfoohs sfwfoosh sfwfosoh sfwfosho sfwfhoos sfwfhoso
sfwfhoos sfwfhoso sfwfhsoo sfwfhsoo sfwfohos sfwfohso sfwfoohs sfwfoosh sfwfosoh sfwfosho sfwfshoo
sfwfshoo sfwfsoho sfwfsooh sfwfsooh sfwfsoho sfwsohfo sfwsohof sfwsofho sfwsofoh sfwsoofh sfwsoohf
sfwshofo sfwshoof sfwshfoo sfwshfoo sfwshofo sfwshoof sfwsfhoo sfwsfhoo sfwsfoho sfwsfooh sfwsfooh
sfwsfoho sfwsohfo sfwsohof sfwsofho sfwsofoh sfwsoofh sfwsoohf sfowohfs sfowohsf sfowofhs sfowofsh
sfowosfh sfowoshf sfowhofs sfowhosf sfowhfos sfowhfso sfowhsfo sfowhsof sfowfhos sfowfhso sfowfohs
sfowfosh sfowfsoh sfowfsho sfowshfo sfowshof sfowsfho sfowsfoh sfowsofh sfowsohf sfoowhfs sfoowhsf
sfoowfhs sfoowfsh sfoowsfh sfoowshf sfoohwfs sfoohwsf sfoohfws sfoohfsw sfoohsfw sfoohswf sfoofhws
sfoofhsw sfoofwhs sfoofwsh sfoofswh sfoofshw sfooshfw sfooshwf sfoosfhw sfoosfwh sfooswfh sfooswhf
sfohowfs sfohowsf sfohofws sfohofsw sfohosfw sfohoswf sfohwofs sfohwosf sfohwfos sfohwfso sfohwsfo
sfohwsof sfohfwos sfohfwso sfohfows sfohfosw sfohfsow sfohfswo sfohswfo sfohswof sfohsfwo sfohsfow
sfohsofw sfohsowf sfofohws sfofohsw sfofowhs sfofowsh sfofoswh sfofoshw sfofhows sfofhosw sfofhwos
sfofhwso sfofhswo sfofhsow sfofwhos sfofwhso sfofwohs sfofwosh sfofwsoh sfofwsho sfofshwo sfofshow
sfofswho sfofswoh sfofsowh sfofsohw sfosohfw sfosohwf sfosofhw sfosofwh sfosowfh sfosowhf sfoshofw
sfoshowf sfoshfow sfoshfwo sfoshwfo sfoshwof sfosfhow sfosfhwo sfosfohw sfosfowh sfosfwoh sfosfwho
sfoswhfo sfoswhof sfoswfho sfoswfoh sfoswofh sfoswohf sfhwoofs sfhwoosf sfhwofos sfhwofso sfhwosfo
sfhwosof sfhwoofs sfhwoosf sfhwofos sfhwofso sfhwosfo sfhwosof sfhwfoos sfhwfoso sfhwfoos sfhwfoso
sfhwfsoo sfhwfsoo sfhwsofo sfhwsoof sfhwsfoo sfhwsfoo sfhwsofo sfhwsoof sfhowofs sfhowosf sfhowfos
sfhowfso sfhowsfo sfhowsof sfhoowfs sfhoowsf sfhoofws sfhoofsw sfhoosfw sfhooswf sfhofows sfhofosw
sfhofwos sfhofwso sfhofswo sfhofsow sfhosofw sfhosowf sfhosfow sfhosfwo sfhoswfo sfhoswof sfhoowfs
sfhoowsf sfhoofws sfhoofsw sfhoosfw sfhooswf sfhowofs sfhowosf sfhowfos sfhowfso sfhowsfo sfhowsof
sfhofwos sfhofwso sfhofows sfhofosw sfhofsow sfhofswo sfhoswfo sfhoswof sfhosfwo sfhosfow sfhosofw
sfhosowf sfhfoows sfhfoosw sfhfowos sfhfowso sfhfoswo sfhfosow sfhfoows sfhfoosw sfhfowos sfhfowso
