easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

margarette

diadochokinesia

fretz

neukomm

fainted

ringdove

judica

taylorii

evangelatos

catastrophically

malleabilities

bestridden

filanders

scaly

glutamates

namesrv

malomirovo

aitesis


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: seemless
cipher variations:
tffnmftt uggonguu vhhpohvv wiiqpiww xjjrqjxx
ykksrkyy zlltslzz ammutmaa bnnvunbb coowvocc
dppxwpdd eqqyxqee frrzyrff gssazsgg httbathh
iuucbuii jvvdcvjj kwwedwkk lxxfexll myygfymm
nzzhgznn oaaihaoo pbbjibpp qcckjcqq rddlkdrr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: seemless
Cipher: hvvnovhh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: seemless
Cipher: BAAAB AABAA AABAA ABABB ABABA AABAA BAAAB BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: seemless
cipher variations:
tffnmfttdnnlinddnvvjevnnxddhadxxhllfwlhhrttdstrrljjzkjllvrrxgrvv
fzzvczffphhtyhppzpprupzzjxxpqxjjuggonguueoomjoeeowwkfwooyeeibeyy
immgxmiisuuetussmkkalkmmwssyhswwgaawdaggqiiuziqqaqqsvqaakyyqrykk
vhhpohvvfppnkpffpxxlgxppzffjcfzzjnnhynjjtvvfuvttnllbmlnnxttzitxx
hbbxebhhrjjvajrrbrrtwrbblzzrszllwiiqpiwwgqqolqggqyymhyqqaggkdgaa
kooizokkuwwgvwuuommcnmooyuuajuyyiccyfciiskkwbksscssuxsccmaastamm
xjjrqjxxhrrpmrhhrzznizrrbhhlehbblppjapllvxxhwxvvpnndonppzvvbkvzz
jddzgdjjtllxclttdttvytddnbbtubnnykksrkyyissqnsiisaaojassciimficc
mqqkbqmmwyyixywwqooepoqqawwclwaakeeahekkummydmuueuuwzueeoccuvcoo
zlltslzzjttrotjjtbbpkbttdjjngjddnrrlcrnnxzzjyzxxrppfqprrbxxdmxbb
lffbifllvnnzenvvfvvxavffpddvwdppammutmaakuuspukkuccqlcuuekkohkee
ossmdsooyaakzayysqqgrqsscyyenyccmggcjgmmwooafowwgwwybwggqeewxeqq
bnnvunbblvvtqvllvddrmdvvfllpilffpttnetppzbblabzztrrhsrttdzzfozdd
nhhdkhnnxppbgpxxhxxzcxhhrffxyfrrcoowvoccmwwurwmmweesnewwgmmqjmgg
quuofuqqaccmbcaaussitsuueaagpaeeoiieliooyqqchqyyiyyadyiisggyzgss
dppxwpddnxxvsxnnxfftofxxhnnrknhhrvvpgvrrbddncdbbvttjutvvfbbhqbff
pjjfmjppzrrdirzzjzzbezjjthhzahtteqqyxqeeoyywtyooyggupgyyioosloii
swwqhwssceeodeccwuukvuwwgccircggqkkgnkqqassejsaakaacfakkuiiabiuu
frrzyrffpzzxuzppzhhvqhzzjpptmpjjtxxrixttdffpefddxvvlwvxxhddjsdhh
rllholrrbttfktbblbbdgbllvjjbcjvvgssazsggqaayvaqqaiiwriaakqqunqkk
uyysjyuueggqfgeeywwmxwyyieekteiismmipmsscuugluccmccehcmmwkkcdkww
httbathhrbbzwbrrbjjxsjbblrrvorllvzztkzvvfhhrghffzxxnyxzzjfflufjj
tnnjqnttdvvhmvddnddfidnnxlldelxxiuucbuiisccaxcssckkytkccmsswpsmm
waaulawwgiishiggayyozyaakggmvgkkuookrouuewwinweeoeegjeooymmefmyy
jvvdcvjjtddbydttdllzulddnttxqtnnxbbvmbxxhjjtijhhbzzpazbblhhnwhll
vpplspvvfxxjoxffpffhkfppznnfgnzzkwwedwkkueeczeuuemmavmeeouuyruoo
yccwncyyikkujkiicaaqbaccmiioximmwqqmtqwwgyykpyggqggilgqqaooghoaa
lxxfexllvffdafvvfnnbwnffpvvzsvppzddxodzzjllvkljjdbbrcbddnjjpyjnn
xrrnurxxhzzlqzhhrhhjmhrrbpphipbbmyygfymmwggebgwwgoocxoggqwwatwqq
aeeypeaakmmwlmkkeccsdceeokkqzkooyssovsyyiaamraiisiiknisscqqijqcc
nzzhgznnxhhfchxxhppdyphhrxxbuxrrbffzqfbblnnxmnllfddtedffpllralpp
zttpwtzzjbbnsbjjtjjlojttdrrjkrddoaaihaooyiigdiyyiqqezqiisyycvyss
cggargccmooynommgeeufeggqmmsbmqqauuqxuaakccotckkukkmpkuuessklsee
pbbjibppzjjhejzzjrrfarjjtzzdwzttdhhbshddnppzopnnhffvgfhhrnntcnrr
bvvryvbblddpudllvllnqlvvfttlmtffqcckjcqqakkifkaakssgbskkuaaexauu
eiictieeoqqapqooiggwhgiisooudosscwwszwccmeeqvemmwmmormwwguumnugg
rddlkdrrblljglbbltthctllvbbfybvvfjjdujffprrbqrppjhhxihjjtppveptt
dxxtaxddnffrwfnnxnnpsnxxhvvnovhhseemlesscmmkhmccmuuidummwccgzcww
gkkevkggqsscrsqqkiiyjikkuqqwfquueyyubyeeoggsxgooyooqtoyyiwwopwii

