easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

semioxygenated

uerbenaque

cristi

hittable

unfit

wilbon

temiak

uisibus

thairms

wracker

retightened

sweetgrass

bradenton

protogalaxy

craner

creeminique

untestable

orchidopexy


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: seruitioque
cipher variations:
tfsvjujprvf ugtwkvkqswg vhuxlwlrtxh wivymxmsuyi xjwznyntvzj
ykxaozouwak zlybpapvxbl amzcqbqwycm bnadrcrxzdn cobesdsyaeo
dpcftetzbfp eqdgufuacgq frehvgvbdhr gsfiwhwceis htgjxixdfjt
iuhkyjyegku jvilzkzfhlv kwjmalagimw lxknbmbhjnx mylocncikoy
nzmpdodjlpz oanqepekmqa pborfqflnrb qcpsgrgmosc rdqthshnptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: seruitioque
Cipher: hvifrgrljfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: seruitioque
Cipher: BAAAB AABAA BAAAA BAABB ABAAA BAABA ABAAA ABBAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: seruitioque
cipher variations:
tfsvjujprvfdnajzgzrxjnnvixpsptdxvxdqlfefvjldhlyzvqvxpzlrtgnlclzvntljwprardhpjvredhmhfndr
fzmrxyxhtrzphufnknjzfhzpctdwdlftpjxkhtitnlhxugtwkvkqswgeobkahasykoowjyqtqueywyermgfgwkme
imzawrwyqamsuhomdmawoumkxqsbseiqkwsfeinigoesgansyzyiusaqivgolokagiaqduexemguqkyliujuomiy
vhuxlwlrtxhfpclbibtzlppxkzrurvfzxzfsnhghxlnfjnabxsxzrbntvipnenbxpvnlyrtctfjrlxtgfjojhpft
hbotzazjvtbrjwhpmplbhjbrevfyfnhvrlzmjvkvpnjzwivymxmsuyigqdmcjcuamqqylasvswgayagtoihiymog
kobcytyascouwjqofocyqwomzsudugksmyuhgkpkiqguicpuabakwucskxiqnqmcikcsfwgzgoiwsmankwlwqoka
xjwznyntvzjhrendkdvbnrrzmbtwtxhbzbhupjijznphlpcdzuzbtdpvxkrpgpdzrxpnatvevhltnzvihlqljrhv
jdqvbcblxvdtlyjrorndjldtgxhahpjxtnbolxmxrplbykxaozouwakisfoelewcossancuxuyicacivqkjkaoqi
mqdeavacueqwylsqhqeasyqobuwfwimuoawjimrmksiwkerwcdcmyweumzkspsoekmeuhyibiqkyuocpmynysqmc
zlybpapvxbljtgpfmfxdpttbodvyvzjdbdjwrlklbprjnrefbwbdvfrxzmtrirfbtzrpcvxgxjnvpbxkjnsnltjx
lfsxdednzxfvnaltqtpflnfvizjcjrlzvpdqnzoztrndamzcqbqwycmkuhqgngyequucpewzwakecekxsmlmcqsk
osfgcxcewgsyanusjsgcuasqdwyhykowqcylkotomukymgtyefeoaygwobmuruqgmogwjakdksmawqeroapausoe
bnadrcrxzdnlvirhohzfrvvdqfxaxblfdflytnmndrtlptghdydfxhtzbovtkthdvbtrexzizlpxrdzmlpupnvlz
nhuzfgfpbzhxpcnvsvrhnphxkbleltnbxrfspbqbvtpfcobesdsyaeomwjsipiagswwergybycmgegmzuonoesum
quhiezegyiuacpwuluiewcusfyajamqyseanmqvqowmaoivaghgqcaiyqdowtwsioqiylcmfmuocysgtqcrcwuqg
dpcftetzbfpnxktjqjbhtxxfshzczdnhfhnavpopftvnrvijfafhzjvbdqxvmvjfxdvtgzbkbnrztfbonrwrpxnb
pjwbhihrdbjzrepxuxtjprjzmdngnvpdzthurdsdxvrheqdgufuacgqoylukrkciuyygtiadaeoigiobwqpqguwo
swjkgbgiakwcerywnwkgyewuhaclcosaugcposxsqyocqkxcijiseckasfqyvyukqskaneohowqeauivseteywsi
frehvgvbdhrpzmvlsldjvzzhujbebfpjhjpcxrqrhvxptxklhchjblxdfszxoxlhzfxvibdmdptbvhdqptytrzpd
rlydjkjtfdlbtgrzwzvlrtlbofpipxrfbvjwtfufzxtjgsfiwhwceisqanwmtmekwaaivkcfcgqkikqdysrsiwyq
uylmidikcmyegtaypymiagywjcenequcwierquzusaqesmzeklkugemcuhsaxawmsumcpgqjqysgcwkxugvgayuk
htgjxixdfjtrboxnunflxbbjwldgdhrljlreztstjxzrvzmnjejldnzfhubzqznjbhzxkdfofrvdxjfsrvavtbrf
tnaflmlvhfndvitbybxntvndqhrkrzthdxlyvhwhbzvliuhkyjyegkuscpyovogmycckxmeheismkmsfautukyas
wanokfkmeoagivcaraokciaylegpgsweykgtswbwucsguobgmnmwigoewjuczcyouwoerislsauieymzwixicawm
jvilzkzfhlvtdqzpwphnzddlynfifjtnlntgbvuvlzbtxboplglnfpbhjwdbsbpldjbzmfhqhtxfzlhutxcxvdth
vpchnonxjhpfxkvdadzpvxpfsjtmtbvjfznaxjyjdbxnkwjmalagimwueraqxqioaeemzogjgkuomouhcwvwmacu
ycpqmhmogqcikxectcqmekcangiriuygamivuydyweuiwqdiopoykiqgylwebeaqwyqgtkunucwkgaobykzkecyo
lxknbmbhjnxvfsbryrjpbffnaphkhlvpnpvidxwxnbdvzdqrninphrdjlyfdudrnfldbohjsjvzhbnjwvzezxfvj
xrejpqpzljrhzmxfcfbrxzrhulvovdxlhbpczlalfdzpmylocncikoywgtcszskqcggobqilimwqoqwjeyxyocew
aersojoqisekmzgevesogmecpiktkwaicokxwafaygwkysfkqrqamksianygdgcsyasivmwpweymicqdambmgeaq
nzmpdodjlpzxhudtatlrdhhpcrjmjnxrprxkfzyzpdfxbfstpkprjtflnahfwftphnfdqjlulxbjdplyxbgbzhxl
ztglrsrbnltjbozhehdtzbtjwnxqxfznjdrebncnhfbroanqepekmqayiveubumseiiqdsknkoysqsylgazaqegy
cgtuqlqskugmobigxguqiogerkmvmyckeqmzychcaiymauhmstscomukcpaifieuacukxoyrygaokesfcodoigcs
pborfqflnrbzjwfvcvntfjjretlolpztrtzmhbabrfhzdhuvrmrtlvhnpcjhyhvrjphfslnwnzdlfrnazdidbjzn
bvintutdpnvldqbjgjfvbdvlypzszhbplftgdpepjhdtqcpsgrgmoscakxgwdwougkksfumpmqausuanicbcsgia
eivwsnsumwioqdkiziwskqigtmoxoaemgsobaejeckaocwjouvueqowmerckhkgwcewmzqataicqmguheqfqkieu
rdqthshnptdblyhxexpvhlltgvnqnrbvtvbojdcdthjbfjwxtotvnxjpreljajxtlrjhunpypbfnhtpcbfkfdlbp
dxkpvwvfrpxnfsdlilhxdfxnarbubjdrnhvifrgrljfvseruitioquecmziyfyqwimmuhworoscwuwcpkedeuikc
gkxyupuwoykqsfmkbkyumskivoqzqcgoiuqdcglgemcqeylqwxwgsqyogtemjmiyegyobscvckesoiwjgshsmkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: seruitioque
Cipher: frehvgvbdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: seruitioque
Cipher: 3451245442444243145451

Extended Methods:
Method #1

Plaintext: seruitioque
method variations:
xkwzoyotvzkcpbetdtyaephugkyiydfkunzmpdodilpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s e r u i t i o q u e 
3 5 2 5 4 4 4 4 1 5 5 
4 1 4 4 2 4 2 3 4 4 1 
They are then read out in rows:
3525444415541442423441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: seruitioque
Cipher: xwttvuqiisd

Read more ...
Method #3

Plaintext: seruitioque
method variations:
yfytrtrcyyl fytrtrcyyly ytrtrcyylyf
trtrcyylyfy rtrcyylyfyt trcyylyfytr
rcyylyfytrt cyylyfytrtr yylyfytrtrc
ylyfytrtrcy lyfytrtrcyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: seruitioque