sfhfoswo sfhfosow sfhfwoos sfhfwoso sfhfwoos sfhfwoso sfhfwsoo sfhfwsoo sfhfsowo sfhfsoow sfhfswoo
sfhfswoo sfhfsowo sfhfsoow sfhsoofw sfhsoowf sfhsofow sfhsofwo sfhsowfo sfhsowof sfhsoofw sfhsoowf
sfhsofow sfhsofwo sfhsowfo sfhsowof sfhsfoow sfhsfowo sfhsfoow sfhsfowo sfhsfwoo sfhsfwoo sfhswofo
sfhswoof sfhswfoo sfhswfoo sfhswofo sfhswoof sffwohos sffwohso sffwoohs sffwoosh sffwosoh sffwosho
sffwhoos sffwhoso sffwhoos sffwhoso sffwhsoo sffwhsoo sffwohos sffwohso sffwoohs sffwoosh sffwosoh
sffwosho sffwshoo sffwshoo sffwsoho sffwsooh sffwsooh sffwsoho sffowhos sffowhso sffowohs sffowosh
sffowsoh sffowsho sffohwos sffohwso sffohows sffohosw sffohsow sffohswo sffoohws sffoohsw sffoowhs
sffoowsh sffooswh sffooshw sffoshow sffoshwo sffosohw sffosowh sffoswoh sffoswho sffhowos sffhowso
sffhoows sffhoosw sffhosow sffhoswo sffhwoos sffhwoso sffhwoos sffhwoso sffhwsoo sffhwsoo sffhowos
sffhowso sffhoows sffhoosw sffhosow sffhoswo sffhswoo sffhswoo sffhsowo sffhsoow sffhsoow sffhsowo
sffoohws sffoohsw sffoowhs sffoowsh sffooswh sffooshw sffohows sffohosw sffohwos sffohwso sffohswo
sffohsow sffowhos sffowhso sffowohs sffowosh sffowsoh sffowsho sffoshwo sffoshow sffoswho sffoswoh
sffosowh sffosohw sffsohow sffsohwo sffsoohw sffsoowh sffsowoh sffsowho sffshoow sffshowo sffshoow
sffshowo sffshwoo sffshwoo sffsohow sffsohwo sffsoohw sffsoowh sffsowoh sffsowho sffswhoo sffswhoo
sffswoho sffswooh sffswooh sffswoho sfswohfo sfswohof sfswofho sfswofoh sfswoofh sfswoohf sfswhofo
sfswhoof sfswhfoo sfswhfoo sfswhofo sfswhoof sfswfhoo sfswfhoo sfswfoho sfswfooh sfswfooh sfswfoho
sfswohfo sfswohof sfswofho sfswofoh sfswoofh sfswoohf sfsowhfo sfsowhof sfsowfho sfsowfoh sfsowofh
sfsowohf sfsohwfo sfsohwof sfsohfwo sfsohfow sfsohofw sfsohowf sfsofhwo sfsofhow sfsofwho sfsofwoh
sfsofowh sfsofohw sfsoohfw sfsoohwf sfsoofhw sfsoofwh sfsoowfh sfsoowhf sfshowfo sfshowof sfshofwo
sfshofow sfshoofw sfshoowf sfshwofo sfshwoof sfshwfoo sfshwfoo sfshwofo sfshwoof sfshfwoo sfshfwoo
sfshfowo sfshfoow sfshfoow sfshfowo sfshowfo sfshowof sfshofwo sfshofow sfshoofw sfshoowf sfsfohwo
sfsfohow sfsfowho sfsfowoh sfsfoowh sfsfoohw sfsfhowo sfsfhoow sfsfhwoo sfsfhwoo sfsfhowo sfsfhoow