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: seemless
Cipher: frrzyrff

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: seemless
Cipher: 3451512313513434

Extended Methods:
Method #1

Plaintext: seemless
method variations:
xkkrqkxxcppwvpcchuubauhhnzzgfznn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s e e m l e s s 
3 5 5 2 1 5 3 3 
4 1 1 3 3 1 4 4 
They are then read out in rows:
3552153341133144
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: seemless
Cipher: xkvndlct

Read more ...
Method #3

Plaintext: seemless
method variations:
yvfcxloo vfcxlooy fcxlooyv
cxlooyvf xlooyvfc looyvfcx
ooyvfcxl oyvfcxlo

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: seemless

first 5040 cipher variations(40320 total)
seemless seemless seemlses seemlsse seemlsse seemlses seemelss seemelss seemesls seemessl seemessl
seemesls seemsels seemsesl seemsles seemslse seemssle seemssel seemsesl seemsels seemssel seemssle
seemslse seemsles seelmess seelmess seelmses seelmsse seelmsse seelmses seelemss seelemss seelesms
seelessm seelessm seelesms seelsems seelsesm seelsmes seelsmse seelssme seelssem seelsesm seelsems
seelssem seelssme seelsmse seelsmes seeelmss seeelmss seeelsms seeelssm seeelssm seeelsms seeemlss
seeemlss seeemsls seeemssl seeemssl seeemsls seeesmls seeesmsl seeeslms seeeslsm seeesslm seeessml
seeesmsl seeesmls seeessml seeesslm seeeslsm seeeslms seeslems seeslesm seeslmes seeslmse seeslsme
seeslsem seeselms seeselsm seesemls seesemsl seesesml seeseslm seesmels seesmesl seesmles seesmlse
seesmsle seesmsel seesseml seesselm seessmel seessmle seesslme seesslem seeslesm seeslems seeslsem
seeslsme seeslmse seeslmes seeselsm seeselms seeseslm seesesml seesemsl seesemls seesselm seesseml
seesslem seesslme seessmle seessmel seesmesl seesmels seesmsel seesmsle seesmlse seesmles semeless
semeless semelses semelsse semelsse semelses semeelss semeelss semeesls semeessl semeessl semeesls
semesels semesesl semesles semeslse semessle semessel semesesl semesels semessel semessle semeslse
semesles semleess semleess semleses semlesse semlesse semleses semleess semleess semleses semlesse
semlesse semleses semlsees semlsese semlsees semlsese semlssee semlssee semlsese semlsees semlssee
semlssee semlsese semlsees semeless semeless semelses semelsse semelsse semelses semeelss semeelss
semeesls semeessl semeessl semeesls semesels semesesl semesles semeslse semessle semessel semesesl
semesels semessel semessle semeslse semesles semslees semslese semslees semslese semslsee semslsee
semseles semselse semseels semseesl semsesel semsesle semseels semseesl semseles semselse semsesle
semsesel semsseel semssele semsseel semssele semsslee semsslee semslese semslees semslsee semslsee
semslese semslees semselse semseles semsesle semsesel semseesl semseels semssele semsseel semsslee
semsslee semssele semsseel semseesl semseels semsesel semsesle semselse semseles selmeess selmeess
selmeses selmesse selmesse selmeses selmeess selmeess selmeses selmesse selmesse selmeses selmsees
selmsese selmsees selmsese selmssee selmssee selmsese selmsees selmssee selmssee selmsese selmsees
selemess selemess selemses selemsse selemsse selemses seleemss seleemss seleesms seleessm seleessm
seleesms selesems selesesm selesmes selesmse selessme selessem selesesm selesems selessem selessme
selesmse selesmes seleemss seleemss seleesms seleessm seleessm seleesms selemess selemess selemses
selemsse selemsse selemses selesmes selesmse selesems selesesm selessem selessme selesmse selesmes
selessme selessem selesesm selesems selseems selseesm selsemes selsemse selsesme selsesem selseems
selseesm selsemes selsemse selsesme selsesem selsmees selsmese selsmees selsmese selsmsee selsmsee
selsseme selsseem selssmee selssmee selsseme selsseem selseesm selseems selsesem selsesme selsemse
selsemes selseesm selseems selsesem selsesme selsemse selsemes selsseem selsseme selsseem selsseme
selssmee selssmee selsmese selsmees selsmsee selsmsee selsmese selsmees seemless seemless seemlses
seemlsse seemlsse seemlses seemelss seemelss seemesls seemessl seemessl seemesls seemsels seemsesl
seemsles seemslse seemssle seemssel seemsesl seemsels seemssel seemssle seemslse seemsles seelmess
seelmess seelmses seelmsse seelmsse seelmses seelemss seelemss seelesms seelessm seelessm seelesms