first 5040 cipher variations(39615626 total)
seruitioque seruitioqeu seruitiouqe seruitioueq seruitioeuq seruitioequ seruitiqoue seruitiqoeu seruitiquoe seruitiqueo
seruitiqeuo seruitiqeou seruitiuqoe seruitiuqeo seruitiuoqe seruitiuoeq seruitiueoq seruitiueqo seruitiequo seruitieqou
seruitieuqo seruitieuoq seruitieouq seruitieoqu seruitoique seruitoiqeu seruitoiuqe seruitoiueq seruitoieuq seruitoiequ
seruitoqiue seruitoqieu seruitoquie seruitoquei seruitoqeui seruitoqeiu seruitouqie seruitouqei seruitouiqe seruitouieq
seruitoueiq seruitoueqi seruitoequi seruitoeqiu seruitoeuqi seruitoeuiq seruitoeiuq seruitoeiqu seruitqoiue seruitqoieu
seruitqouie seruitqouei seruitqoeui seruitqoeiu seruitqioue seruitqioeu seruitqiuoe seruitqiueo seruitqieuo seruitqieou
seruitquioe seruitquieo seruitquoie seruitquoei seruitqueoi seruitqueio seruitqeiuo seruitqeiou seruitqeuio seruitqeuoi
seruitqeoui seruitqeoiu seruituoqie seruituoqei seruituoiqe seruituoieq seruituoeiq seruituoeqi seruituqoie seruituqoei
seruituqioe seruituqieo seruituqeio seruituqeoi seruituiqoe seruituiqeo seruituioqe seruituioeq seruituieoq seruituieqo
seruitueqio seruitueqoi seruitueiqo seruitueioq seruitueoiq seruitueoqi seruiteoqui seruiteoqiu seruiteouqi seruiteouiq
seruiteoiuq seruiteoiqu seruiteqoui seruiteqoiu seruitequoi seruitequio seruiteqiuo seruiteqiou seruiteuqoi seruiteuqio
seruiteuoqi seruiteuoiq seruiteuioq seruiteuiqo seruiteiquo seruiteiqou seruiteiuqo seruiteiuoq seruiteiouq seruiteioqu
seruiitoque seruiitoqeu seruiitouqe seruiitoueq seruiitoeuq seruiitoequ seruiitqoue seruiitqoeu seruiitquoe seruiitqueo
seruiitqeuo seruiitqeou seruiituqoe seruiituqeo seruiituoqe seruiituoeq seruiitueoq seruiitueqo seruiitequo seruiiteqou
seruiiteuqo seruiiteuoq seruiiteouq seruiiteoqu seruiiotque seruiiotqeu seruiiotuqe seruiiotueq seruiioteuq seruiiotequ
seruiioqtue seruiioqteu seruiioqute seruiioquet seruiioqeut seruiioqetu seruiiouqte seruiiouqet seruiioutqe seruiiouteq
seruiiouetq seruiioueqt seruiioequt seruiioeqtu seruiioeuqt seruiioeutq seruiioetuq seruiioetqu seruiiqotue seruiiqoteu
seruiiqoute seruiiqouet seruiiqoeut seruiiqoetu seruiiqtoue seruiiqtoeu seruiiqtuoe seruiiqtueo seruiiqteuo seruiiqteou
seruiiqutoe seruiiquteo seruiiquote seruiiquoet seruiiqueot seruiiqueto seruiiqetuo seruiiqetou seruiiqeuto seruiiqeuot
seruiiqeout seruiiqeotu seruiiuoqte seruiiuoqet seruiiuotqe seruiiuoteq seruiiuoetq seruiiuoeqt seruiiuqote seruiiuqoet
seruiiuqtoe seruiiuqteo seruiiuqeto seruiiuqeot seruiiutqoe seruiiutqeo seruiiutoqe seruiiutoeq seruiiuteoq seruiiuteqo
seruiiueqto seruiiueqot seruiiuetqo seruiiuetoq seruiiueotq seruiiueoqt seruiieoqut seruiieoqtu seruiieouqt seruiieoutq
seruiieotuq seruiieotqu seruiieqout seruiieqotu seruiiequot seruiiequto seruiieqtuo seruiieqtou seruiieuqot seruiieuqto
seruiieuoqt seruiieuotq seruiieutoq seruiieutqo seruiietquo seruiietqou seruiietuqo seruiietuoq seruiietouq seruiietoqu
seruioitque seruioitqeu seruioituqe seruioitueq seruioiteuq seruioitequ seruioiqtue seruioiqteu seruioiqute seruioiquet
seruioiqeut seruioiqetu seruioiuqte seruioiuqet seruioiutqe seruioiuteq seruioiuetq seruioiueqt seruioiequt seruioieqtu
seruioieuqt seruioieutq seruioietuq seruioietqu seruiotique seruiotiqeu seruiotiuqe seruiotiueq seruiotieuq seruiotiequ
seruiotqiue seruiotqieu seruiotquie seruiotquei seruiotqeui seruiotqeiu seruiotuqie seruiotuqei seruiotuiqe seruiotuieq
seruiotueiq seruiotueqi seruiotequi seruioteqiu seruioteuqi seruioteuiq seruioteiuq seruioteiqu seruioqtiue seruioqtieu
seruioqtuie seruioqtuei seruioqteui seruioqteiu seruioqitue seruioqiteu seruioqiute seruioqiuet seruioqieut seruioqietu
seruioquite seruioquiet seruioqutie seruioqutei seruioqueti seruioqueit seruioqeiut seruioqeitu seruioqeuit seruioqeuti
seruioqetui seruioqetiu seruioutqie seruioutqei seruioutiqe seruioutieq seruiouteiq seruiouteqi seruiouqtie seruiouqtei
seruiouqite seruiouqiet seruiouqeit seruiouqeti seruiouiqte seruiouiqet seruiouitqe seruiouiteq seruiouietq seruiouieqt
seruioueqit seruioueqti seruioueiqt seruioueitq seruiouetiq seruiouetqi seruioetqui seruioetqiu seruioetuqi seruioetuiq
seruioetiuq seruioetiqu seruioeqtui seruioeqtiu seruioequti seruioequit seruioeqiut seruioeqitu seruioeuqti seruioeuqit
seruioeutqi seruioeutiq seruioeuitq seruioeuiqt seruioeiqut seruioeiqtu seruioeiuqt seruioeiutq seruioeituq seruioeitqu
seruiqiotue seruiqioteu seruiqioute seruiqiouet seruiqioeut seruiqioetu seruiqitoue seruiqitoeu seruiqituoe seruiqitueo
seruiqiteuo seruiqiteou seruiqiutoe seruiqiuteo seruiqiuote seruiqiuoet seruiqiueot seruiqiueto seruiqietuo seruiqietou
seruiqieuto seruiqieuot seruiqieout seruiqieotu seruiqoitue seruiqoiteu seruiqoiute seruiqoiuet seruiqoieut seruiqoietu
seruiqotiue seruiqotieu seruiqotuie seruiqotuei seruiqoteui seruiqoteiu seruiqoutie seruiqoutei seruiqouite seruiqouiet
seruiqoueit seruiqoueti seruiqoetui seruiqoetiu seruiqoeuti seruiqoeuit seruiqoeiut seruiqoeitu seruiqtoiue seruiqtoieu
seruiqtouie seruiqtouei seruiqtoeui seruiqtoeiu seruiqtioue seruiqtioeu seruiqtiuoe seruiqtiueo seruiqtieuo seruiqtieou
seruiqtuioe seruiqtuieo seruiqtuoie seruiqtuoei seruiqtueoi seruiqtueio seruiqteiuo seruiqteiou seruiqteuio seruiqteuoi
seruiqteoui seruiqteoiu seruiquotie seruiquotei seruiquoite seruiquoiet seruiquoeit seruiquoeti seruiqutoie seruiqutoei
seruiqutioe seruiqutieo seruiquteio seruiquteoi seruiquitoe seruiquiteo seruiquiote seruiquioet seruiquieot seruiquieto
seruiquetio seruiquetoi seruiqueito seruiqueiot seruiqueoit seruiqueoti seruiqeotui seruiqeotiu seruiqeouti seruiqeouit
seruiqeoiut seruiqeoitu seruiqetoui seruiqetoiu seruiqetuoi seruiqetuio seruiqetiuo seruiqetiou seruiqeutoi seruiqeutio
seruiqeuoti seruiqeuoit seruiqeuiot seruiqeuito seruiqeituo seruiqeitou seruiqeiuto seruiqeiuot seruiqeiout seruiqeiotu
seruiuioqte seruiuioqet seruiuiotqe seruiuioteq seruiuioetq seruiuioeqt seruiuiqote seruiuiqoet seruiuiqtoe seruiuiqteo
seruiuiqeto seruiuiqeot seruiuitqoe seruiuitqeo seruiuitoqe seruiuitoeq seruiuiteoq seruiuiteqo seruiuieqto seruiuieqot
seruiuietqo seruiuietoq seruiuieotq seruiuieoqt seruiuoiqte seruiuoiqet seruiuoitqe seruiuoiteq seruiuoietq seruiuoieqt
seruiuoqite seruiuoqiet seruiuoqtie seruiuoqtei seruiuoqeti seruiuoqeit seruiuotqie seruiuotqei seruiuotiqe seruiuotieq
seruiuoteiq seruiuoteqi seruiuoeqti seruiuoeqit seruiuoetqi seruiuoetiq seruiuoeitq seruiuoeiqt seruiuqoite seruiuqoiet
seruiuqotie seruiuqotei seruiuqoeti seruiuqoeit seruiuqiote seruiuqioet seruiuqitoe seruiuqiteo seruiuqieto seruiuqieot
seruiuqtioe seruiuqtieo seruiuqtoie seruiuqtoei seruiuqteoi seruiuqteio seruiuqeito seruiuqeiot seruiuqetio seruiuqetoi
seruiuqeoti seruiuqeoit seruiutoqie seruiutoqei seruiutoiqe seruiutoieq seruiutoeiq seruiutoeqi seruiutqoie seruiutqoei
seruiutqioe seruiutqieo seruiutqeio seruiutqeoi seruiutiqoe seruiutiqeo seruiutioqe seruiutioeq seruiutieoq seruiutieqo
seruiuteqio seruiuteqoi seruiuteiqo seruiuteioq seruiuteoiq seruiuteoqi seruiueoqti seruiueoqit seruiueotqi seruiueotiq
seruiueoitq seruiueoiqt seruiueqoti seruiueqoit seruiueqtoi seruiueqtio seruiueqito seruiueqiot seruiuetqoi seruiuetqio
seruiuetoqi seruiuetoiq seruiuetioq seruiuetiqo seruiueiqto seruiueiqot seruiueitqo seruiueitoq seruiueiotq seruiueioqt
seruieioqut seruieioqtu seruieiouqt seruieioutq seruieiotuq seruieiotqu seruieiqout seruieiqotu seruieiquot seruieiquto
seruieiqtuo seruieiqtou seruieiuqot seruieiuqto seruieiuoqt seruieiuotq seruieiutoq seruieiutqo seruieitquo seruieitqou
seruieituqo seruieituoq seruieitouq seruieitoqu seruieoiqut seruieoiqtu seruieoiuqt seruieoiutq seruieoituq seruieoitqu
seruieoqiut seruieoqitu seruieoquit seruieoquti seruieoqtui seruieoqtiu seruieouqit seruieouqti seruieouiqt seruieouitq
seruieoutiq seruieoutqi seruieotqui seruieotqiu seruieotuqi seruieotuiq seruieotiuq seruieotiqu seruieqoiut seruieqoitu
seruieqouit seruieqouti seruieqotui seruieqotiu seruieqiout seruieqiotu seruieqiuot seruieqiuto seruieqituo seruieqitou
seruiequiot seruiequito seruiequoit seruiequoti seruiequtoi seruiequtio seruieqtiuo seruieqtiou seruieqtuio seruieqtuoi
seruieqtoui seruieqtoiu seruieuoqit seruieuoqti seruieuoiqt seruieuoitq seruieuotiq seruieuotqi seruieuqoit seruieuqoti
seruieuqiot seruieuqito seruieuqtio seruieuqtoi seruieuiqot seruieuiqto seruieuioqt seruieuiotq seruieuitoq seruieuitqo
seruieutqio seruieutqoi seruieutiqo seruieutioq seruieutoiq seruieutoqi seruietoqui seruietoqiu seruietouqi seruietouiq
seruietoiuq seruietoiqu seruietqoui seruietqoiu seruietquoi seruietquio seruietqiuo seruietqiou seruietuqoi seruietuqio
seruietuoqi seruietuoiq seruietuioq seruietuiqo seruietiquo seruietiqou seruietiuqo seruietiuoq seruietiouq seruietioqu