sfsfwhoo sfsfwhoo sfsfwoho sfsfwooh sfsfwooh sfsfwoho sfsfohwo sfsfohow sfsfowho sfsfowoh sfsfoowh
sfsfoohw sfsoohfw sfsoohwf sfsoofhw sfsoofwh sfsoowfh sfsoowhf sfsohofw sfsohowf sfsohfow sfsohfwo
sfsohwfo sfsohwof sfsofhow sfsofhwo sfsofohw sfsofowh sfsofwoh sfsofwho sfsowhfo sfsowhof sfsowfho
sfsowfoh sfsowofh sfsowohf sfowofhs sfowofsh sfowohfs sfowohsf sfowoshf sfowosfh sfowfohs sfowfosh
sfowfhos sfowfhso sfowfsho sfowfsoh sfowhfos sfowhfso sfowhofs sfowhosf sfowhsof sfowhsfo sfowsfho
sfowsfoh sfowshfo sfowshof sfowsohf sfowsofh sfoowfhs sfoowfsh sfoowhfs sfoowhsf sfoowshf sfoowsfh
sfoofwhs sfoofwsh sfoofhws sfoofhsw sfoofshw sfoofswh sfoohfws sfoohfsw sfoohwfs sfoohwsf sfoohswf
sfoohsfw sfoosfhw sfoosfwh sfooshfw sfooshwf sfooswhf sfooswfh sfofowhs sfofowsh sfofohws sfofohsw
sfofoshw sfofoswh sfofwohs sfofwosh sfofwhos sfofwhso sfofwsho sfofwsoh sfofhwos sfofhwso sfofhows
sfofhosw sfofhsow sfofhswo sfofswho sfofswoh sfofshwo sfofshow sfofsohw sfofsowh sfohofws sfohofsw
sfohowfs sfohowsf sfohoswf sfohosfw sfohfows sfohfosw sfohfwos sfohfwso sfohfswo sfohfsow sfohwfos
sfohwfso sfohwofs sfohwosf sfohwsof sfohwsfo sfohsfwo sfohsfow sfohswfo sfohswof sfohsowf sfohsofw
sfosofhw sfosofwh sfosohfw sfosohwf sfosowhf sfosowfh sfosfohw sfosfowh sfosfhow sfosfhwo sfosfwho
sfosfwoh sfoshfow sfoshfwo sfoshofw sfoshowf sfoshwof sfoshwfo sfoswfho sfoswfoh sfoswhfo sfoswhof
sfoswohf sfoswofh sfwoofhs sfwoofsh sfwoohfs sfwoohsf sfwooshf sfwoosfh sfwofohs sfwofosh sfwofhos
sfwofhso sfwofsho sfwofsoh sfwohfos sfwohfso sfwohofs sfwohosf sfwohsof sfwohsfo sfwosfho sfwosfoh
sfwoshfo sfwoshof sfwosohf sfwosofh sfwoofhs sfwoofsh sfwoohfs sfwoohsf sfwooshf sfwoosfh sfwofohs
sfwofosh sfwofhos sfwofhso sfwofsho sfwofsoh sfwohfos sfwohfso sfwohofs sfwohosf sfwohsof sfwohsfo
sfwosfho sfwosfoh sfwoshfo sfwoshof sfwosohf sfwosofh sfwfoohs sfwfoosh sfwfohos sfwfohso sfwfosho
sfwfosoh sfwfoohs sfwfoosh sfwfohos sfwfohso sfwfosho sfwfosoh sfwfhoos sfwfhoso sfwfhoos sfwfhoso
sfwfhsoo sfwfhsoo sfwfsoho sfwfsooh sfwfshoo sfwfshoo sfwfsoho sfwfsooh sfwhofos sfwhofso sfwhoofs
sfwhoosf sfwhosof sfwhosfo sfwhfoos sfwhfoso sfwhfoos sfwhfoso sfwhfsoo sfwhfsoo sfwhofos sfwhofso
sfwhoofs sfwhoosf sfwhosof sfwhosfo sfwhsfoo sfwhsfoo sfwhsofo sfwhsoof sfwhsoof sfwhsofo sfwsofho