seelsems seelsesm seelsmes seelsmse seelssme seelssem seelsesm seelsems seelssem seelssme seelsmse
seelsmes seeelmss seeelmss seeelsms seeelssm seeelssm seeelsms seeemlss seeemlss seeemsls seeemssl
seeemssl seeemsls seeesmls seeesmsl seeeslms seeeslsm seeesslm seeessml seeesmsl seeesmls seeessml
seeesslm seeeslsm seeeslms seeslems seeslesm seeslmes seeslmse seeslsme seeslsem seeselms seeselsm
seesemls seesemsl seesesml seeseslm seesmels seesmesl seesmles seesmlse seesmsle seesmsel seesseml
seesselm seessmel seessmle seesslme seesslem seeslesm seeslems seeslsem seeslsme seeslmse seeslmes
seeselsm seeselms seeseslm seesesml seesemsl seesemls seesselm seesseml seesslem seesslme seessmle
seessmel seesmesl seesmels seesmsel seesmsle seesmlse seesmles sesmlees sesmlese sesmlees sesmlese
sesmlsee sesmlsee sesmeles sesmelse sesmeels sesmeesl sesmesel sesmesle sesmeels sesmeesl sesmeles
sesmelse sesmesle sesmesel sesmseel sesmsele sesmseel sesmsele sesmslee sesmslee seslmees seslmese
seslmees seslmese seslmsee seslmsee seslemes seslemse sesleems sesleesm seslesem seslesme sesleems
sesleesm seslemes seslemse seslesme seslesem seslseem seslseme seslseem seslseme seslsmee seslsmee
seselmes seselmse seselems seselesm seselsem seselsme sesemles sesemlse sesemels sesemesl sesemsel
sesemsle seseemls seseemsl seseelms seseelsm seseeslm seseesml sesesmel sesesmle seseseml seseselm
seseslem seseslme seselems seselesm seselmes seselmse seselsme seselsem seseelms seseelsm seseemls
seseemsl seseesml seseeslm sesemels sesemesl sesemles sesemlse sesemsle sesemsel seseseml seseselm
sesesmel sesesmle seseslme seseslem sessleem sessleme sessleem sessleme sesslmee sesslmee sesselem
sesselme sesseelm sesseeml sessemel sessemle sesseelm sesseeml sesselem sesselme sessemle sessemel
sessmeel sessmele sessmeel sessmele sessmlee sessmlee sesmlese sesmlees sesmlsee sesmlsee sesmlese
sesmlees sesmelse sesmeles sesmesle sesmesel sesmeesl sesmeels sesmsele sesmseel sesmslee sesmslee
sesmsele sesmseel sesmeesl sesmeels sesmesel sesmesle sesmelse sesmeles seslmese seslmees seslmsee
seslmsee seslmese seslmees seslemse seslemes seslesme seslesem sesleesm sesleems seslseme seslseem
seslsmee seslsmee seslseme seslseem sesleesm sesleems seslesem seslesme seslemse seslemes seselmse
seselmes seselsme seselsem seselesm seselems sesemlse sesemles sesemsle sesemsel sesemesl sesemels
sesesmle sesesmel seseslme seseslem seseselm seseseml seseemsl seseemls seseesml seseeslm seseelsm
seseelms sessleme sessleem sesslmee sesslmee sessleme sessleem sesselme sesselem sessemle sessemel
sesseeml sesseelm sessmele sessmeel sessmlee sessmlee sessmele sessmeel sesseeml sesseelm sessemel
sessemle sesselme sesselem seselesm seselems seselsem seselsme seselmse seselmes seseelsm seseelms
seseeslm seseesml seseemsl seseemls seseselm seseseml seseslem seseslme sesesmle sesesmel sesemesl
sesemels sesemsel sesemsle sesemlse sesemles seemless seemless seemlses seemlsse seemlsse seemlses
seemelss seemelss seemesls seemessl seemessl seemesls seemsels seemsesl seemsles seemslse seemssle
seemssel seemsesl seemsels seemssel seemssle seemslse seemsles seelmess seelmess seelmses seelmsse
seelmsse seelmses seelemss seelemss seelesms seelessm seelessm seelesms seelsems seelsesm seelsmes
seelsmse seelssme seelssem seelsesm seelsems seelssem seelssme seelsmse seelsmes seeelmss seeelmss
seeelsms seeelssm seeelssm seeelsms seeemlss seeemlss seeemsls seeemssl seeemssl seeemsls seeesmls
seeesmsl seeeslms seeeslsm seeesslm seeessml seeesmsl seeesmls seeessml seeesslm seeeslsm seeeslms
seeslems seeslesm seeslmes seeslmse seeslsme seeslsem seeselms seeselsm seesemls seesemsl seesesml
seeseslm seesmels seesmesl seesmles seesmlse seesmsle seesmsel seesseml seesselm seessmel seessmle
seesslme seesslem seeslesm seeslems seeslsem seeslsme seeslmse seeslmes seeselsm seeselms seeseslm
seesesml seesemsl seesemls seesselm seesseml seesslem seesslme seessmle seessmel seesmesl seesmels
seesmsel seesmsle seesmlse seesmles semeless semeless semelses semelsse semelsse semelses semeelss
semeelss semeesls semeessl semeessl semeesls semesels semesesl semesles semeslse semessle semessel
semesesl semesels semessel semessle semeslse semesles semleess semleess semleses semlesse semlesse
