easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

pyritaceous

rester

empetraceous

klava

overspeak

mandament

myelosyphilis

fascial

romaeque

hirofumi

thermonatrite

pscni

baronetical

presentatively

reformandum

thermochemistry

marconia

vermicellis


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: semsem
cipher variations:
tfntfn ugougo vhpvhp wiqwiq xjrxjr
yksyks zltzlt amuamu bnvbnv cowcow
dpxdpx eqyeqy frzfrz gsagsa htbhtb
iuciuc jvdjvd kwekwe lxflxf mygmyg
nzhnzh oaioai pbjpbj qckqck rdlrdl

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: semsem
Cipher: hvnhvn

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: semsem
Cipher: BAAAB AABAA ABABB BAAAB AABAA ABABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: semsem
cipher variations:
tfntfndnldnlnvjnvjxdhxdhhlfhlfrtdrtdljzljzvrxvrx
fzvfzvphtphtzprzprjxpjxpugougoeomeomowkowkyeiyei
imgimgsuesuemkamkawsywsygawgawqiuqiuaqsaqskyqkyq
vhpvhpfpnfpnpxlpxlzfjzfjjnhjnhtvftvfnlbnlbxtzxtz
hbxhbxrjvrjvbrtbrtlzrlzrwiqwiqgqogqoqymqymagkagk
koikoiuwguwgomcomcyuayuaicyicyskwskwcsucsumasmas
xjrxjrhrphrprznrznbhlbhllpjlpjvxhvxhpndpndzvbzvb
jdzjdztlxtlxdtvdtvnbtnbtyksyksisqisqsaosaocimcim
mqkmqkwyiwyiqoeqoeawcawckeakeaumyumyeuweuwocuocu
zltzltjtrjtrtbptbpdjndjnnrlnrlxzjxzjrpfrpfbxdbxd
lfblfbvnzvnzfvxfvxpdvpdvamuamukuskusucqucqekoeko
osmosmyakyaksqgsqgcyecyemgcmgcwoawoagwygwyqewqew
bnvbnvlvtlvtvdrvdrflpflpptnptnzblzbltrhtrhdzfdzf
nhdnhdxpbxpbhxzhxzrfxrfxcowcowmwumwuweswesgmqgmq
quoquoacmacmusiusieageagoieoieyqcyqciyaiyasgysgy
dpxdpxnxvnxvxftxfthnrhnrrvprvpbdnbdnvtjvtjfbhfbh
pjfpjfzrdzrdjzbjzbthzthzeqyeqyoywoywyguyguiosios
swqswqceoceowukwukgcigciqkgqkgaseasekackacuiauia
frzfrzpzxpzxzhvzhvjptjpttxrtxrdfpdfpxvlxvlhdjhdj
rlhrlhbtfbtflbdlbdvjbvjbgsagsaqayqayaiwaiwkqukqu
uysuysegqegqywmywmiekieksmismicugcugmcemcewkcwkc
htbhtbrbzrbzbjxbjxlrvlrvvztvztfhrfhrzxnzxnjfljfl
tnjtnjdvhdvhndfndfxldxldiuciucscascackyckymswmsw
wauwaugisgisayoayokgmkgmuokuokewiewioegoegymeyme
jvdjvdtdbtdbdlzdlzntxntxxbvxbvhjthjtbzpbzplhnlhn
vplvplfxjfxjpfhpfhznfznfkwekweuecuecemaemaouyouy
ycwycwikuikucaqcaqmiomiowqmwqmgykgykqgiqgiaogaog
lxflxfvfdvfdfnbfnbpvzpvzzdxzdxjlvjlvdbrdbrnjpnjp
xrnxrnhzlhzlrhjrhjbphbphmygmygwgewgegocgocqwaqwa
aeyaeykmwkmwecsecsokqokqysoysoiamiamsiksikcqicqi
nzhnzhxhfxhfhpdhpdrxbrxbbfzbfzlnxlnxfdtfdtplrplr
ztpztpjbnjbntjltjldrjdrjoaioaiyigyigiqeiqesycsyc
cgacgamoymoygeugeuqmsqmsauqauqkcokcoukmukmeskesk
pbjpbjzjhzjhjrfjrftzdtzddhbdhbnpznpzhfvhfvrntrnt
bvrbvrldpldpvlnvlnftlftlqckqckakiakiksgksguaeuae
eiceicoqaoqaigwigwsousoucwscwsmeqmeqwmowmogumgum
rdlrdlbljbljlthlthvbfvbffjdfjdprbprbjhxjhxtpvtpv
dxtdxtnfrnfrxnpxnphvnhvnsemsemcmkcmkmuimuiwcgwcg
gkegkeqscqsckiykiyuqwuqweyueyuogsogsyoqyoqiwoiwo