sfwsofoh sfwsohfo sfwsohof sfwsoohf sfwsoofh sfwsfoho sfwsfooh sfwsfhoo sfwsfhoo sfwsfoho sfwsfooh
sfwshfoo sfwshfoo sfwshofo sfwshoof sfwshoof sfwshofo sfwsofho sfwsofoh sfwsohfo sfwsohof sfwsoohf
sfwsoofh sfowofhs sfowofsh sfowohfs sfowohsf sfowoshf sfowosfh sfowfohs sfowfosh sfowfhos sfowfhso
sfowfsho sfowfsoh sfowhfos sfowhfso sfowhofs sfowhosf sfowhsof sfowhsfo sfowsfho sfowsfoh sfowshfo
sfowshof sfowsohf sfowsofh sfoowfhs sfoowfsh sfoowhfs sfoowhsf sfoowshf sfoowsfh sfoofwhs sfoofwsh
sfoofhws sfoofhsw sfoofshw sfoofswh sfoohfws sfoohfsw sfoohwfs sfoohwsf sfoohswf sfoohsfw sfoosfhw
sfoosfwh sfooshfw sfooshwf sfooswhf sfooswfh sfofowhs sfofowsh sfofohws sfofohsw sfofoshw sfofoswh
sfofwohs sfofwosh sfofwhos sfofwhso sfofwsho sfofwsoh sfofhwos sfofhwso sfofhows sfofhosw sfofhsow
sfofhswo sfofswho sfofswoh sfofshwo sfofshow sfofsohw sfofsowh sfohofws sfohofsw sfohowfs sfohowsf
sfohoswf sfohosfw sfohfows sfohfosw sfohfwos sfohfwso sfohfswo sfohfsow sfohwfos sfohwfso sfohwofs
sfohwosf sfohwsof sfohwsfo sfohsfwo sfohsfow sfohswfo sfohswof sfohsowf sfohsofw sfosofhw sfosofwh
sfosohfw sfosohwf sfosowhf sfosowfh sfosfohw sfosfowh sfosfhow sfosfhwo sfosfwho sfosfwoh sfoshfow
sfoshfwo sfoshofw sfoshowf sfoshwof sfoshwfo sfoswfho sfoswfoh sfoswhfo sfoswhof sfoswohf sfoswofh
sffwoohs sffwoosh sffwohos sffwohso sffwosho sffwosoh sffwoohs sffwoosh sffwohos sffwohso sffwosho
sffwosoh sffwhoos sffwhoso sffwhoos sffwhoso sffwhsoo sffwhsoo sffwsoho sffwsooh sffwshoo sffwshoo
sffwsoho sffwsooh sffowohs sffowosh sffowhos sffowhso sffowsho sffowsoh sffoowhs sffoowsh sffoohws
sffoohsw sffooshw sffooswh sffohows sffohosw sffohwos sffohwso sffohswo sffohsow sffosohw sffosowh
sffoshow sffoshwo sffoswho sffoswoh sffoowhs sffoowsh sffoohws sffoohsw sffooshw sffooswh sffowohs
sffowosh sffowhos sffowhso sffowsho sffowsoh sffohwos sffohwso sffohows sffohosw sffohsow sffohswo
sffoswho sffoswoh sffoshwo sffoshow sffosohw sffosowh sffhoows sffhoosw sffhowos sffhowso sffhoswo
sffhosow sffhoows sffhoosw sffhowos sffhowso sffhoswo sffhosow sffhwoos sffhwoso sffhwoos sffhwoso
sffhwsoo sffhwsoo sffhsowo sffhsoow sffhswoo sffhswoo sffhsowo sffhsoow sffsoohw sffsoowh sffsohow