semleses semleess semleess semleses semlesse semlesse semleses semlsees semlsese semlsees semlsese
semlssee semlssee semlsese semlsees semlssee semlssee semlsese semlsees semeless semeless semelses
semelsse semelsse semelses semeelss semeelss semeesls semeessl semeessl semeesls semesels semesesl
semesles semeslse semessle semessel semesesl semesels semessel semessle semeslse semesles semslees
semslese semslees semslese semslsee semslsee semseles semselse semseels semseesl semsesel semsesle
semseels semseesl semseles semselse semsesle semsesel semsseel semssele semsseel semssele semsslee
semsslee semslese semslees semslsee semslsee semslese semslees semselse semseles semsesle semsesel
semseesl semseels semssele semsseel semsslee semsslee semssele semsseel semseesl semseels semsesel
semsesle semselse semseles selmeess selmeess selmeses selmesse selmesse selmeses selmeess selmeess
selmeses selmesse selmesse selmeses selmsees selmsese selmsees selmsese selmssee selmssee selmsese
selmsees selmssee selmssee selmsese selmsees selemess selemess selemses selemsse selemsse selemses
seleemss seleemss seleesms seleessm seleessm seleesms selesems selesesm selesmes selesmse selessme
selessem selesesm selesems selessem selessme selesmse selesmes seleemss seleemss seleesms seleessm
seleessm seleesms selemess selemess selemses selemsse selemsse selemses selesmes selesmse selesems
selesesm selessem selessme selesmse selesmes selessme selessem selesesm selesems selseems selseesm
selsemes selsemse selsesme selsesem selseems selseesm selsemes selsemse selsesme selsesem selsmees
selsmese selsmees selsmese selsmsee selsmsee selsseme selsseem selssmee selssmee selsseme selsseem
selseesm selseems selsesem selsesme selsemse selsemes selseesm selseems selsesem selsesme selsemse
selsemes selsseem selsseme selsseem selsseme selssmee selssmee selsmese selsmees selsmsee selsmsee
selsmese selsmees seemless seemless seemlses seemlsse seemlsse seemlses seemelss seemelss seemesls
seemessl seemessl seemesls seemsels seemsesl seemsles seemslse seemssle seemssel seemsesl seemsels
seemssel seemssle seemslse seemsles seelmess seelmess seelmses seelmsse seelmsse seelmses seelemss
seelemss seelesms seelessm seelessm seelesms seelsems seelsesm seelsmes seelsmse seelssme seelssem
seelsesm seelsems seelssem seelssme seelsmse seelsmes seeelmss seeelmss seeelsms seeelssm seeelssm
seeelsms seeemlss seeemlss seeemsls seeemssl seeemssl seeemsls seeesmls seeesmsl seeeslms seeeslsm
seeesslm seeessml seeesmsl seeesmls seeessml seeesslm seeeslsm seeeslms seeslems seeslesm seeslmes
seeslmse seeslsme seeslsem seeselms seeselsm seesemls seesemsl seesesml seeseslm seesmels seesmesl
seesmles seesmlse seesmsle seesmsel seesseml seesselm seessmel seessmle seesslme seesslem seeslesm
seeslems seeslsem seeslsme seeslmse seeslmes seeselsm seeselms seeseslm seesesml seesemsl seesemls
seesselm seesseml seesslem seesslme seessmle seessmel seesmesl seesmels seesmsel seesmsle seesmlse
seesmles sesmlees sesmlese sesmlees sesmlese sesmlsee sesmlsee sesmeles sesmelse sesmeels sesmeesl
sesmesel sesmesle sesmeels sesmeesl sesmeles sesmelse sesmesle sesmesel sesmseel sesmsele sesmseel
sesmsele sesmslee sesmslee seslmees seslmese seslmees seslmese seslmsee seslmsee seslemes seslemse
sesleems sesleesm seslesem seslesme sesleems sesleesm seslemes seslemse seslesme seslesem seslseem
seslseme seslseem seslseme seslsmee seslsmee seselmes seselmse seselems seselesm seselsem seselsme
sesemles sesemlse sesemels sesemesl sesemsel sesemsle seseemls seseemsl seseelms seseelsm seseeslm
seseesml sesesmel sesesmle seseseml seseselm seseslem seseslme seselems seselesm seselmes seselmse
seselsme seselsem seseelms seseelsm seseemls seseemsl seseesml seseeslm sesemels sesemesl sesemles
sesemlse sesemsle sesemsel seseseml seseselm sesesmel sesesmle seseslme seseslem sessleem sessleme
sessleem sessleme sesslmee sesslmee sesselem sesselme sesseelm sesseeml sessemel sessemle sesseelm
sesseeml sesselem sesselme sessemle sessemel sessmeel sessmele sessmeel sessmele sessmlee sessmlee
sesmlese sesmlees sesmlsee sesmlsee sesmlese sesmlees sesmelse sesmeles sesmesle sesmesel sesmeesl
sesmeels sesmsele sesmseel sesmslee sesmslee sesmsele sesmseel sesmeesl sesmeels sesmesel sesmesle