serutiioque serutiioqeu serutiiouqe serutiioueq serutiioeuq serutiioequ serutiiqoue serutiiqoeu serutiiquoe serutiiqueo
serutiiqeuo serutiiqeou serutiiuqoe serutiiuqeo serutiiuoqe serutiiuoeq serutiiueoq serutiiueqo serutiiequo serutiieqou
serutiieuqo serutiieuoq serutiieouq serutiieoqu serutioique serutioiqeu serutioiuqe serutioiueq serutioieuq serutioiequ
serutioqiue serutioqieu serutioquie serutioquei serutioqeui serutioqeiu serutiouqie serutiouqei serutiouiqe serutiouieq
serutioueiq serutioueqi serutioequi serutioeqiu serutioeuqi serutioeuiq serutioeiuq serutioeiqu serutiqoiue serutiqoieu
serutiqouie serutiqouei serutiqoeui serutiqoeiu serutiqioue serutiqioeu serutiqiuoe serutiqiueo serutiqieuo serutiqieou
serutiquioe serutiquieo serutiquoie serutiquoei serutiqueoi serutiqueio serutiqeiuo serutiqeiou serutiqeuio serutiqeuoi
serutiqeoui serutiqeoiu serutiuoqie serutiuoqei serutiuoiqe serutiuoieq serutiuoeiq serutiuoeqi serutiuqoie serutiuqoei
serutiuqioe serutiuqieo serutiuqeio serutiuqeoi serutiuiqoe serutiuiqeo serutiuioqe serutiuioeq serutiuieoq serutiuieqo
serutiueqio serutiueqoi serutiueiqo serutiueioq serutiueoiq serutiueoqi serutieoqui serutieoqiu serutieouqi serutieouiq
serutieoiuq serutieoiqu serutieqoui serutieqoiu serutiequoi serutiequio serutieqiuo serutieqiou serutieuqoi serutieuqio
serutieuoqi serutieuoiq serutieuioq serutieuiqo serutieiquo serutieiqou serutieiuqo serutieiuoq serutieiouq serutieioqu
serutiioque serutiioqeu serutiiouqe serutiioueq serutiioeuq serutiioequ serutiiqoue serutiiqoeu serutiiquoe serutiiqueo
serutiiqeuo serutiiqeou serutiiuqoe serutiiuqeo serutiiuoqe serutiiuoeq serutiiueoq serutiiueqo serutiiequo serutiieqou
serutiieuqo serutiieuoq serutiieouq serutiieoqu serutioique serutioiqeu serutioiuqe serutioiueq serutioieuq serutioiequ
serutioqiue serutioqieu serutioquie serutioquei serutioqeui serutioqeiu serutiouqie serutiouqei serutiouiqe serutiouieq
serutioueiq serutioueqi serutioequi serutioeqiu serutioeuqi serutioeuiq serutioeiuq serutioeiqu serutiqoiue serutiqoieu
serutiqouie serutiqouei serutiqoeui serutiqoeiu serutiqioue serutiqioeu serutiqiuoe serutiqiueo serutiqieuo serutiqieou
serutiquioe serutiquieo serutiquoie serutiquoei serutiqueoi serutiqueio serutiqeiuo serutiqeiou serutiqeuio serutiqeuoi
serutiqeoui serutiqeoiu serutiuoqie serutiuoqei serutiuoiqe serutiuoieq serutiuoeiq serutiuoeqi serutiuqoie serutiuqoei
serutiuqioe serutiuqieo serutiuqeio serutiuqeoi serutiuiqoe serutiuiqeo serutiuioqe serutiuioeq serutiuieoq serutiuieqo
serutiueqio serutiueqoi serutiueiqo serutiueioq serutiueoiq serutiueoqi serutieoqui serutieoqiu serutieouqi serutieouiq
serutieoiuq serutieoiqu serutieqoui serutieqoiu serutiequoi serutiequio serutieqiuo serutieqiou serutieuqoi serutieuqio
serutieuoqi serutieuoiq serutieuioq serutieuiqo serutieiquo serutieiqou serutieiuqo serutieiuoq serutieiouq serutieioqu
serutoiique serutoiiqeu serutoiiuqe serutoiiueq serutoiieuq serutoiiequ serutoiqiue serutoiqieu serutoiquie serutoiquei
serutoiqeui serutoiqeiu serutoiuqie serutoiuqei serutoiuiqe serutoiuieq serutoiueiq serutoiueqi serutoiequi serutoieqiu
serutoieuqi serutoieuiq serutoieiuq serutoieiqu serutoiique serutoiiqeu serutoiiuqe serutoiiueq serutoiieuq serutoiiequ
serutoiqiue serutoiqieu serutoiquie serutoiquei serutoiqeui serutoiqeiu serutoiuqie serutoiuqei serutoiuiqe serutoiuieq
serutoiueiq serutoiueqi serutoiequi serutoieqiu serutoieuqi serutoieuiq serutoieiuq serutoieiqu serutoqiiue serutoqiieu
serutoqiuie serutoqiuei serutoqieui serutoqieiu serutoqiiue serutoqiieu serutoqiuie serutoqiuei serutoqieui serutoqieiu
serutoquiie serutoquiei serutoquiie serutoquiei serutoqueii serutoqueii serutoqeiui serutoqeiiu serutoqeuii serutoqeuii
serutoqeiui serutoqeiiu serutouiqie serutouiqei serutouiiqe serutouiieq serutouieiq serutouieqi serutouqiie serutouqiei
serutouqiie serutouqiei serutouqeii serutouqeii serutouiqie serutouiqei serutouiiqe serutouiieq serutouieiq serutouieqi
serutoueqii serutoueqii serutoueiqi serutoueiiq serutoueiiq serutoueiqi serutoeiqui serutoeiqiu serutoeiuqi serutoeiuiq
serutoeiiuq serutoeiiqu serutoeqiui serutoeqiiu serutoequii serutoequii serutoeqiui serutoeqiiu serutoeuqii serutoeuqii
serutoeuiqi serutoeuiiq serutoeuiiq serutoeuiqi serutoeiqui serutoeiqiu serutoeiuqi serutoeiuiq serutoeiiuq serutoeiiqu
serutqioiue serutqioieu serutqiouie serutqiouei serutqioeui serutqioeiu serutqiioue serutqiioeu serutqiiuoe serutqiiueo
serutqiieuo serutqiieou serutqiuioe serutqiuieo serutqiuoie serutqiuoei serutqiueoi serutqiueio serutqieiuo serutqieiou
serutqieuio serutqieuoi serutqieoui serutqieoiu serutqoiiue serutqoiieu serutqoiuie serutqoiuei serutqoieui serutqoieiu
serutqoiiue serutqoiieu serutqoiuie serutqoiuei serutqoieui serutqoieiu serutqouiie serutqouiei serutqouiie serutqouiei
serutqoueii serutqoueii serutqoeiui serutqoeiiu serutqoeuii serutqoeuii serutqoeiui serutqoeiiu serutqioiue serutqioieu
serutqiouie serutqiouei serutqioeui serutqioeiu serutqiioue serutqiioeu serutqiiuoe serutqiiueo serutqiieuo serutqiieou
serutqiuioe serutqiuieo serutqiuoie serutqiuoei serutqiueoi serutqiueio serutqieiuo serutqieiou serutqieuio serutqieuoi
serutqieoui serutqieoiu serutquoiie serutquoiei serutquoiie serutquoiei serutquoeii serutquoeii serutquioie serutquioei
serutquiioe serutquiieo serutquieio serutquieoi serutquiioe serutquiieo serutquioie serutquioei serutquieoi serutquieio
serutqueiio serutqueioi serutqueiio serutqueioi serutqueoii serutqueoii serutqeoiui serutqeoiiu serutqeouii serutqeouii
serutqeoiui serutqeoiiu serutqeioui serutqeioiu serutqeiuoi serutqeiuio serutqeiiuo serutqeiiou serutqeuioi serutqeuiio
serutqeuoii serutqeuoii serutqeuioi serutqeuiio serutqeiiuo serutqeiiou serutqeiuio serutqeiuoi serutqeioui serutqeioiu
serutuioqie serutuioqei serutuioiqe serutuioieq serutuioeiq serutuioeqi serutuiqoie serutuiqoei serutuiqioe serutuiqieo
serutuiqeio serutuiqeoi serutuiiqoe serutuiiqeo serutuiioqe serutuiioeq serutuiieoq serutuiieqo serutuieqio serutuieqoi
serutuieiqo serutuieioq serutuieoiq serutuieoqi serutuoiqie serutuoiqei serutuoiiqe serutuoiieq serutuoieiq serutuoieqi
serutuoqiie serutuoqiei serutuoqiie serutuoqiei serutuoqeii serutuoqeii serutuoiqie serutuoiqei serutuoiiqe serutuoiieq
serutuoieiq serutuoieqi serutuoeqii serutuoeqii serutuoeiqi serutuoeiiq serutuoeiiq serutuoeiqi serutuqoiie serutuqoiei
serutuqoiie serutuqoiei serutuqoeii serutuqoeii serutuqioie serutuqioei serutuqiioe serutuqiieo serutuqieio serutuqieoi
serutuqiioe serutuqiieo serutuqioie serutuqioei serutuqieoi serutuqieio serutuqeiio serutuqeioi serutuqeiio serutuqeioi
serutuqeoii serutuqeoii serutuioqie serutuioqei serutuioiqe serutuioieq serutuioeiq serutuioeqi serutuiqoie serutuiqoei
serutuiqioe serutuiqieo serutuiqeio serutuiqeoi serutuiiqoe serutuiiqeo serutuiioqe serutuiioeq serutuiieoq serutuiieqo
serutuieqio serutuieqoi serutuieiqo serutuieioq serutuieoiq serutuieoqi serutueoqii serutueoqii serutueoiqi serutueoiiq
serutueoiiq serutueoiqi serutueqoii serutueqoii serutueqioi serutueqiio serutueqiio serutueqioi serutueiqoi serutueiqio
serutueioqi serutueioiq serutueiioq serutueiiqo serutueiqio serutueiqoi serutueiiqo serutueiioq serutueioiq serutueioqi
seruteioqui seruteioqiu seruteiouqi seruteiouiq seruteioiuq seruteioiqu seruteiqoui seruteiqoiu seruteiquoi seruteiquio
seruteiqiuo seruteiqiou seruteiuqoi seruteiuqio seruteiuoqi seruteiuoiq seruteiuioq seruteiuiqo seruteiiquo seruteiiqou
seruteiiuqo seruteiiuoq seruteiiouq seruteiioqu seruteoiqui seruteoiqiu seruteoiuqi seruteoiuiq seruteoiiuq seruteoiiqu
seruteoqiui seruteoqiiu seruteoquii seruteoquii seruteoqiui seruteoqiiu seruteouqii seruteouqii seruteouiqi seruteouiiq
seruteouiiq seruteouiqi seruteoiqui seruteoiqiu seruteoiuqi seruteoiuiq seruteoiiuq seruteoiiqu seruteqoiui seruteqoiiu
seruteqouii seruteqouii seruteqoiui seruteqoiiu seruteqioui seruteqioiu seruteqiuoi seruteqiuio seruteqiiuo seruteqiiou
serutequioi serutequiio serutequoii serutequoii serutequioi serutequiio seruteqiiuo seruteqiiou seruteqiuio seruteqiuoi
seruteqioui seruteqioiu seruteuoqii seruteuoqii seruteuoiqi seruteuoiiq seruteuoiiq seruteuoiqi seruteuqoii seruteuqoii
seruteuqioi seruteuqiio seruteuqiio seruteuqioi seruteuiqoi seruteuiqio seruteuioqi seruteuioiq seruteuiioq seruteuiiqo
seruteuiqio seruteuiqoi seruteuiiqo seruteuiioq seruteuioiq seruteuioqi seruteioqui seruteioqiu seruteiouqi seruteiouiq
seruteioiuq seruteioiqu seruteiqoui seruteiqoiu seruteiquoi seruteiquio seruteiqiuo seruteiqiou seruteiuqoi seruteiuqio
seruteiuoqi seruteiuoiq seruteiuioq seruteiuiqo seruteiiquo seruteiiqou seruteiiuqo seruteiiuoq seruteiiouq seruteiioqu