sffsohwo sffsowho sffsowoh sffsoohw sffsoowh sffsohow sffsohwo sffsowho sffsowoh sffshoow sffshowo
sffshoow sffshowo sffshwoo sffshwoo sffswoho sffswooh sffswhoo sffswhoo sffswoho sffswooh sfhwofos
sfhwofso sfhwoofs sfhwoosf sfhwosof sfhwosfo sfhwfoos sfhwfoso sfhwfoos sfhwfoso sfhwfsoo sfhwfsoo
sfhwofos sfhwofso sfhwoofs sfhwoosf sfhwosof sfhwosfo sfhwsfoo sfhwsfoo sfhwsofo sfhwsoof sfhwsoof
sfhwsofo sfhowfos sfhowfso sfhowofs sfhowosf sfhowsof sfhowsfo sfhofwos sfhofwso sfhofows sfhofosw
sfhofsow sfhofswo sfhoofws sfhoofsw sfhoowfs sfhoowsf sfhooswf sfhoosfw sfhosfow sfhosfwo sfhosofw
sfhosowf sfhoswof sfhoswfo sfhfowos sfhfowso sfhfoows sfhfoosw sfhfosow sfhfoswo sfhfwoos sfhfwoso
sfhfwoos sfhfwoso sfhfwsoo sfhfwsoo sfhfowos sfhfowso sfhfoows sfhfoosw sfhfosow sfhfoswo sfhfswoo
sfhfswoo sfhfsowo sfhfsoow sfhfsoow sfhfsowo sfhoofws sfhoofsw sfhoowfs sfhoowsf sfhooswf sfhoosfw
sfhofows sfhofosw sfhofwos sfhofwso sfhofswo sfhofsow sfhowfos sfhowfso sfhowofs sfhowosf sfhowsof
sfhowsfo sfhosfwo sfhosfow sfhoswfo sfhoswof sfhosowf sfhosofw sfhsofow sfhsofwo sfhsoofw sfhsoowf
sfhsowof sfhsowfo sfhsfoow sfhsfowo sfhsfoow sfhsfowo sfhsfwoo sfhsfwoo sfhsofow sfhsofwo sfhsoofw
sfhsoowf sfhsowof sfhsowfo sfhswfoo sfhswfoo sfhswofo sfhswoof sfhswoof sfhswofo sfswofho sfswofoh
sfswohfo sfswohof sfswoohf sfswoofh sfswfoho sfswfooh sfswfhoo sfswfhoo sfswfoho sfswfooh sfswhfoo
sfswhfoo sfswhofo sfswhoof sfswhoof sfswhofo sfswofho sfswofoh sfswohfo sfswohof sfswoohf sfswoofh
sfsowfho sfsowfoh sfsowhfo sfsowhof sfsowohf sfsowofh sfsofwho sfsofwoh sfsofhwo sfsofhow sfsofohw
sfsofowh sfsohfwo sfsohfow sfsohwfo sfsohwof sfsohowf sfsohofw sfsoofhw sfsoofwh sfsoohfw sfsoohwf
sfsoowhf sfsoowfh sfsfowho sfsfowoh sfsfohwo sfsfohow sfsfoohw sfsfoowh sfsfwoho sfsfwooh sfsfwhoo
sfsfwhoo sfsfwoho sfsfwooh sfsfhwoo sfsfhwoo sfsfhowo sfsfhoow sfsfhoow sfsfhowo sfsfowho sfsfowoh
sfsfohwo sfsfohow sfsfoohw sfsfoowh sfshofwo sfshofow sfshowfo sfshowof sfshoowf sfshoofw sfshfowo
sfshfoow sfshfwoo sfshfwoo sfshfowo sfshfoow sfshwfoo sfshwfoo sfshwofo sfshwoof sfshwoof sfshwofo
sfshofwo sfshofow sfshowfo sfshowof sfshoowf sfshoofw sfsoofhw sfsoofwh sfsoohfw sfsoohwf sfsoowhf
sfsoowfh sfsofohw sfsofowh sfsofhow sfsofhwo sfsofwho sfsofwoh sfsohfow sfsohfwo sfsohofw sfsohowf