sesmelse sesmeles seslmese seslmees seslmsee seslmsee seslmese seslmees seslemse seslemes seslesme
seslesem sesleesm sesleems seslseme seslseem seslsmee seslsmee seslseme seslseem sesleesm sesleems
seslesem seslesme seslemse seslemes seselmse seselmes seselsme seselsem seselesm seselems sesemlse
sesemles sesemsle sesemsel sesemesl sesemels sesesmle sesesmel seseslme seseslem seseselm seseseml
seseemsl seseemls seseesml seseeslm seseelsm seseelms sessleme sessleem sesslmee sesslmee sessleme
sessleem sesselme sesselem sessemle sessemel sesseeml sesseelm sessmele sessmeel sessmlee sessmlee
sessmele sessmeel sesseeml sesseelm sessemel sessemle sesselme sesselem seselesm seselems seselsem
seselsme seselmse seselmes seseelsm seseelms seseeslm seseesml seseemsl seseemls seseselm seseseml
seseslem seseslme sesesmle sesesmel sesemesl sesemels sesemsel sesemsle sesemlse sesemles smeeless
smeeless smeelses smeelsse smeelsse smeelses smeeelss smeeelss smeeesls smeeessl smeeessl smeeesls
smeesels smeesesl smeesles smeeslse smeessle smeessel smeesesl smeesels smeessel smeessle smeeslse
smeesles smeleess smeleess smeleses smelesse smelesse smeleses smeleess smeleess smeleses smelesse
smelesse smeleses smelsees smelsese smelsees smelsese smelssee smelssee smelsese smelsees smelssee
smelssee smelsese smelsees smeeless smeeless smeelses smeelsse smeelsse smeelses smeeelss smeeelss
smeeesls smeeessl smeeessl smeeesls smeesels smeesesl smeesles smeeslse smeessle smeessel smeesesl
smeesels smeessel smeessle smeeslse smeesles smeslees smeslese smeslees smeslese smeslsee smeslsee
smeseles smeselse smeseels smeseesl smesesel smesesle smeseels smeseesl smeseles smeselse smesesle
smesesel smesseel smessele smesseel smessele smesslee smesslee smeslese smeslees smeslsee smeslsee
smeslese smeslees smeselse smeseles smesesle smesesel smeseesl smeseels smessele smesseel smesslee
smesslee smessele smesseel smeseesl smeseels smesesel smesesle smeselse smeseles smeeless smeeless
smeelses smeelsse smeelsse smeelses smeeelss smeeelss smeeesls smeeessl smeeessl smeeesls smeesels
smeesesl smeesles smeeslse smeessle smeessel smeesesl smeesels smeessel smeessle smeeslse smeesles
smeleess smeleess smeleses smelesse smelesse smeleses smeleess smeleess smeleses smelesse smelesse
smeleses smelsees smelsese smelsees smelsese smelssee smelssee smelsese smelsees smelssee smelssee
smelsese smelsees smeeless smeeless smeelses smeelsse smeelsse smeelses smeeelss smeeelss smeeesls
smeeessl smeeessl smeeesls smeesels smeesesl smeesles smeeslse smeessle smeessel smeesesl smeesels
smeessel smeessle smeeslse smeesles smeslees smeslese smeslees smeslese smeslsee smeslsee smeseles
smeselse smeseels smeseesl smesesel smesesle smeseels smeseesl smeseles smeselse smesesle smesesel
smesseel smessele smesseel smessele smesslee smesslee smeslese smeslees smeslsee smeslsee smeslese
smeslees smeselse smeseles smesesle smesesel smeseesl smeseels smessele smesseel smesslee smesslee
smessele smesseel smeseesl smeseels smesesel smesesle smeselse smeseles smleeess smleeess smleeses
smleesse smleesse smleeses smleeess smleeess smleeses smleesse smleesse smleeses smlesees smlesese
smlesees smlesese smlessee smlessee smlesese smlesees smlessee smlessee smlesese smlesees smleeess
smleeess smleeses smleesse smleesse smleeses smleeess smleeess smleeses smleesse smleesse smleeses
smlesees smlesese smlesees smlesese smlessee smlessee smlesese smlesees smlessee smlessee smlesese
smlesees smleeess smleeess smleeses smleesse smleesse smleeses smleeess smleeess smleeses smleesse
smleesse smleeses smlesees smlesese smlesees smlesese smlessee smlessee smlesese smlesees smlessee
smlessee smlesese smlesees smlseees smlseese smlseees smlseese smlsesee smlsesee smlseees smlseese
smlseees smlseese smlsesee smlsesee smlseees smlseese smlseees smlseese smlsesee smlsesee smlsseee
smlsseee smlsseee smlsseee smlsseee smlsseee smlseese smlseees smlsesee smlsesee smlseese smlseees
smlseese smlseees smlsesee smlsesee smlseese smlseees smlsseee smlsseee smlsseee smlsseee smlsseee
smlsseee smlseese smlseees smlsesee smlsesee smlseese smlseees smeeless smeeless smeelses smeelsse
smeelsse smeelses smeeelss smeeelss smeeesls smeeessl smeeessl smeeesls smeesels smeesesl smeesles
smeeslse smeessle smeessel smeesesl smeesels smeessel smeessle smeeslse smeesles smeleess smeleess