seruitioque seruitioqeu seruitiouqe seruitioueq seruitioeuq seruitioequ seruitiqoue seruitiqoeu seruitiquoe seruitiqueo
seruitiqeuo seruitiqeou seruitiuqoe seruitiuqeo seruitiuoqe seruitiuoeq seruitiueoq seruitiueqo seruitiequo seruitieqou
seruitieuqo seruitieuoq seruitieouq seruitieoqu seruitoique seruitoiqeu seruitoiuqe seruitoiueq seruitoieuq seruitoiequ
seruitoqiue seruitoqieu seruitoquie seruitoquei seruitoqeui seruitoqeiu seruitouqie seruitouqei seruitouiqe seruitouieq
seruitoueiq seruitoueqi seruitoequi seruitoeqiu seruitoeuqi seruitoeuiq seruitoeiuq seruitoeiqu seruitqoiue seruitqoieu
seruitqouie seruitqouei seruitqoeui seruitqoeiu seruitqioue seruitqioeu seruitqiuoe seruitqiueo seruitqieuo seruitqieou
seruitquioe seruitquieo seruitquoie seruitquoei seruitqueoi seruitqueio seruitqeiuo seruitqeiou seruitqeuio seruitqeuoi
seruitqeoui seruitqeoiu seruituoqie seruituoqei seruituoiqe seruituoieq seruituoeiq seruituoeqi seruituqoie seruituqoei
seruituqioe seruituqieo seruituqeio seruituqeoi seruituiqoe seruituiqeo seruituioqe seruituioeq seruituieoq seruituieqo
seruitueqio seruitueqoi seruitueiqo seruitueioq seruitueoiq seruitueoqi seruiteoqui seruiteoqiu seruiteouqi seruiteouiq
seruiteoiuq seruiteoiqu seruiteqoui seruiteqoiu seruitequoi seruitequio seruiteqiuo seruiteqiou seruiteuqoi seruiteuqio
seruiteuoqi seruiteuoiq seruiteuioq seruiteuiqo seruiteiquo seruiteiqou seruiteiuqo seruiteiuoq seruiteiouq seruiteioqu
seruiitoque seruiitoqeu seruiitouqe seruiitoueq seruiitoeuq seruiitoequ seruiitqoue seruiitqoeu seruiitquoe seruiitqueo
seruiitqeuo seruiitqeou seruiituqoe seruiituqeo seruiituoqe seruiituoeq seruiitueoq seruiitueqo seruiitequo seruiiteqou
seruiiteuqo seruiiteuoq seruiiteouq seruiiteoqu seruiiotque seruiiotqeu seruiiotuqe seruiiotueq seruiioteuq seruiiotequ
seruiioqtue seruiioqteu seruiioqute seruiioquet seruiioqeut seruiioqetu seruiiouqte seruiiouqet seruiioutqe seruiiouteq
seruiiouetq seruiioueqt seruiioequt seruiioeqtu seruiioeuqt seruiioeutq seruiioetuq seruiioetqu seruiiqotue seruiiqoteu
seruiiqoute seruiiqouet seruiiqoeut seruiiqoetu seruiiqtoue seruiiqtoeu seruiiqtuoe seruiiqtueo seruiiqteuo seruiiqteou
seruiiqutoe seruiiquteo seruiiquote seruiiquoet seruiiqueot seruiiqueto seruiiqetuo seruiiqetou seruiiqeuto seruiiqeuot
seruiiqeout seruiiqeotu seruiiuoqte seruiiuoqet seruiiuotqe seruiiuoteq seruiiuoetq seruiiuoeqt seruiiuqote seruiiuqoet
seruiiuqtoe seruiiuqteo seruiiuqeto seruiiuqeot seruiiutqoe seruiiutqeo seruiiutoqe seruiiutoeq seruiiuteoq seruiiuteqo
seruiiueqto seruiiueqot seruiiuetqo seruiiuetoq seruiiueotq seruiiueoqt seruiieoqut seruiieoqtu seruiieouqt seruiieoutq
seruiieotuq seruiieotqu seruiieqout seruiieqotu seruiiequot seruiiequto seruiieqtuo seruiieqtou seruiieuqot seruiieuqto
seruiieuoqt seruiieuotq seruiieutoq seruiieutqo seruiietquo seruiietqou seruiietuqo seruiietuoq seruiietouq seruiietoqu
seruioitque seruioitqeu seruioituqe seruioitueq seruioiteuq seruioitequ seruioiqtue seruioiqteu seruioiqute seruioiquet
seruioiqeut seruioiqetu seruioiuqte seruioiuqet seruioiutqe seruioiuteq seruioiuetq seruioiueqt seruioiequt seruioieqtu
seruioieuqt seruioieutq seruioietuq seruioietqu seruiotique seruiotiqeu seruiotiuqe seruiotiueq seruiotieuq seruiotiequ
seruiotqiue seruiotqieu seruiotquie seruiotquei seruiotqeui seruiotqeiu seruiotuqie seruiotuqei seruiotuiqe seruiotuieq
seruiotueiq seruiotueqi seruiotequi seruioteqiu seruioteuqi seruioteuiq seruioteiuq seruioteiqu seruioqtiue seruioqtieu
seruioqtuie seruioqtuei seruioqteui seruioqteiu seruioqitue seruioqiteu seruioqiute seruioqiuet seruioqieut seruioqietu
seruioquite seruioquiet seruioqutie seruioqutei seruioqueti seruioqueit seruioqeiut seruioqeitu seruioqeuit seruioqeuti
seruioqetui seruioqetiu seruioutqie seruioutqei seruioutiqe seruioutieq seruiouteiq seruiouteqi seruiouqtie seruiouqtei
seruiouqite seruiouqiet seruiouqeit seruiouqeti seruiouiqte seruiouiqet seruiouitqe seruiouiteq seruiouietq seruiouieqt
seruioueqit seruioueqti seruioueiqt seruioueitq seruiouetiq seruiouetqi seruioetqui seruioetqiu seruioetuqi seruioetuiq
seruioetiuq seruioetiqu seruioeqtui seruioeqtiu seruioequti seruioequit seruioeqiut seruioeqitu seruioeuqti seruioeuqit
seruioeutqi seruioeutiq seruioeuitq seruioeuiqt seruioeiqut seruioeiqtu seruioeiuqt seruioeiutq seruioeituq seruioeitqu
seruiqiotue seruiqioteu seruiqioute seruiqiouet seruiqioeut seruiqioetu seruiqitoue seruiqitoeu seruiqituoe seruiqitueo
seruiqiteuo seruiqiteou seruiqiutoe seruiqiuteo seruiqiuote seruiqiuoet seruiqiueot seruiqiueto seruiqietuo seruiqietou
seruiqieuto seruiqieuot seruiqieout seruiqieotu seruiqoitue seruiqoiteu seruiqoiute seruiqoiuet seruiqoieut seruiqoietu
seruiqotiue seruiqotieu seruiqotuie seruiqotuei seruiqoteui seruiqoteiu seruiqoutie seruiqoutei seruiqouite seruiqouiet
seruiqoueit seruiqoueti seruiqoetui seruiqoetiu seruiqoeuti seruiqoeuit seruiqoeiut seruiqoeitu seruiqtoiue seruiqtoieu
seruiqtouie seruiqtouei seruiqtoeui seruiqtoeiu seruiqtioue seruiqtioeu seruiqtiuoe seruiqtiueo seruiqtieuo seruiqtieou
seruiqtuioe seruiqtuieo seruiqtuoie seruiqtuoei seruiqtueoi seruiqtueio seruiqteiuo seruiqteiou seruiqteuio seruiqteuoi
seruiqteoui seruiqteoiu seruiquotie seruiquotei seruiquoite seruiquoiet seruiquoeit seruiquoeti seruiqutoie seruiqutoei
seruiqutioe seruiqutieo seruiquteio seruiquteoi seruiquitoe seruiquiteo seruiquiote seruiquioet seruiquieot seruiquieto
seruiquetio seruiquetoi seruiqueito seruiqueiot seruiqueoit seruiqueoti seruiqeotui seruiqeotiu seruiqeouti seruiqeouit
seruiqeoiut seruiqeoitu seruiqetoui seruiqetoiu seruiqetuoi seruiqetuio seruiqetiuo seruiqetiou seruiqeutoi seruiqeutio
seruiqeuoti seruiqeuoit seruiqeuiot seruiqeuito seruiqeituo seruiqeitou seruiqeiuto seruiqeiuot seruiqeiout seruiqeiotu
seruiuioqte seruiuioqet seruiuiotqe seruiuioteq seruiuioetq seruiuioeqt seruiuiqote seruiuiqoet seruiuiqtoe seruiuiqteo
seruiuiqeto seruiuiqeot seruiuitqoe seruiuitqeo seruiuitoqe seruiuitoeq seruiuiteoq seruiuiteqo seruiuieqto seruiuieqot
seruiuietqo seruiuietoq seruiuieotq seruiuieoqt seruiuoiqte seruiuoiqet seruiuoitqe seruiuoiteq seruiuoietq seruiuoieqt
seruiuoqite seruiuoqiet seruiuoqtie seruiuoqtei seruiuoqeti seruiuoqeit seruiuotqie seruiuotqei seruiuotiqe seruiuotieq
seruiuoteiq seruiuoteqi seruiuoeqti seruiuoeqit seruiuoetqi seruiuoetiq seruiuoeitq seruiuoeiqt seruiuqoite seruiuqoiet
seruiuqotie seruiuqotei seruiuqoeti seruiuqoeit seruiuqiote seruiuqioet seruiuqitoe seruiuqiteo seruiuqieto seruiuqieot
seruiuqtioe seruiuqtieo seruiuqtoie seruiuqtoei seruiuqteoi seruiuqteio seruiuqeito seruiuqeiot seruiuqetio seruiuqetoi
seruiuqeoti seruiuqeoit seruiutoqie seruiutoqei seruiutoiqe seruiutoieq seruiutoeiq seruiutoeqi seruiutqoie seruiutqoei
seruiutqioe seruiutqieo seruiutqeio seruiutqeoi seruiutiqoe seruiutiqeo seruiutioqe seruiutioeq seruiutieoq seruiutieqo
seruiuteqio seruiuteqoi seruiuteiqo seruiuteioq seruiuteoiq seruiuteoqi seruiueoqti seruiueoqit seruiueotqi seruiueotiq
seruiueoitq seruiueoiqt seruiueqoti seruiueqoit seruiueqtoi seruiueqtio seruiueqito seruiueqiot seruiuetqoi seruiuetqio
seruiuetoqi seruiuetoiq seruiuetioq seruiuetiqo seruiueiqto seruiueiqot seruiueitqo seruiueitoq seruiueiotq seruiueioqt
seruieioqut seruieioqtu seruieiouqt seruieioutq seruieiotuq seruieiotqu seruieiqout seruieiqotu seruieiquot seruieiquto
seruieiqtuo seruieiqtou seruieiuqot seruieiuqto seruieiuoqt seruieiuotq seruieiutoq seruieiutqo seruieitquo seruieitqou
seruieituqo seruieituoq seruieitouq seruieitoqu seruieoiqut seruieoiqtu seruieoiuqt seruieoiutq seruieoituq seruieoitqu
seruieoqiut seruieoqitu seruieoquit seruieoquti seruieoqtui seruieoqtiu seruieouqit seruieouqti seruieouiqt seruieouitq
seruieoutiq seruieoutqi seruieotqui seruieotqiu seruieotuqi seruieotuiq seruieotiuq seruieotiqu seruieqoiut seruieqoitu
seruieqouit seruieqouti seruieqotui seruieqotiu seruieqiout seruieqiotu seruieqiuot seruieqiuto seruieqituo seruieqitou
seruiequiot seruiequito seruiequoit seruiequoti seruiequtoi seruiequtio seruieqtiuo seruieqtiou seruieqtuio seruieqtuoi
seruieqtoui seruieqtoiu seruieuoqit seruieuoqti seruieuoiqt seruieuoitq seruieuotiq seruieuotqi seruieuqoit seruieuqoti
seruieuqiot seruieuqito seruieuqtio seruieuqtoi seruieuiqot seruieuiqto seruieuioqt seruieuiotq seruieuitoq seruieuitqo
seruieutqio seruieutqoi seruieutiqo seruieutioq seruieutoiq seruieutoqi seruietoqui seruietoqiu seruietouqi seruietouiq
seruietoiuq seruietoiqu seruietqoui seruietqoiu seruietquoi seruietquio seruietqiuo seruietqiou seruietuqoi seruietuqio
seruietuoqi seruietuoiq seruietuioq seruietuiqo seruietiquo seruietiqou seruietiuqo seruietiuoq seruietiouq seruietioqu