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: semsem
Cipher: frzfrz

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: semsem
Cipher: 345123345123

Extended Methods:
Method #1

Plaintext: semsem
method variations:
xkrxkrcpwcpwhubhubnzgnzg

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s e m s e m 
3 5 2 3 5 2 
4 1 3 4 1 3 
They are then read out in rows:
352352413413
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: semsem
Cipher: xmkdsl

Read more ...
Method #3

Plaintext: semsem
method variations:
yfnyfn fnyfny nyfnyf
yfnyfn fnyfny nyfnyf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: semsem

all 720 cipher variations:
semsem semsme semesm semems semmes semmse sesmem sesmme sesemm sesemm sesmem
sesmme seesmm seesmm seemsm seemms seemms seemsm semsem semsme semesm semems
semmes semmse smesem smesme smeesm smeems smemes smemse smseem smseme smseem
smseme smsmee smsmee smesem smesme smeesm smeems smemes smemse smmsee smmsee
smmese smmees smmees smmese ssmeem ssmeme ssmeem ssmeme ssmmee ssmmee ssemem
ssemme sseemm sseemm ssemem ssemme sseemm sseemm ssemem ssemme ssemme ssemem
ssmeem ssmeme ssmeem ssmeme ssmmee ssmmee semsem semsme semesm semems semmes
semmse sesmem sesmme sesemm sesemm sesmem sesmme seesmm seesmm seemsm seemms
seemms seemsm semsem semsme semesm semems semmes semmse smmsee smmsee smmese
smmees smmees smmese smsmee smsmee smseme smseem smseem smseme smesme smesem
smemse smemes smeems smeesm smesem smesme smeesm smeems smemes smemse esmsem
esmsme esmesm esmems esmmes esmmse essmem essmme essemm essemm essmem essmme
esesmm esesmm esemsm esemms esemms esemsm esmsem esmsme esmesm esmems esmmes
esmmse emssem emssme emsesm emsems emsmes emsmse emssem emssme emsesm emsems
emsmes emsmse emessm emesms emessm emesms ememss ememss emmses emmsse emmess
emmess emmses emmsse esmsem esmsme esmesm esmems esmmes esmmse essmem essmme
essemm essemm essmem essmme esesmm esesmm esemsm esemms esemms esemsm esmsem
esmsme esmesm esmems esmmes esmmse eemssm eemsms eemssm eemsms eemmss eemmss
eesmsm eesmms eessmm eessmm eesmsm eesmms eessmm eessmm eesmsm eesmms eesmms
eesmsm eemssm eemsms eemssm eemsms eemmss eemmss emmses emmsse emmess emmess
emmses emmsse emsmes emsmse emsems emsesm emssem emssme emesms emessm ememss
ememss emesms emessm emssem emssme emsesm emsems emsmes emsmse messem messme
mesesm mesems mesmes mesmse messem messme mesesm mesems mesmes mesmse meessm
meesms meessm meesms meemss meemss memses memsse memess memess memses memsse
msesem msesme mseesm mseems msemes msemse msseem msseme msseem msseme mssmee
mssmee msesem msesme mseesm mseems msemes msemse msmsee msmsee msmese msmees
msmees msmese msseem msseme msseem msseme mssmee mssmee msesem msesme mseesm
mseems msemes msemse mseesm mseems msesem msesme msemse msemes msmees msmese
msmees msmese msmsee msmsee messem messme mesesm mesems mesmes mesmse messem