sfsohwof sfsohwfo sfsowfho sfsowfoh sfsowhfo sfsowhof sfsowohf sfsowofh ssowoffh ssowofhf ssowoffh
ssowofhf ssowohff ssowohff ssowfofh ssowfohf ssowffoh ssowffho ssowfhfo ssowfhof ssowffoh ssowffho
ssowfofh ssowfohf ssowfhof ssowfhfo ssowhffo ssowhfof ssowhffo ssowhfof ssowhoff ssowhoff ssoowffh
ssoowfhf ssoowffh ssoowfhf ssoowhff ssoowhff ssoofwfh ssoofwhf ssooffwh ssooffhw ssoofhfw ssoofhwf
ssooffwh ssooffhw ssoofwfh ssoofwhf ssoofhwf ssoofhfw ssoohffw ssoohfwf ssoohffw ssoohfwf ssoohwff
ssoohwff ssofowfh ssofowhf ssofofwh ssofofhw ssofohfw ssofohwf ssofwofh ssofwohf ssofwfoh ssofwfho
ssofwhfo ssofwhof ssoffwoh ssoffwho ssoffowh ssoffohw ssoffhow ssoffhwo ssofhwfo ssofhwof ssofhfwo
ssofhfow ssofhofw ssofhowf ssofofwh ssofofhw ssofowfh ssofowhf ssofohwf ssofohfw ssoffowh ssoffohw
ssoffwoh ssoffwho ssoffhwo ssoffhow ssofwfoh ssofwfho ssofwofh ssofwohf ssofwhof ssofwhfo ssofhfwo
ssofhfow ssofhwfo ssofhwof ssofhowf ssofhofw ssohoffw ssohofwf ssohoffw ssohofwf ssohowff ssohowff
ssohfofw ssohfowf ssohffow ssohffwo ssohfwfo ssohfwof ssohffow ssohffwo ssohfofw ssohfowf ssohfwof
ssohfwfo ssohwffo ssohwfof ssohwffo ssohwfof ssohwoff ssohwoff sswooffh sswoofhf sswooffh sswoofhf
sswoohff sswoohff sswofofh sswofohf sswoffoh sswoffho sswofhfo sswofhof sswoffoh sswoffho sswofofh
sswofohf sswofhof sswofhfo sswohffo sswohfof sswohffo sswohfof sswohoff sswohoff sswooffh sswoofhf
sswooffh sswoofhf sswoohff sswoohff sswofofh sswofohf sswoffoh sswoffho sswofhfo sswofhof sswoffoh
sswoffho sswofofh sswofohf sswofhof sswofhfo sswohffo sswohfof sswohffo sswohfof sswohoff sswohoff
sswfoofh sswfoohf sswfofoh sswfofho sswfohfo sswfohof sswfoofh sswfoohf sswfofoh sswfofho sswfohfo
sswfohof sswffooh sswffoho sswffooh sswffoho sswffhoo sswffhoo sswfhofo sswfhoof sswfhfoo sswfhfoo
sswfhofo sswfhoof sswfofoh sswfofho sswfoofh sswfoohf sswfohof sswfohfo sswffooh sswffoho sswffooh
sswffoho sswffhoo sswffhoo sswfofoh sswfofho sswfoofh sswfoohf sswfohof sswfohfo sswfhfoo sswfhfoo
sswfhofo sswfhoof sswfhoof sswfhofo sswhoffo sswhofof sswhoffo sswhofof sswhooff sswhooff sswhfofo
sswhfoof sswhffoo sswhffoo sswhfofo sswhfoof sswhffoo sswhffoo sswhfofo sswhfoof sswhfoof sswhfofo