seruotiique seruotiiqeu seruotiiuqe seruotiiueq seruotiieuq seruotiiequ seruotiqiue seruotiqieu seruotiquie seruotiquei
seruotiqeui seruotiqeiu seruotiuqie seruotiuqei seruotiuiqe seruotiuieq seruotiueiq seruotiueqi seruotiequi seruotieqiu
seruotieuqi seruotieuiq seruotieiuq seruotieiqu seruotiique seruotiiqeu seruotiiuqe seruotiiueq seruotiieuq seruotiiequ
seruotiqiue seruotiqieu seruotiquie seruotiquei seruotiqeui seruotiqeiu seruotiuqie seruotiuqei seruotiuiqe seruotiuieq
seruotiueiq seruotiueqi seruotiequi seruotieqiu seruotieuqi seruotieuiq seruotieiuq seruotieiqu seruotqiiue seruotqiieu
seruotqiuie seruotqiuei seruotqieui seruotqieiu seruotqiiue seruotqiieu seruotqiuie seruotqiuei seruotqieui seruotqieiu
seruotquiie seruotquiei seruotquiie seruotquiei seruotqueii seruotqueii seruotqeiui seruotqeiiu seruotqeuii seruotqeuii
seruotqeiui seruotqeiiu seruotuiqie seruotuiqei seruotuiiqe seruotuiieq seruotuieiq seruotuieqi seruotuqiie seruotuqiei
seruotuqiie seruotuqiei seruotuqeii seruotuqeii seruotuiqie seruotuiqei seruotuiiqe seruotuiieq seruotuieiq seruotuieqi
seruotueqii seruotueqii seruotueiqi seruotueiiq seruotueiiq seruotueiqi seruoteiqui seruoteiqiu seruoteiuqi seruoteiuiq
seruoteiiuq seruoteiiqu seruoteqiui seruoteqiiu seruotequii seruotequii seruoteqiui seruoteqiiu seruoteuqii seruoteuqii
seruoteuiqi seruoteuiiq seruoteuiiq seruoteuiqi seruoteiqui seruoteiqiu seruoteiuqi seruoteiuiq seruoteiiuq seruoteiiqu
seruoitique seruoitiqeu seruoitiuqe seruoitiueq seruoitieuq seruoitiequ seruoitqiue seruoitqieu seruoitquie seruoitquei
seruoitqeui seruoitqeiu seruoituqie seruoituqei seruoituiqe seruoituieq seruoitueiq seruoitueqi seruoitequi seruoiteqiu
seruoiteuqi seruoiteuiq seruoiteiuq seruoiteiqu seruoiitque seruoiitqeu seruoiituqe seruoiitueq seruoiiteuq seruoiitequ
seruoiiqtue seruoiiqteu seruoiiqute seruoiiquet seruoiiqeut seruoiiqetu seruoiiuqte seruoiiuqet seruoiiutqe seruoiiuteq
seruoiiuetq seruoiiueqt seruoiiequt seruoiieqtu seruoiieuqt seruoiieutq seruoiietuq seruoiietqu seruoiqitue seruoiqiteu
seruoiqiute seruoiqiuet seruoiqieut seruoiqietu seruoiqtiue seruoiqtieu seruoiqtuie seruoiqtuei seruoiqteui seruoiqteiu
seruoiqutie seruoiqutei seruoiquite seruoiquiet seruoiqueit seruoiqueti seruoiqetui seruoiqetiu seruoiqeuti seruoiqeuit
seruoiqeiut seruoiqeitu seruoiuiqte seruoiuiqet seruoiuitqe seruoiuiteq seruoiuietq seruoiuieqt seruoiuqite seruoiuqiet
seruoiuqtie seruoiuqtei seruoiuqeti seruoiuqeit seruoiutqie seruoiutqei seruoiutiqe seruoiutieq seruoiuteiq seruoiuteqi
seruoiueqti seruoiueqit seruoiuetqi seruoiuetiq seruoiueitq seruoiueiqt seruoieiqut seruoieiqtu seruoieiuqt seruoieiutq
seruoieituq seruoieitqu seruoieqiut seruoieqitu seruoiequit seruoiequti seruoieqtui seruoieqtiu seruoieuqit seruoieuqti
seruoieuiqt seruoieuitq seruoieutiq seruoieutqi seruoietqui seruoietqiu seruoietuqi seruoietuiq seruoietiuq seruoietiqu
seruoiitque seruoiitqeu seruoiituqe seruoiitueq seruoiiteuq seruoiitequ seruoiiqtue seruoiiqteu seruoiiqute seruoiiquet
seruoiiqeut seruoiiqetu seruoiiuqte seruoiiuqet seruoiiutqe seruoiiuteq seruoiiuetq seruoiiueqt seruoiiequt seruoiieqtu
seruoiieuqt seruoiieutq seruoiietuq seruoiietqu seruoitique seruoitiqeu seruoitiuqe seruoitiueq seruoitieuq seruoitiequ
seruoitqiue seruoitqieu seruoitquie seruoitquei seruoitqeui seruoitqeiu seruoituqie seruoituqei seruoituiqe seruoituieq
seruoitueiq seruoitueqi seruoitequi seruoiteqiu seruoiteuqi seruoiteuiq seruoiteiuq seruoiteiqu seruoiqtiue seruoiqtieu
seruoiqtuie seruoiqtuei seruoiqteui seruoiqteiu seruoiqitue seruoiqiteu seruoiqiute seruoiqiuet seruoiqieut seruoiqietu
seruoiquite seruoiquiet seruoiqutie seruoiqutei seruoiqueti seruoiqueit seruoiqeiut seruoiqeitu seruoiqeuit seruoiqeuti
seruoiqetui seruoiqetiu seruoiutqie seruoiutqei seruoiutiqe seruoiutieq seruoiuteiq seruoiuteqi seruoiuqtie seruoiuqtei
seruoiuqite seruoiuqiet seruoiuqeit seruoiuqeti seruoiuiqte seruoiuiqet seruoiuitqe seruoiuiteq seruoiuietq seruoiuieqt
seruoiueqit seruoiueqti seruoiueiqt seruoiueitq seruoiuetiq seruoiuetqi seruoietqui seruoietqiu seruoietuqi seruoietuiq
seruoietiuq seruoietiqu seruoieqtui seruoieqtiu seruoiequti seruoiequit seruoieqiut seruoieqitu seruoieuqti seruoieuqit
seruoieutqi seruoieutiq seruoieuitq seruoieuiqt seruoieiqut seruoieiqtu seruoieiuqt seruoieiutq seruoieituq seruoieitqu
seruoqiitue seruoqiiteu seruoqiiute seruoqiiuet seruoqiieut seruoqiietu seruoqitiue seruoqitieu seruoqituie seruoqituei
seruoqiteui seruoqiteiu seruoqiutie seruoqiutei seruoqiuite seruoqiuiet seruoqiueit seruoqiueti seruoqietui seruoqietiu
seruoqieuti seruoqieuit seruoqieiut seruoqieitu seruoqiitue seruoqiiteu seruoqiiute seruoqiiuet seruoqiieut seruoqiietu
seruoqitiue seruoqitieu seruoqituie seruoqituei seruoqiteui seruoqiteiu seruoqiutie seruoqiutei seruoqiuite seruoqiuiet
seruoqiueit seruoqiueti seruoqietui seruoqietiu seruoqieuti seruoqieuit seruoqieiut seruoqieitu seruoqtiiue seruoqtiieu
seruoqtiuie seruoqtiuei seruoqtieui seruoqtieiu seruoqtiiue seruoqtiieu seruoqtiuie seruoqtiuei seruoqtieui seruoqtieiu
seruoqtuiie seruoqtuiei seruoqtuiie seruoqtuiei seruoqtueii seruoqtueii seruoqteiui seruoqteiiu seruoqteuii seruoqteuii
seruoqteiui seruoqteiiu seruoquitie seruoquitei seruoquiite seruoquiiet seruoquieit seruoquieti seruoqutiie seruoqutiei
seruoqutiie seruoqutiei seruoquteii seruoquteii seruoquitie seruoquitei seruoquiite seruoquiiet seruoquieit seruoquieti
seruoquetii seruoquetii seruoqueiti seruoqueiit seruoqueiit seruoqueiti seruoqeitui seruoqeitiu seruoqeiuti seruoqeiuit
seruoqeiiut seruoqeiitu seruoqetiui seruoqetiiu seruoqetuii seruoqetuii seruoqetiui seruoqetiiu seruoqeutii seruoqeutii
seruoqeuiti seruoqeuiit seruoqeuiit seruoqeuiti seruoqeitui seruoqeitiu seruoqeiuti seruoqeiuit seruoqeiiut seruoqeiitu
seruouiiqte seruouiiqet seruouiitqe seruouiiteq seruouiietq seruouiieqt seruouiqite seruouiqiet seruouiqtie seruouiqtei
seruouiqeti seruouiqeit seruouitqie seruouitqei seruouitiqe seruouitieq seruouiteiq seruouiteqi seruouieqti seruouieqit
seruouietqi seruouietiq seruouieitq seruouieiqt seruouiiqte seruouiiqet seruouiitqe seruouiiteq seruouiietq seruouiieqt
seruouiqite seruouiqiet seruouiqtie seruouiqtei seruouiqeti seruouiqeit seruouitqie seruouitqei seruouitiqe seruouitieq
seruouiteiq seruouiteqi seruouieqti seruouieqit seruouietqi seruouietiq seruouieitq seruouieiqt seruouqiite seruouqiiet
seruouqitie seruouqitei seruouqieti seruouqieit seruouqiite seruouqiiet seruouqitie seruouqitei seruouqieti seruouqieit
seruouqtiie seruouqtiei seruouqtiie seruouqtiei seruouqteii seruouqteii seruouqeiti seruouqeiit seruouqetii seruouqetii
seruouqeiti seruouqeiit seruoutiqie seruoutiqei seruoutiiqe seruoutiieq seruoutieiq seruoutieqi seruoutqiie seruoutqiei
seruoutqiie seruoutqiei seruoutqeii seruoutqeii seruoutiqie seruoutiqei seruoutiiqe seruoutiieq seruoutieiq seruoutieqi
seruouteqii seruouteqii seruouteiqi seruouteiiq seruouteiiq seruouteiqi seruoueiqti seruoueiqit seruoueitqi seruoueitiq
seruoueiitq seruoueiiqt seruoueqiti seruoueqiit seruoueqtii seruoueqtii seruoueqiti seruoueqiit seruouetqii seruouetqii
seruouetiqi seruouetiiq seruouetiiq seruouetiqi seruoueiqti seruoueiqit seruoueitqi seruoueitiq seruoueiitq seruoueiiqt
seruoeiiqut seruoeiiqtu seruoeiiuqt seruoeiiutq seruoeiituq seruoeiitqu seruoeiqiut seruoeiqitu seruoeiquit seruoeiquti
seruoeiqtui seruoeiqtiu seruoeiuqit seruoeiuqti seruoeiuiqt seruoeiuitq seruoeiutiq seruoeiutqi seruoeitqui seruoeitqiu
seruoeituqi seruoeituiq seruoeitiuq seruoeitiqu seruoeiiqut seruoeiiqtu seruoeiiuqt seruoeiiutq seruoeiituq seruoeiitqu
seruoeiqiut seruoeiqitu seruoeiquit seruoeiquti seruoeiqtui seruoeiqtiu seruoeiuqit seruoeiuqti seruoeiuiqt seruoeiuitq
seruoeiutiq seruoeiutqi seruoeitqui seruoeitqiu seruoeituqi seruoeituiq seruoeitiuq seruoeitiqu seruoeqiiut seruoeqiitu
seruoeqiuit seruoeqiuti seruoeqitui seruoeqitiu seruoeqiiut seruoeqiitu seruoeqiuit seruoeqiuti seruoeqitui seruoeqitiu
seruoequiit seruoequiti seruoequiit seruoequiti seruoequtii seruoequtii seruoeqtiui seruoeqtiiu seruoeqtuii seruoeqtuii
seruoeqtiui seruoeqtiiu seruoeuiqit seruoeuiqti seruoeuiiqt seruoeuiitq seruoeuitiq seruoeuitqi seruoeuqiit seruoeuqiti
seruoeuqiit seruoeuqiti seruoeuqtii seruoeuqtii seruoeuiqit seruoeuiqti seruoeuiiqt seruoeuiitq seruoeuitiq seruoeuitqi
seruoeutqii seruoeutqii seruoeutiqi seruoeutiiq seruoeutiiq seruoeutiqi seruoetiqui seruoetiqiu seruoetiuqi seruoetiuiq
seruoetiiuq seruoetiiqu seruoetqiui seruoetqiiu seruoetquii seruoetquii seruoetqiui seruoetqiiu seruoetuqii seruoetuqii
seruoetuiqi seruoetuiiq seruoetuiiq seruoetuiqi seruoetiqui seruoetiqiu seruoetiuqi seruoetiuiq seruoetiiuq seruoetiiqu