messme mesesm mesems mesmes mesmse meessm meesms meessm meesms meemss meemss
memses memsse memess memess memses memsse mmssee mmssee mmsese mmsees mmsees
mmsese mmssee mmssee mmsese mmsees mmsees mmsese mmesse mmeses mmesse mmeses
mmeess mmeess mmeses mmesse mmeess mmeess mmeses mmesse semsem semsme semesm
semems semmes semmse sesmem sesmme sesemm sesemm sesmem sesmme seesmm seesmm
seemsm seemms seemms seemsm semsem semsme semesm semems semmes semmse smesem
smesme smeesm smeems smemes smemse smseem smseme smseem smseme smsmee smsmee
smesem smesme smeesm smeems smemes smemse smmsee smmsee smmese smmees smmees
smmese ssmeem ssmeme ssmeem ssmeme ssmmee ssmmee ssemem ssemme sseemm sseemm
ssemem ssemme sseemm sseemm ssemem ssemme ssemme ssemem ssmeem ssmeme ssmeem
ssmeme ssmmee ssmmee semsem semsme semesm semems semmes semmse sesmem sesmme
sesemm sesemm sesmem sesmme seesmm seesmm seemsm seemms seemms seemsm semsem
semsme semesm semems semmes semmse smmsee smmsee smmese smmees smmees smmese
smsmee smsmee smseme smseem smseem smseme smesme smesem smemse smemes smeems
smeesm smesem smesme smeesm smeems smemes smemse eemssm eemsms eemssm eemsms
eemmss eemmss eesmsm eesmms eessmm eessmm eesmsm eesmms eessmm eessmm eesmsm
eesmms eesmms eesmsm eemssm eemsms eemssm eemsms eemmss eemmss emessm emesms
emessm emesms ememss ememss emsesm emsems emssem emssme emsmse emsmes emssem
emssme emsesm emsems emsmes emsmse emmsse emmses emmsse emmses emmess emmess
esmesm esmems esmsem esmsme esmmse esmmes esemsm esemms esesmm esesmm esemsm
esemms essemm essemm essmem essmme essmme essmem esmesm esmems esmsem esmsme
esmmse esmmes esmsem esmsme esmesm esmems esmmes esmmse essmem essmme essemm
essemm essmem essmme esesmm esesmm esemsm esemms esemms esemsm esmsem esmsme
esmesm esmems esmmes esmmse emmsse emmses emmsse emmses emmess emmess emsmse
emsmes emssme emssem emsesm emsems emssme emssem emsmse emsmes emsems emsesm
emessm emesms emessm emesms ememss ememss memses memsse memess memess memses
memsse mesmes mesmse mesems mesesm messem messme meesms meessm meemss meemss
meesms meessm messem messme mesesm mesems mesmes mesmse mmeses mmesse mmeess
mmeess mmeses mmesse mmsees mmsese mmsees mmsese mmssee mmssee mmeses mmesse
mmeess mmeess mmeses mmesse mmssee mmssee mmsese mmsees mmsees mmsese msmees
msmese msmees msmese msmsee msmsee msemes msemse mseems mseesm msesem msesme
mseems mseesm msemes msemse msesme msesem msseem msseme msseem msseme mssmee
mssmee memses memsse memess memess memses memsse mesmes mesmse mesems mesesm
messem messme meesms meessm meemss meemss meesms meessm messem messme mesesm
mesems mesmes mesmse msmsee msmsee msmese msmees msmees msmese mssmee mssmee
msseme msseem msseem msseme msesme msesem msemse msemes mseems mseesm msesem
msesme mseesm mseems msemes msemse

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us