sswhoffo sswhofof sswhoffo sswhofof sswhooff sswhooff ssowoffh ssowofhf ssowoffh ssowofhf ssowohff
ssowohff ssowfofh ssowfohf ssowffoh ssowffho ssowfhfo ssowfhof ssowffoh ssowffho ssowfofh ssowfohf
ssowfhof ssowfhfo ssowhffo ssowhfof ssowhffo ssowhfof ssowhoff ssowhoff ssoowffh ssoowfhf ssoowffh
ssoowfhf ssoowhff ssoowhff ssoofwfh ssoofwhf ssooffwh ssooffhw ssoofhfw ssoofhwf ssooffwh ssooffhw
ssoofwfh ssoofwhf ssoofhwf ssoofhfw ssoohffw ssoohfwf ssoohffw ssoohfwf ssoohwff ssoohwff ssofowfh
ssofowhf ssofofwh ssofofhw ssofohfw ssofohwf ssofwofh ssofwohf ssofwfoh ssofwfho ssofwhfo ssofwhof
ssoffwoh ssoffwho ssoffowh ssoffohw ssoffhow ssoffhwo ssofhwfo ssofhwof ssofhfwo ssofhfow ssofhofw
ssofhowf ssofofwh ssofofhw ssofowfh ssofowhf ssofohwf ssofohfw ssoffowh ssoffohw ssoffwoh ssoffwho
ssoffhwo ssoffhow ssofwfoh ssofwfho ssofwofh ssofwohf ssofwhof ssofwhfo ssofhfwo ssofhfow ssofhwfo
ssofhwof ssofhowf ssofhofw ssohoffw ssohofwf ssohoffw ssohofwf ssohowff ssohowff ssohfofw ssohfowf
ssohffow ssohffwo ssohfwfo ssohfwof ssohffow ssohffwo ssohfofw ssohfowf ssohfwof ssohfwfo ssohwffo
ssohwfof ssohwffo ssohwfof ssohwoff ssohwoff ssfwoofh ssfwoohf ssfwofoh ssfwofho ssfwohfo ssfwohof
ssfwoofh ssfwoohf ssfwofoh ssfwofho ssfwohfo ssfwohof ssfwfooh ssfwfoho ssfwfooh ssfwfoho ssfwfhoo
ssfwfhoo ssfwhofo ssfwhoof ssfwhfoo ssfwhfoo ssfwhofo ssfwhoof ssfowofh ssfowohf ssfowfoh ssfowfho
ssfowhfo ssfowhof ssfoowfh ssfoowhf ssfoofwh ssfoofhw ssfoohfw ssfoohwf ssfofowh ssfofohw ssfofwoh
ssfofwho ssfofhwo ssfofhow ssfohofw ssfohowf ssfohfow ssfohfwo ssfohwfo ssfohwof ssfoowfh ssfoowhf
ssfoofwh ssfoofhw ssfoohfw ssfoohwf ssfowofh ssfowohf ssfowfoh ssfowfho ssfowhfo ssfowhof ssfofwoh
ssfofwho ssfofowh ssfofohw ssfofhow ssfofhwo ssfohwfo ssfohwof ssfohfwo ssfohfow ssfohofw ssfohowf
ssffoowh ssffoohw ssffowoh ssffowho ssffohwo ssffohow ssffoowh ssffoohw ssffowoh ssffowho ssffohwo
ssffohow ssffwooh ssffwoho ssffwooh ssffwoho ssffwhoo ssffwhoo ssffhowo ssffhoow ssffhwoo ssffhwoo
ssffhowo ssffhoow ssfhoofw ssfhoowf ssfhofow ssfhofwo ssfhowfo ssfhowof ssfhoofw ssfhoowf ssfhofow
ssfhofwo ssfhowfo ssfhowof ssfhfoow ssfhfowo ssfhfoow ssfhfowo ssfhfwoo ssfhfwoo ssfhwofo ssfhwoof