seruqtioiue seruqtioieu seruqtiouie seruqtiouei seruqtioeui seruqtioeiu seruqtiioue seruqtiioeu seruqtiiuoe seruqtiiueo
seruqtiieuo seruqtiieou seruqtiuioe seruqtiuieo seruqtiuoie seruqtiuoei seruqtiueoi seruqtiueio seruqtieiuo seruqtieiou
seruqtieuio seruqtieuoi seruqtieoui seruqtieoiu seruqtoiiue seruqtoiieu seruqtoiuie seruqtoiuei seruqtoieui seruqtoieiu
seruqtoiiue seruqtoiieu seruqtoiuie seruqtoiuei seruqtoieui seruqtoieiu seruqtouiie seruqtouiei seruqtouiie seruqtouiei
seruqtoueii seruqtoueii seruqtoeiui seruqtoeiiu seruqtoeuii seruqtoeuii seruqtoeiui seruqtoeiiu seruqtioiue seruqtioieu
seruqtiouie seruqtiouei seruqtioeui seruqtioeiu seruqtiioue seruqtiioeu seruqtiiuoe seruqtiiueo seruqtiieuo seruqtiieou
seruqtiuioe seruqtiuieo seruqtiuoie seruqtiuoei seruqtiueoi seruqtiueio seruqtieiuo seruqtieiou seruqtieuio seruqtieuoi
seruqtieoui seruqtieoiu seruqtuoiie seruqtuoiei seruqtuoiie seruqtuoiei seruqtuoeii seruqtuoeii seruqtuioie seruqtuioei
seruqtuiioe seruqtuiieo seruqtuieio seruqtuieoi seruqtuiioe seruqtuiieo seruqtuioie seruqtuioei seruqtuieoi seruqtuieio
seruqtueiio seruqtueioi seruqtueiio seruqtueioi seruqtueoii seruqtueoii seruqteoiui seruqteoiiu seruqteouii seruqteouii
seruqteoiui seruqteoiiu seruqteioui seruqteioiu seruqteiuoi seruqteiuio seruqteiiuo seruqteiiou seruqteuioi seruqteuiio
seruqteuoii seruqteuoii seruqteuioi seruqteuiio seruqteiiuo seruqteiiou seruqteiuio seruqteiuoi seruqteioui seruqteioiu
seruqitoiue seruqitoieu seruqitouie seruqitouei seruqitoeui seruqitoeiu seruqitioue seruqitioeu seruqitiuoe seruqitiueo
seruqitieuo seruqitieou seruqituioe seruqituieo seruqituoie seruqituoei seruqitueoi seruqitueio seruqiteiuo seruqiteiou
seruqiteuio seruqiteuoi seruqiteoui seruqiteoiu seruqiotiue seruqiotieu seruqiotuie seruqiotuei seruqioteui seruqioteiu
seruqioitue seruqioiteu seruqioiute seruqioiuet seruqioieut seruqioietu seruqiouite seruqiouiet seruqioutie seruqioutei
seruqioueti seruqioueit seruqioeiut seruqioeitu seruqioeuit seruqioeuti seruqioetui seruqioetiu seruqiiotue seruqiioteu
seruqiioute seruqiiouet seruqiioeut seruqiioetu seruqiitoue seruqiitoeu seruqiituoe seruqiitueo seruqiiteuo seruqiiteou
seruqiiutoe seruqiiuteo seruqiiuote seruqiiuoet seruqiiueot seruqiiueto seruqiietuo seruqiietou seruqiieuto seruqiieuot
seruqiieout seruqiieotu seruqiuoite seruqiuoiet seruqiuotie seruqiuotei seruqiuoeti seruqiuoeit seruqiuiote seruqiuioet
seruqiuitoe seruqiuiteo seruqiuieto seruqiuieot seruqiutioe seruqiutieo seruqiutoie seruqiutoei seruqiuteoi seruqiuteio
seruqiueito seruqiueiot seruqiuetio seruqiuetoi seruqiueoti seruqiueoit seruqieoiut seruqieoitu seruqieouit seruqieouti
seruqieotui seruqieotiu seruqieiout seruqieiotu seruqieiuot seruqieiuto seruqieituo seruqieitou seruqieuiot seruqieuito
seruqieuoit seruqieuoti seruqieutoi seruqieutio seruqietiuo seruqietiou seruqietuio seruqietuoi seruqietoui seruqietoiu
seruqoitiue seruqoitieu seruqoituie seruqoituei seruqoiteui seruqoiteiu seruqoiitue seruqoiiteu seruqoiiute seruqoiiuet
seruqoiieut seruqoiietu seruqoiuite seruqoiuiet seruqoiutie seruqoiutei seruqoiueti seruqoiueit seruqoieiut seruqoieitu
seruqoieuit seruqoieuti seruqoietui seruqoietiu seruqotiiue seruqotiieu seruqotiuie seruqotiuei seruqotieui seruqotieiu
seruqotiiue seruqotiieu seruqotiuie seruqotiuei seruqotieui seruqotieiu seruqotuiie seruqotuiei seruqotuiie seruqotuiei
seruqotueii seruqotueii seruqoteiui seruqoteiiu seruqoteuii seruqoteuii seruqoteiui seruqoteiiu seruqoitiue seruqoitieu
seruqoituie seruqoituei seruqoiteui seruqoiteiu seruqoiitue seruqoiiteu seruqoiiute seruqoiiuet seruqoiieut seruqoiietu
seruqoiuite seruqoiuiet seruqoiutie seruqoiutei seruqoiueti seruqoiueit seruqoieiut seruqoieitu seruqoieuit seruqoieuti
seruqoietui seruqoietiu seruqoutiie seruqoutiei seruqoutiie seruqoutiei seruqouteii seruqouteii seruqouitie seruqouitei
seruqouiite seruqouiiet seruqouieit seruqouieti seruqouiite seruqouiiet seruqouitie seruqouitei seruqouieti seruqouieit
seruqoueiit seruqoueiti seruqoueiit seruqoueiti seruqouetii seruqouetii seruqoetiui seruqoetiiu seruqoetuii seruqoetuii
seruqoetiui seruqoetiiu seruqoeitui seruqoeitiu seruqoeiuti seruqoeiuit seruqoeiiut seruqoeiitu seruqoeuiti seruqoeuiit
seruqoeutii seruqoeutii seruqoeuiti seruqoeuiit seruqoeiiut seruqoeiitu seruqoeiuit seruqoeiuti seruqoeitui seruqoeitiu
seruqiiotue seruqiioteu seruqiioute seruqiiouet seruqiioeut seruqiioetu seruqiitoue seruqiitoeu seruqiituoe seruqiitueo
seruqiiteuo seruqiiteou seruqiiutoe seruqiiuteo seruqiiuote seruqiiuoet seruqiiueot seruqiiueto seruqiietuo seruqiietou
seruqiieuto seruqiieuot seruqiieout seruqiieotu seruqioitue seruqioiteu seruqioiute seruqioiuet seruqioieut seruqioietu
seruqiotiue seruqiotieu seruqiotuie seruqiotuei seruqioteui seruqioteiu seruqioutie seruqioutei seruqiouite seruqiouiet
seruqioueit seruqioueti seruqioetui seruqioetiu seruqioeuti seruqioeuit seruqioeiut seruqioeitu seruqitoiue seruqitoieu
seruqitouie seruqitouei seruqitoeui seruqitoeiu seruqitioue seruqitioeu seruqitiuoe seruqitiueo seruqitieuo seruqitieou
seruqituioe seruqituieo seruqituoie seruqituoei seruqitueoi seruqitueio seruqiteiuo seruqiteiou seruqiteuio seruqiteuoi
seruqiteoui seruqiteoiu seruqiuotie seruqiuotei seruqiuoite seruqiuoiet seruqiuoeit seruqiuoeti seruqiutoie seruqiutoei
seruqiutioe seruqiutieo seruqiuteio seruqiuteoi seruqiuitoe seruqiuiteo seruqiuiote seruqiuioet seruqiuieot seruqiuieto
seruqiuetio seruqiuetoi seruqiueito seruqiueiot seruqiueoit seruqiueoti seruqieotui seruqieotiu seruqieouti seruqieouit
seruqieoiut seruqieoitu seruqietoui seruqietoiu seruqietuoi seruqietuio seruqietiuo seruqietiou seruqieutoi seruqieutio
seruqieuoti seruqieuoit seruqieuiot seruqieuito seruqieituo seruqieitou seruqieiuto seruqieiuot seruqieiout seruqieiotu
seruquioite seruquioiet seruquiotie seruquiotei seruquioeti seruquioeit seruquiiote seruquiioet seruquiitoe seruquiiteo
seruquiieto seruquiieot seruquitioe seruquitieo seruquitoie seruquitoei seruquiteoi seruquiteio seruquieito seruquieiot
seruquietio seruquietoi seruquieoti seruquieoit seruquoiite seruquoiiet seruquoitie seruquoitei seruquoieti seruquoieit
seruquoiite seruquoiiet seruquoitie seruquoitei seruquoieti seruquoieit seruquotiie seruquotiei seruquotiie seruquotiei
seruquoteii seruquoteii seruquoeiti seruquoeiit seruquoetii seruquoetii seruquoeiti seruquoeiit seruquioite seruquioiet
seruquiotie seruquiotei seruquioeti seruquioeit seruquiiote seruquiioet seruquiitoe seruquiiteo seruquiieto seruquiieot
seruquitioe seruquitieo seruquitoie seruquitoei seruquiteoi seruquiteio seruquieito seruquieiot seruquietio seruquietoi
seruquieoti seruquieoit seruqutoiie seruqutoiei seruqutoiie seruqutoiei seruqutoeii seruqutoeii seruqutioie seruqutioei
seruqutiioe seruqutiieo seruqutieio seruqutieoi seruqutiioe seruqutiieo seruqutioie seruqutioei seruqutieoi seruqutieio
seruquteiio seruquteioi seruquteiio seruquteioi seruquteoii seruquteoii seruqueoiti seruqueoiit seruqueotii seruqueotii
seruqueoiti seruqueoiit seruqueioti seruqueioit seruqueitoi seruqueitio seruqueiito seruqueiiot seruquetioi seruquetiio
seruquetoii seruquetoii seruquetioi seruquetiio seruqueiito seruqueiiot seruqueitio seruqueitoi seruqueioti seruqueioit
seruqeioiut seruqeioitu seruqeiouit seruqeiouti seruqeiotui seruqeiotiu seruqeiiout seruqeiiotu seruqeiiuot seruqeiiuto
seruqeiituo seruqeiitou seruqeiuiot seruqeiuito seruqeiuoit seruqeiuoti seruqeiutoi seruqeiutio seruqeitiuo seruqeitiou
seruqeituio seruqeituoi seruqeitoui seruqeitoiu seruqeoiiut seruqeoiitu seruqeoiuit seruqeoiuti seruqeoitui seruqeoitiu
seruqeoiiut seruqeoiitu seruqeoiuit seruqeoiuti seruqeoitui seruqeoitiu seruqeouiit seruqeouiti seruqeouiit seruqeouiti
seruqeoutii seruqeoutii seruqeotiui seruqeotiiu seruqeotuii seruqeotuii seruqeotiui seruqeotiiu seruqeioiut seruqeioitu
seruqeiouit seruqeiouti seruqeiotui seruqeiotiu seruqeiiout seruqeiiotu seruqeiiuot seruqeiiuto seruqeiituo seruqeiitou
seruqeiuiot seruqeiuito seruqeiuoit seruqeiuoti seruqeiutoi seruqeiutio seruqeitiuo seruqeitiou seruqeituio seruqeituoi
seruqeitoui seruqeitoiu seruqeuoiit seruqeuoiti seruqeuoiit seruqeuoiti seruqeuotii seruqeuotii seruqeuioit seruqeuioti
seruqeuiiot seruqeuiito seruqeuitio seruqeuitoi seruqeuiiot seruqeuiito seruqeuioit seruqeuioti seruqeuitoi seruqeuitio
seruqeutiio seruqeutioi seruqeutiio seruqeutioi seruqeutoii seruqeutoii seruqetoiui seruqetoiiu seruqetouii seruqetouii
seruqetoiui seruqetoiiu seruqetioui seruqetioiu seruqetiuoi seruqetiuio seruqetiiuo seruqetiiou seruqetuioi seruqetuiio
seruqetuoii seruqetuoii seruqetuioi seruqetuiio seruqetiiuo seruqetiiou seruqetiuio seruqetiuoi seruqetioui seruqetioiu