smeleses smelesse smelesse smeleses smeleess smeleess smeleses smelesse smelesse smeleses smelsees
smelsese smelsees smelsese smelssee smelssee smelsese smelsees smelssee smelssee smelsese smelsees
smeeless smeeless smeelses smeelsse smeelsse smeelses smeeelss smeeelss smeeesls smeeessl smeeessl
smeeesls smeesels smeesesl smeesles smeeslse smeessle smeessel smeesesl smeesels smeessel smeessle
smeeslse smeesles smeslees smeslese smeslees smeslese smeslsee smeslsee smeseles smeselse smeseels
smeseesl smesesel smesesle smeseels smeseesl smeseles smeselse smesesle smesesel smesseel smessele
smesseel smessele smesslee smesslee smeslese smeslees smeslsee smeslsee smeslese smeslees smeselse
smeseles smesesle smesesel smeseesl smeseels smessele smesseel smesslee smesslee smessele smesseel
smeseesl smeseels smesesel smesesle smeselse smeseles smselees smselese smselees smselese smselsee
smselsee smseeles smseelse smseeels smseeesl smseesel smseesle smseeels smseeesl smseeles smseelse
smseesle smseesel smseseel smsesele smseseel smsesele smseslee smseslee smsleees smsleese smsleees
smsleese smslesee smslesee smsleees smsleese smsleees smsleese smslesee smslesee smsleees smsleese
smsleees smsleese smslesee smslesee smslseee smslseee smslseee smslseee smslseee smslseee smselees
smselese smselees smselese smselsee smselsee smseeles smseelse smseeels smseeesl smseesel smseesle
smseeels smseeesl smseeles smseelse smseesle smseesel smseseel smsesele smseseel smsesele smseslee
smseslee smselees smselese smselees smselese smselsee smselsee smseeles smseelse smseeels smseeesl
smseesel smseesle smseeels smseeesl smseeles smseelse smseesle smseesel smseseel smsesele smseseel
smsesele smseslee smseslee smssleee smssleee smssleee smssleee smssleee smssleee smsselee smsselee
smsseele smsseeel smsseeel smsseele smsseele smsseeel smsselee smsselee smsseele smsseeel smsseeel
smsseele smsseeel smsseele smsselee smsselee smselese smselees smselsee smselsee smselese smselees
smseelse smseeles smseesle smseesel smseeesl smseeels smsesele smseseel smseslee smseslee smsesele
smseseel smseeesl smseeels smseesel smseesle smseelse smseeles smsleese smsleees smslesee smslesee
smsleese smsleees smsleese smsleees smslesee smslesee smsleese smsleees smslseee smslseee smslseee
smslseee smslseee smslseee smsleese smsleees smslesee smslesee smsleese smsleees smselese smselees
smselsee smselsee smselese smselees smseelse smseeles smseesle smseesel smseeesl smseeels smsesele
smseseel smseslee smseslee smsesele smseseel smseeesl smseeels smseesel smseesle smseelse smseeles
smssleee smssleee smssleee smssleee smssleee smssleee smsselee smsselee smsseele smsseeel smsseeel
smsseele smsseele smsseeel smsselee smsselee smsseele smsseeel smsseeel smsseele smsseeel smsseele
smsselee smsselee smselese smselees smselsee smselsee smselese smselees smseelse smseeles smseesle
smseesel smseeesl smseeels smsesele smseseel smseslee smseslee smsesele smseseel smseeesl smseeels
smseesel smseesle smseelse smseeles slemeess slemeess slemeses slemesse slemesse slemeses slemeess
slemeess slemeses slemesse slemesse slemeses slemsees slemsese slemsees slemsese slemssee slemssee
slemsese slemsees slemssee slemssee slemsese slemsees sleemess sleemess sleemses sleemsse sleemsse
sleemses sleeemss sleeemss sleeesms sleeessm sleeessm sleeesms sleesems sleesesm sleesmes sleesmse
sleessme sleessem sleesesm sleesems sleessem sleessme sleesmse sleesmes sleeemss sleeemss sleeesms
sleeessm sleeessm sleeesms sleemess sleemess sleemses sleemsse sleemsse sleemses sleesmes sleesmse
sleesems sleesesm sleessem sleessme sleesmse sleesmes sleessme sleessem sleesesm sleesems sleseems
sleseesm slesemes slesemse slesesme slesesem sleseems sleseesm slesemes slesemse slesesme slesesem
slesmees slesmese slesmees slesmese slesmsee slesmsee slesseme slesseem slessmee slessmee slesseme
slesseem sleseesm sleseems slesesem slesesme slesemse slesemes sleseesm sleseems slesesem slesesme
slesemse slesemes slesseem slesseme slesseem slesseme slessmee slessmee slesmese slesmees slesmsee
slesmsee slesmese slesmees slmeeess slmeeess slmeeses slmeesse slmeesse slmeeses slmeeess slmeeess
slmeeses slmeesse slmeesse slmeeses slmesees slmesese slmesees slmesese slmessee slmessee slmesese