ssfhwfoo ssfhwfoo ssfhwofo ssfhwoof ssfwofoh ssfwofho ssfwoofh ssfwoohf ssfwohof ssfwohfo ssfwfooh
ssfwfoho ssfwfooh ssfwfoho ssfwfhoo ssfwfhoo ssfwofoh ssfwofho ssfwoofh ssfwoohf ssfwohof ssfwohfo
ssfwhfoo ssfwhfoo ssfwhofo ssfwhoof ssfwhoof ssfwhofo ssfowfoh ssfowfho ssfowofh ssfowohf ssfowhof
ssfowhfo ssfofwoh ssfofwho ssfofowh ssfofohw ssfofhow ssfofhwo ssfoofwh ssfoofhw ssfoowfh ssfoowhf
ssfoohwf ssfoohfw ssfohfow ssfohfwo ssfohofw ssfohowf ssfohwof ssfohwfo ssffowoh ssffowho ssffoowh
ssffoohw ssffohow ssffohwo ssffwooh ssffwoho ssffwooh ssffwoho ssffwhoo ssffwhoo ssffowoh ssffowho
ssffoowh ssffoohw ssffohow ssffohwo ssffhwoo ssffhwoo ssffhowo ssffhoow ssffhoow ssffhowo ssfoofwh
ssfoofhw ssfoowfh ssfoowhf ssfoohwf ssfoohfw ssfofowh ssfofohw ssfofwoh ssfofwho ssfofhwo ssfofhow
ssfowfoh ssfowfho ssfowofh ssfowohf ssfowhof ssfowhfo ssfohfwo ssfohfow ssfohwfo ssfohwof ssfohowf
ssfohofw ssfhofow ssfhofwo ssfhoofw ssfhoowf ssfhowof ssfhowfo ssfhfoow ssfhfowo ssfhfoow ssfhfowo
ssfhfwoo ssfhfwoo ssfhofow ssfhofwo ssfhoofw ssfhoowf ssfhowof ssfhowfo ssfhwfoo ssfhwfoo ssfhwofo
ssfhwoof ssfhwoof ssfhwofo sshwoffo sshwofof sshwoffo sshwofof sshwooff sshwooff sshwfofo sshwfoof
sshwffoo sshwffoo sshwfofo sshwfoof sshwffoo sshwffoo sshwfofo sshwfoof sshwfoof sshwfofo sshwoffo
sshwofof sshwoffo sshwofof sshwooff sshwooff sshowffo sshowfof sshowffo sshowfof sshowoff sshowoff
sshofwfo sshofwof sshoffwo sshoffow sshofofw sshofowf sshoffwo sshoffow sshofwfo sshofwof sshofowf
sshofofw sshooffw sshoofwf sshooffw sshoofwf sshoowff sshoowff sshfowfo sshfowof sshfofwo sshfofow
sshfoofw sshfoowf sshfwofo sshfwoof sshfwfoo sshfwfoo sshfwofo sshfwoof sshffwoo sshffwoo sshffowo
sshffoow sshffoow sshffowo sshfowfo sshfowof sshfofwo sshfofow sshfoofw sshfoowf sshfofwo sshfofow
sshfowfo sshfowof sshfoowf sshfoofw sshffowo sshffoow sshffwoo sshffwoo sshffowo sshffoow sshfwfoo
sshfwfoo sshfwofo sshfwoof sshfwoof sshfwofo sshfofwo sshfofow sshfowfo sshfowof sshfoowf sshfoofw
sshooffw sshoofwf sshooffw sshoofwf sshoowff sshoowff sshofofw sshofowf sshoffow sshoffwo sshofwfo
sshofwof sshoffow sshoffwo sshofofw sshofowf sshofwof sshofwfo sshowffo sshowfof sshowffo sshowfof
sshowoff sshowoff

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us