seruutioqie seruutioqei seruutioiqe seruutioieq seruutioeiq seruutioeqi seruutiqoie seruutiqoei seruutiqioe seruutiqieo
seruutiqeio seruutiqeoi seruutiiqoe seruutiiqeo seruutiioqe seruutiioeq seruutiieoq seruutiieqo seruutieqio seruutieqoi
seruutieiqo seruutieioq seruutieoiq seruutieoqi seruutoiqie seruutoiqei seruutoiiqe seruutoiieq seruutoieiq seruutoieqi
seruutoqiie seruutoqiei seruutoqiie seruutoqiei seruutoqeii seruutoqeii seruutoiqie seruutoiqei seruutoiiqe seruutoiieq
seruutoieiq seruutoieqi seruutoeqii seruutoeqii seruutoeiqi seruutoeiiq seruutoeiiq seruutoeiqi seruutqoiie seruutqoiei
seruutqoiie seruutqoiei seruutqoeii seruutqoeii seruutqioie seruutqioei seruutqiioe seruutqiieo seruutqieio seruutqieoi
seruutqiioe seruutqiieo seruutqioie seruutqioei seruutqieoi seruutqieio seruutqeiio seruutqeioi seruutqeiio seruutqeioi
seruutqeoii seruutqeoii seruutioqie seruutioqei seruutioiqe seruutioieq seruutioeiq seruutioeqi seruutiqoie seruutiqoei
seruutiqioe seruutiqieo seruutiqeio seruutiqeoi seruutiiqoe seruutiiqeo seruutiioqe seruutiioeq seruutiieoq seruutiieqo
seruutieqio seruutieqoi seruutieiqo seruutieioq seruutieoiq seruutieoqi seruuteoqii seruuteoqii seruuteoiqi seruuteoiiq
seruuteoiiq seruuteoiqi seruuteqoii seruuteqoii seruuteqioi seruuteqiio seruuteqiio seruuteqioi seruuteiqoi seruuteiqio
seruuteioqi seruuteioiq seruuteiioq seruuteiiqo seruuteiqio seruuteiqoi seruuteiiqo seruuteiioq seruuteioiq seruuteioqi
seruuitoqie seruuitoqei seruuitoiqe seruuitoieq seruuitoeiq seruuitoeqi seruuitqoie seruuitqoei seruuitqioe seruuitqieo
seruuitqeio seruuitqeoi seruuitiqoe seruuitiqeo seruuitioqe seruuitioeq seruuitieoq seruuitieqo seruuiteqio seruuiteqoi
seruuiteiqo seruuiteioq seruuiteoiq seruuiteoqi seruuiotqie seruuiotqei seruuiotiqe seruuiotieq seruuioteiq seruuioteqi
seruuioqtie seruuioqtei seruuioqite seruuioqiet seruuioqeit seruuioqeti seruuioiqte seruuioiqet seruuioitqe seruuioiteq
seruuioietq seruuioieqt seruuioeqit seruuioeqti seruuioeiqt seruuioeitq seruuioetiq seruuioetqi seruuiqotie seruuiqotei
seruuiqoite seruuiqoiet seruuiqoeit seruuiqoeti seruuiqtoie seruuiqtoei seruuiqtioe seruuiqtieo seruuiqteio seruuiqteoi
seruuiqitoe seruuiqiteo seruuiqiote seruuiqioet seruuiqieot seruuiqieto seruuiqetio seruuiqetoi seruuiqeito seruuiqeiot
seruuiqeoit seruuiqeoti seruuiioqte seruuiioqet seruuiiotqe seruuiioteq seruuiioetq seruuiioeqt seruuiiqote seruuiiqoet
seruuiiqtoe seruuiiqteo seruuiiqeto seruuiiqeot seruuiitqoe seruuiitqeo seruuiitoqe seruuiitoeq seruuiiteoq seruuiiteqo
seruuiieqto seruuiieqot seruuiietqo seruuiietoq seruuiieotq seruuiieoqt seruuieoqit seruuieoqti seruuieoiqt seruuieoitq
seruuieotiq seruuieotqi seruuieqoit seruuieqoti seruuieqiot seruuieqito seruuieqtio seruuieqtoi seruuieiqot seruuieiqto
seruuieioqt seruuieiotq seruuieitoq seruuieitqo seruuietqio seruuietqoi seruuietiqo seruuietioq seruuietoiq seruuietoqi
seruuoitqie seruuoitqei seruuoitiqe seruuoitieq seruuoiteiq seruuoiteqi seruuoiqtie seruuoiqtei seruuoiqite seruuoiqiet
seruuoiqeit seruuoiqeti seruuoiiqte seruuoiiqet seruuoiitqe seruuoiiteq seruuoiietq seruuoiieqt seruuoieqit seruuoieqti
seruuoieiqt seruuoieitq seruuoietiq seruuoietqi seruuotiqie seruuotiqei seruuotiiqe seruuotiieq seruuotieiq seruuotieqi
seruuotqiie seruuotqiei seruuotqiie seruuotqiei seruuotqeii seruuotqeii seruuotiqie seruuotiqei seruuotiiqe seruuotiieq
seruuotieiq seruuotieqi seruuoteqii seruuoteqii seruuoteiqi seruuoteiiq seruuoteiiq seruuoteiqi seruuoqtiie seruuoqtiei
seruuoqtiie seruuoqtiei seruuoqteii seruuoqteii seruuoqitie seruuoqitei seruuoqiite seruuoqiiet seruuoqieit seruuoqieti
seruuoqiite seruuoqiiet seruuoqitie seruuoqitei seruuoqieti seruuoqieit seruuoqeiit seruuoqeiti seruuoqeiit seruuoqeiti
seruuoqetii seruuoqetii seruuoitqie seruuoitqei seruuoitiqe seruuoitieq seruuoiteiq seruuoiteqi seruuoiqtie seruuoiqtei
seruuoiqite seruuoiqiet seruuoiqeit seruuoiqeti seruuoiiqte seruuoiiqet seruuoiitqe seruuoiiteq seruuoiietq seruuoiieqt
seruuoieqit seruuoieqti seruuoieiqt seruuoieitq seruuoietiq seruuoietqi seruuoetqii seruuoetqii seruuoetiqi seruuoetiiq
seruuoetiiq seruuoetiqi seruuoeqtii seruuoeqtii seruuoeqiti seruuoeqiit seruuoeqiit seruuoeqiti seruuoeiqti seruuoeiqit
seruuoeitqi seruuoeitiq seruuoeiitq seruuoeiiqt seruuoeiqit seruuoeiqti seruuoeiiqt seruuoeiitq seruuoeitiq seruuoeitqi
seruuqiotie seruuqiotei seruuqioite seruuqioiet seruuqioeit seruuqioeti seruuqitoie seruuqitoei seruuqitioe seruuqitieo
seruuqiteio seruuqiteoi seruuqiitoe seruuqiiteo seruuqiiote seruuqiioet seruuqiieot seruuqiieto seruuqietio seruuqietoi
seruuqieito seruuqieiot seruuqieoit seruuqieoti seruuqoitie seruuqoitei seruuqoiite seruuqoiiet seruuqoieit seruuqoieti
seruuqotiie seruuqotiei seruuqotiie seruuqotiei seruuqoteii seruuqoteii seruuqoitie seruuqoitei seruuqoiite seruuqoiiet
seruuqoieit seruuqoieti seruuqoetii seruuqoetii seruuqoeiti seruuqoeiit seruuqoeiit seruuqoeiti seruuqtoiie seruuqtoiei
seruuqtoiie seruuqtoiei seruuqtoeii seruuqtoeii seruuqtioie seruuqtioei seruuqtiioe seruuqtiieo seruuqtieio seruuqtieoi
seruuqtiioe seruuqtiieo seruuqtioie seruuqtioei seruuqtieoi seruuqtieio seruuqteiio seruuqteioi seruuqteiio seruuqteioi
seruuqteoii seruuqteoii seruuqiotie seruuqiotei seruuqioite seruuqioiet seruuqioeit seruuqioeti seruuqitoie seruuqitoei
seruuqitioe seruuqitieo seruuqiteio seruuqiteoi seruuqiitoe seruuqiiteo seruuqiiote seruuqiioet seruuqiieot seruuqiieto
seruuqietio seruuqietoi seruuqieito seruuqieiot seruuqieoit seruuqieoti seruuqeotii seruuqeotii seruuqeoiti seruuqeoiit
seruuqeoiit seruuqeoiti seruuqetoii seruuqetoii seruuqetioi seruuqetiio seruuqetiio seruuqetioi seruuqeitoi seruuqeitio
seruuqeioti seruuqeioit seruuqeiiot seruuqeiito seruuqeitio seruuqeitoi seruuqeiito seruuqeiiot seruuqeioit seruuqeioti
seruuiioqte seruuiioqet seruuiiotqe seruuiioteq seruuiioetq seruuiioeqt seruuiiqote seruuiiqoet seruuiiqtoe seruuiiqteo
seruuiiqeto seruuiiqeot seruuiitqoe seruuiitqeo seruuiitoqe seruuiitoeq seruuiiteoq seruuiiteqo seruuiieqto seruuiieqot
seruuiietqo seruuiietoq seruuiieotq seruuiieoqt seruuioiqte seruuioiqet seruuioitqe seruuioiteq seruuioietq seruuioieqt
seruuioqite seruuioqiet seruuioqtie seruuioqtei seruuioqeti seruuioqeit seruuiotqie seruuiotqei seruuiotiqe seruuiotieq
seruuioteiq seruuioteqi seruuioeqti seruuioeqit seruuioetqi seruuioetiq seruuioeitq seruuioeiqt seruuiqoite seruuiqoiet
seruuiqotie seruuiqotei seruuiqoeti seruuiqoeit seruuiqiote seruuiqioet seruuiqitoe seruuiqiteo seruuiqieto seruuiqieot
seruuiqtioe seruuiqtieo seruuiqtoie seruuiqtoei seruuiqteoi seruuiqteio seruuiqeito seruuiqeiot seruuiqetio seruuiqetoi
seruuiqeoti seruuiqeoit seruuitoqie seruuitoqei seruuitoiqe seruuitoieq seruuitoeiq seruuitoeqi seruuitqoie seruuitqoei
seruuitqioe seruuitqieo seruuitqeio seruuitqeoi seruuitiqoe seruuitiqeo seruuitioqe seruuitioeq seruuitieoq seruuitieqo
seruuiteqio seruuiteqoi seruuiteiqo seruuiteioq seruuiteoiq seruuiteoqi seruuieoqti seruuieoqit seruuieotqi seruuieotiq
seruuieoitq seruuieoiqt seruuieqoti seruuieqoit seruuieqtoi seruuieqtio seruuieqito seruuieqiot seruuietqoi seruuietqio
seruuietoqi seruuietoiq seruuietioq seruuietiqo seruuieiqto seruuieiqot seruuieitqo seruuieitoq seruuieiotq seruuieioqt
seruueioqit seruueioqti seruueioiqt seruueioitq seruueiotiq seruueiotqi seruueiqoit seruueiqoti seruueiqiot seruueiqito
seruueiqtio seruueiqtoi seruueiiqot seruueiiqto seruueiioqt seruueiiotq seruueiitoq seruueiitqo seruueitqio seruueitqoi
seruueitiqo seruueitioq seruueitoiq seruueitoqi seruueoiqit seruueoiqti seruueoiiqt seruueoiitq seruueoitiq seruueoitqi
seruueoqiit seruueoqiti seruueoqiit seruueoqiti seruueoqtii seruueoqtii seruueoiqit seruueoiqti seruueoiiqt seruueoiitq
seruueoitiq seruueoitqi seruueotqii seruueotqii seruueotiqi seruueotiiq seruueotiiq seruueotiqi seruueqoiit seruueqoiti
seruueqoiit seruueqoiti seruueqotii seruueqotii seruueqioit seruueqioti seruueqiiot seruueqiito seruueqitio seruueqitoi
seruueqiiot seruueqiito seruueqioit seruueqioti seruueqitoi seruueqitio seruueqtiio seruueqtioi seruueqtiio seruueqtioi
seruueqtoii seruueqtoii seruueioqit seruueioqti seruueioiqt seruueioitq seruueiotiq seruueiotqi seruueiqoit seruueiqoti
seruueiqiot seruueiqito seruueiqtio seruueiqtoi seruueiiqot seruueiiqto seruueiioqt seruueiiotq seruueiitoq seruueiitqo
seruueitqio seruueitqoi seruueitiqo seruueitioq seruueitoiq seruueitoqi seruuetoqii seruuetoqii seruuetoiqi seruuetoiiq
seruuetoiiq seruuetoiqi seruuetqoii seruuetqoii seruuetqioi seruuetqiio seruuetqiio seruuetqioi seruuetiqoi seruuetiqio
seruuetioqi seruuetioiq seruuetiioq seruuetiiqo seruuetiqio seruuetiqoi seruuetiiqo seruuetiioq seruuetioiq seruuetioqi