slmesees slmessee slmessee slmesese slmesees slmeeess slmeeess slmeeses slmeesse slmeesse slmeeses
slmeeess slmeeess slmeeses slmeesse slmeesse slmeeses slmesees slmesese slmesees slmesese slmessee
slmessee slmesese slmesees slmessee slmessee slmesese slmesees slmeeess slmeeess slmeeses slmeesse
slmeesse slmeeses slmeeess slmeeess slmeeses slmeesse slmeesse slmeeses slmesees slmesese slmesees
slmesese slmessee slmessee slmesese slmesees slmessee slmessee slmesese slmesees slmseees slmseese
slmseees slmseese slmsesee slmsesee slmseees slmseese slmseees slmseese slmsesee slmsesee slmseees
slmseese slmseees slmseese slmsesee slmsesee slmsseee slmsseee slmsseee slmsseee slmsseee slmsseee
slmseese slmseees slmsesee slmsesee slmseese slmseees slmseese slmseees slmsesee slmsesee slmseese
slmseees slmsseee slmsseee slmsseee slmsseee slmsseee slmsseee slmseese slmseees slmsesee slmsesee
slmseese slmseees slemeess slemeess slemeses slemesse slemesse slemeses slemeess slemeess slemeses
slemesse slemesse slemeses slemsees slemsese slemsees slemsese slemssee slemssee slemsese slemsees
slemssee slemssee slemsese slemsees sleemess sleemess sleemses sleemsse sleemsse sleemses sleeemss
sleeemss sleeesms sleeessm sleeessm sleeesms sleesems sleesesm sleesmes sleesmse sleessme sleessem
sleesesm sleesems sleessem sleessme sleesmse sleesmes sleeemss sleeemss sleeesms sleeessm sleeessm
sleeesms sleemess sleemess sleemses sleemsse sleemsse sleemses sleesmes sleesmse sleesems sleesesm
sleessem sleessme sleesmse sleesmes sleessme sleessem sleesesm sleesems sleseems sleseesm slesemes
slesemse slesesme slesesem sleseems sleseesm slesemes slesemse slesesme slesesem slesmees slesmese
slesmees slesmese slesmsee slesmsee slesseme slesseem slessmee slessmee slesseme slesseem sleseesm
sleseems slesesem slesesme slesemse slesemes sleseesm sleseems slesesem slesesme slesemse slesemes
slesseem slesseme slesseem slesseme slessmee slessmee slesmese slesmees slesmsee slesmsee slesmese
slesmees slemeess slemeess slemeses slemesse slemesse slemeses slemeess slemeess slemeses slemesse
slemesse slemeses slemsees slemsese slemsees slemsese slemssee slemssee slemsese slemsees slemssee
slemssee slemsese slemsees sleemess sleemess sleemses sleemsse sleemsse sleemses sleeemss sleeemss
sleeesms sleeessm sleeessm sleeesms sleesems sleesesm sleesmes sleesmse sleessme sleessem sleesesm
sleesems sleessem sleessme sleesmse sleesmes sleeemss sleeemss sleeesms sleeessm sleeessm sleeesms
sleemess sleemess sleemses sleemsse sleemsse sleemses sleesmes sleesmse sleesems sleesesm sleessem
sleessme sleesmse sleesmes sleessme sleessem sleesesm sleesems sleseems sleseesm slesemes slesemse
slesesme slesesem sleseems sleseesm slesemes slesemse slesesme slesesem slesmees slesmese slesmees
slesmese slesmsee slesmsee slesseme slesseem slessmee slessmee slesseme slesseem sleseesm sleseems
slesesem slesesme slesemse slesemes sleseesm sleseems slesesem slesesme slesemse slesemes slesseem
slesseme slesseem slesseme slessmee slessmee slesmese slesmees slesmsee slesmsee slesmese slesmees
slsmeees slsmeese slsmeees slsmeese slsmesee slsmesee slsmeees slsmeese slsmeees slsmeese slsmesee
slsmesee slsmeees slsmeese slsmeees slsmeese slsmesee slsmesee slsmseee slsmseee slsmseee slsmseee
slsmseee slsmseee slsemees slsemese slsemees slsemese slsemsee slsemsee slseemes slseemse slseeems
slseeesm slseesem slseesme slseeems slseeesm slseemes slseemse slseesme slseesem slseseem slseseme
slseseem slseseme slsesmee slsesmee slseemes slseemse slseeems slseeesm slseesem slseesme slsemees
slsemese slsemees slsemese slsemsee slsemsee slseemes slseemse slseeems slseeesm slseesem slseesme
slsesmee slsesmee slseseme slseseem slseseem slseseme slseeems slseeesm slseemes slseemse slseesme
slseesem slseeems slseeesm slseemes slseemse slseesme slseesem slsemees slsemese slsemees slsemese
slsemsee slsemsee slseseme slseseem slsesmee slsesmee slseseme slseseem slsseeem slsseeme slsseeem
slsseeme slssemee slssemee slsseeem slsseeme slsseeem slsseeme slssemee slssemee slsseeem slsseeme
slsseeem slsseeme slssemee slssemee slssmeee slssmeee slssmeee slssmeee slssmeee slssmeee slsmeese
slsmeees slsmesee slsmesee slsmeese slsmeees slsmeese slsmeees slsmesee slsmesee slsmeese slsmeees