seruetioqui seruetioqiu seruetiouqi seruetiouiq seruetioiuq seruetioiqu seruetiqoui seruetiqoiu seruetiquoi seruetiquio
seruetiqiuo seruetiqiou seruetiuqoi seruetiuqio seruetiuoqi seruetiuoiq seruetiuioq seruetiuiqo seruetiiquo seruetiiqou
seruetiiuqo seruetiiuoq seruetiiouq seruetiioqu seruetoiqui seruetoiqiu seruetoiuqi seruetoiuiq seruetoiiuq seruetoiiqu
seruetoqiui seruetoqiiu seruetoquii seruetoquii seruetoqiui seruetoqiiu seruetouqii seruetouqii seruetouiqi seruetouiiq
seruetouiiq seruetouiqi seruetoiqui seruetoiqiu seruetoiuqi seruetoiuiq seruetoiiuq seruetoiiqu seruetqoiui seruetqoiiu
seruetqouii seruetqouii seruetqoiui seruetqoiiu seruetqioui seruetqioiu seruetqiuoi seruetqiuio seruetqiiuo seruetqiiou
seruetquioi seruetquiio seruetquoii seruetquoii seruetquioi seruetquiio seruetqiiuo seruetqiiou seruetqiuio seruetqiuoi
seruetqioui seruetqioiu seruetuoqii seruetuoqii seruetuoiqi seruetuoiiq seruetuoiiq seruetuoiqi seruetuqoii seruetuqoii
seruetuqioi seruetuqiio seruetuqiio seruetuqioi seruetuiqoi seruetuiqio seruetuioqi seruetuioiq seruetuiioq seruetuiiqo
seruetuiqio seruetuiqoi seruetuiiqo seruetuiioq seruetuioiq seruetuioqi seruetioqui seruetioqiu seruetiouqi seruetiouiq
seruetioiuq seruetioiqu seruetiqoui seruetiqoiu seruetiquoi seruetiquio seruetiqiuo seruetiqiou seruetiuqoi seruetiuqio
seruetiuoqi seruetiuoiq seruetiuioq seruetiuiqo seruetiiquo seruetiiqou seruetiiuqo seruetiiuoq seruetiiouq seruetiioqu
serueitoqui serueitoqiu serueitouqi serueitouiq serueitoiuq serueitoiqu serueitqoui serueitqoiu serueitquoi serueitquio
serueitqiuo serueitqiou serueituqoi serueituqio serueituoqi serueituoiq serueituioq serueituiqo serueitiquo serueitiqou
serueitiuqo serueitiuoq serueitiouq serueitioqu serueiotqui serueiotqiu serueiotuqi serueiotuiq serueiotiuq serueiotiqu
serueioqtui serueioqtiu serueioquti serueioquit serueioqiut serueioqitu serueiouqti serueiouqit serueioutqi serueioutiq
serueiouitq serueiouiqt serueioiqut serueioiqtu serueioiuqt serueioiutq serueioituq serueioitqu serueiqotui serueiqotiu
serueiqouti serueiqouit serueiqoiut serueiqoitu serueiqtoui serueiqtoiu serueiqtuoi serueiqtuio serueiqtiuo serueiqtiou
serueiqutoi serueiqutio serueiquoti serueiquoit serueiquiot serueiquito serueiqituo serueiqitou serueiqiuto serueiqiuot
serueiqiout serueiqiotu serueiuoqti serueiuoqit serueiuotqi serueiuotiq serueiuoitq serueiuoiqt serueiuqoti serueiuqoit
serueiuqtoi serueiuqtio serueiuqito serueiuqiot serueiutqoi serueiutqio serueiutoqi serueiutoiq serueiutioq serueiutiqo
serueiuiqto serueiuiqot serueiuitqo serueiuitoq serueiuiotq serueiuioqt serueiioqut serueiioqtu serueiiouqt serueiioutq
serueiiotuq serueiiotqu serueiiqout serueiiqotu serueiiquot serueiiquto serueiiqtuo serueiiqtou serueiiuqot serueiiuqto
serueiiuoqt serueiiuotq serueiiutoq serueiiutqo serueiitquo serueiitqou serueiituqo serueiituoq serueiitouq serueiitoqu
serueoitqui serueoitqiu serueoituqi serueoituiq serueoitiuq serueoitiqu serueoiqtui serueoiqtiu serueoiquti serueoiquit
serueoiqiut serueoiqitu serueoiuqti serueoiuqit serueoiutqi serueoiutiq serueoiuitq serueoiuiqt serueoiiqut serueoiiqtu
serueoiiuqt serueoiiutq serueoiituq serueoiitqu serueotiqui serueotiqiu serueotiuqi serueotiuiq serueotiiuq serueotiiqu
serueotqiui serueotqiiu serueotquii serueotquii serueotqiui serueotqiiu serueotuqii serueotuqii serueotuiqi serueotuiiq
serueotuiiq serueotuiqi serueotiqui serueotiqiu serueotiuqi serueotiuiq serueotiiuq serueotiiqu serueoqtiui serueoqtiiu
serueoqtuii serueoqtuii serueoqtiui serueoqtiiu serueoqitui serueoqitiu serueoqiuti serueoqiuit serueoqiiut serueoqiitu
serueoquiti serueoquiit serueoqutii serueoqutii serueoquiti serueoquiit serueoqiiut serueoqiitu serueoqiuit serueoqiuti
serueoqitui serueoqitiu serueoutqii serueoutqii serueoutiqi serueoutiiq serueoutiiq serueoutiqi serueouqtii serueouqtii
serueouqiti serueouqiit serueouqiit serueouqiti serueouiqti serueouiqit serueouitqi serueouitiq serueouiitq serueouiiqt
serueouiqit serueouiqti serueouiiqt serueouiitq serueouitiq serueouitqi serueoitqui serueoitqiu serueoituqi serueoituiq
serueoitiuq serueoitiqu serueoiqtui serueoiqtiu serueoiquti serueoiquit serueoiqiut serueoiqitu serueoiuqti serueoiuqit
serueoiutqi serueoiutiq serueoiuitq serueoiuiqt serueoiiqut serueoiiqtu serueoiiuqt serueoiiutq serueoiituq serueoiitqu
serueqiotui serueqiotiu serueqiouti serueqiouit serueqioiut serueqioitu serueqitoui serueqitoiu serueqituoi serueqituio
serueqitiuo serueqitiou serueqiutoi serueqiutio serueqiuoti serueqiuoit serueqiuiot serueqiuito serueqiituo serueqiitou
serueqiiuto serueqiiuot serueqiiout serueqiiotu serueqoitui serueqoitiu serueqoiuti serueqoiuit serueqoiiut serueqoiitu
serueqotiui serueqotiiu serueqotuii serueqotuii serueqotiui serueqotiiu serueqoutii serueqoutii serueqouiti serueqouiit
serueqouiit serueqouiti serueqoitui serueqoitiu serueqoiuti serueqoiuit serueqoiiut serueqoiitu serueqtoiui serueqtoiiu
serueqtouii serueqtouii serueqtoiui serueqtoiiu serueqtioui serueqtioiu serueqtiuoi serueqtiuio serueqtiiuo serueqtiiou
serueqtuioi serueqtuiio serueqtuoii serueqtuoii serueqtuioi serueqtuiio serueqtiiuo serueqtiiou serueqtiuio serueqtiuoi
serueqtioui serueqtioiu seruequotii seruequotii seruequoiti seruequoiit seruequoiit seruequoiti seruequtoii seruequtoii
seruequtioi seruequtiio seruequtiio seruequtioi seruequitoi seruequitio seruequioti seruequioit seruequiiot seruequiito
seruequitio seruequitoi seruequiito seruequiiot seruequioit seruequioti serueqiotui serueqiotiu serueqiouti serueqiouit
serueqioiut serueqioitu serueqitoui serueqitoiu serueqituoi serueqituio serueqitiuo serueqitiou serueqiutoi serueqiutio
serueqiuoti serueqiuoit serueqiuiot serueqiuito serueqiituo serueqiitou serueqiiuto serueqiiuot serueqiiout serueqiiotu
serueuioqti serueuioqit serueuiotqi serueuiotiq serueuioitq serueuioiqt serueuiqoti serueuiqoit serueuiqtoi serueuiqtio
serueuiqito serueuiqiot serueuitqoi serueuitqio serueuitoqi serueuitoiq serueuitioq serueuitiqo serueuiiqto serueuiiqot
serueuiitqo serueuiitoq serueuiiotq serueuiioqt serueuoiqti serueuoiqit serueuoitqi serueuoitiq serueuoiitq serueuoiiqt
serueuoqiti serueuoqiit serueuoqtii serueuoqtii serueuoqiti serueuoqiit serueuotqii serueuotqii serueuotiqi serueuotiiq
serueuotiiq serueuotiqi serueuoiqti serueuoiqit serueuoitqi serueuoitiq serueuoiitq serueuoiiqt serueuqoiti serueuqoiit
serueuqotii serueuqotii serueuqoiti serueuqoiit serueuqioti serueuqioit serueuqitoi serueuqitio serueuqiito serueuqiiot
serueuqtioi serueuqtiio serueuqtoii serueuqtoii serueuqtioi serueuqtiio serueuqiito serueuqiiot serueuqitio serueuqitoi
serueuqioti serueuqioit serueutoqii serueutoqii serueutoiqi serueutoiiq serueutoiiq serueutoiqi serueutqoii serueutqoii
serueutqioi serueutqiio serueutqiio serueutqioi serueutiqoi serueutiqio serueutioqi serueutioiq serueutiioq serueutiiqo
serueutiqio serueutiqoi serueutiiqo serueutiioq serueutioiq serueutioqi serueuioqti serueuioqit serueuiotqi serueuiotiq
serueuioitq serueuioiqt serueuiqoti serueuiqoit serueuiqtoi serueuiqtio serueuiqito serueuiqiot serueuitqoi serueuitqio
serueuitoqi serueuitoiq serueuitioq serueuitiqo serueuiiqto serueuiiqot serueuiitqo serueuiitoq serueuiiotq serueuiioqt
serueiioqut serueiioqtu serueiiouqt serueiioutq serueiiotuq serueiiotqu serueiiqout serueiiqotu serueiiquot serueiiquto
serueiiqtuo serueiiqtou serueiiuqot serueiiuqto serueiiuoqt serueiiuotq serueiiutoq serueiiutqo serueiitquo serueiitqou
serueiituqo serueiituoq serueiitouq serueiitoqu serueioiqut serueioiqtu serueioiuqt serueioiutq serueioituq serueioitqu
serueioqiut serueioqitu serueioquit serueioquti serueioqtui serueioqtiu serueiouqit serueiouqti serueiouiqt serueiouitq
serueioutiq serueioutqi serueiotqui serueiotqiu serueiotuqi serueiotuiq serueiotiuq serueiotiqu serueiqoiut serueiqoitu
serueiqouit serueiqouti serueiqotui serueiqotiu serueiqiout serueiqiotu serueiqiuot serueiqiuto serueiqituo serueiqitou
serueiquiot serueiquito serueiquoit serueiquoti serueiqutoi serueiqutio serueiqtiuo serueiqtiou serueiqtuio serueiqtuoi
serueiqtoui serueiqtoiu serueiuoqit serueiuoqti serueiuoiqt serueiuoitq serueiuotiq serueiuotqi serueiuqoit serueiuqoti
serueiuqiot serueiuqito serueiuqtio serueiuqtoi serueiuiqot serueiuiqto serueiuioqt serueiuiotq serueiuitoq serueiuitqo
serueiutqio serueiutqoi serueiutiqo serueiutioq serueiutoiq serueiutoqi serueitoqui serueitoqiu serueitouqi serueitouiq
serueitoiuq serueitoiqu serueitqoui serueitqoiu serueitquoi serueitquio serueitqiuo serueitqiou serueituqoi serueituqio
serueituoqi serueituoiq serueituioq serueituiqo serueitiquo serueitiqou serueitiuqo serueitiuoq serueitiouq serueitioqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us