slsmseee slsmseee slsmseee slsmseee slsmseee slsmseee slsmeese slsmeees slsmesee slsmesee slsmeese
slsmeees slsemese slsemees slsemsee slsemsee slsemese slsemees slseemse slseemes slseesme slseesem
slseeesm slseeems slseseme slseseem slsesmee slsesmee slseseme slseseem slseeesm slseeems slseesem
slseesme slseemse slseemes slseemse slseemes slseesme slseesem slseeesm slseeems slsemese slsemees
slsemsee slsemsee slsemese slsemees slsesmee slsesmee slseseme slseseem slseseem slseseme slseemse
slseemes slseesme slseesem slseeesm slseeems slsseeme slsseeem slssemee slssemee slsseeme slsseeem
slsseeme slsseeem slssemee slssemee slsseeme slsseeem slssmeee slssmeee slssmeee slssmeee slssmeee
slssmeee slsseeme slsseeem slssemee slssemee slsseeme slsseeem slseeesm slseeems slseesem slseesme
slseemse slseemes slseeesm slseeems slseesem slseesme slseemse slseemes slseseem slseseme slseseem
slseseme slsesmee slsesmee slsemese slsemees slsemsee slsemsee slsemese slsemees seemless seemless
seemlses seemlsse seemlsse seemlses seemelss seemelss seemesls seemessl seemessl seemesls seemsels
seemsesl seemsles seemslse seemssle seemssel seemsesl seemsels seemssel seemssle seemslse seemsles
seelmess seelmess seelmses seelmsse seelmsse seelmses seelemss seelemss seelesms seelessm seelessm
seelesms seelsems seelsesm seelsmes seelsmse seelssme seelssem seelsesm seelsems seelssem seelssme
seelsmse seelsmes seeelmss seeelmss seeelsms seeelssm seeelssm seeelsms seeemlss seeemlss seeemsls
seeemssl seeemssl seeemsls seeesmls seeesmsl seeeslms seeeslsm seeesslm seeessml seeesmsl seeesmls
seeessml seeesslm seeeslsm seeeslms seeslems seeslesm seeslmes seeslmse seeslsme seeslsem seeselms
seeselsm seesemls seesemsl seesesml seeseslm seesmels seesmesl seesmles seesmlse seesmsle seesmsel
seesseml seesselm seessmel seessmle seesslme seesslem seeslesm seeslems seeslsem seeslsme seeslmse
seeslmes seeselsm seeselms seeseslm seesesml seesemsl seesemls seesselm seesseml seesslem seesslme
seessmle seessmel seesmesl seesmels seesmsel seesmsle seesmlse seesmles semeless semeless semelses
semelsse semelsse semelses semeelss semeelss semeesls semeessl semeessl semeesls semesels semesesl
semesles semeslse semessle semessel semesesl semesels semessel semessle semeslse semesles semleess
semleess semleses semlesse semlesse semleses semleess semleess semleses semlesse semlesse semleses
semlsees semlsese semlsees semlsese semlssee semlssee semlsese semlsees semlssee semlssee semlsese
semlsees semeless semeless semelses semelsse semelsse semelses semeelss semeelss semeesls semeessl
semeessl semeesls semesels semesesl semesles semeslse semessle semessel semesesl semesels semessel
semessle semeslse semesles semslees semslese semslees semslese semslsee semslsee semseles semselse
semseels semseesl semsesel semsesle semseels semseesl semseles semselse semsesle semsesel semsseel
semssele semsseel semssele semsslee semsslee semslese semslees semslsee semslsee semslese semslees
semselse semseles semsesle semsesel semseesl semseels semssele semsseel semsslee semsslee semssele
semsseel semseesl semseels semsesel semsesle semselse semseles selmeess selmeess selmeses selmesse
selmesse selmeses selmeess selmeess selmeses selmesse selmesse selmeses selmsees selmsese selmsees
selmsese selmssee selmssee selmsese selmsees selmssee selmssee selmsese selmsees selemess selemess
selemses selemsse selemsse selemses seleemss seleemss seleesms seleessm seleessm seleesms selesems
selesesm selesmes selesmse selessme selessem selesesm selesems selessem selessme selesmse selesmes
seleemss seleemss seleesms seleessm seleessm seleesms selemess selemess selemses selemsse selemsse
selemses selesmes selesmse selesems selesesm selessem selessme selesmse selesmes selessme selessem
selesesm selesems selseems selseesm selsemes selsemse selsesme selsesem selseems selseesm selsemes
selsemse selsesme selsesem selsmees selsmese selsmees selsmese selsmsee selsmsee selsseme selsseem
selssmee selssmee selsseme selsseem selseesm selseems selsesem selsesme selsemse selsemes selseesm
selseems selsesem selsesme selsemse selsemes selsseem selsseme selsseem selsseme selssmee selssmee
selsmese selsmees selsmsee selsmsee selsmese selsmees seemless seemless seemlses seemlsse seemlsse
seemlses seemelss seemelss seemesls seemessl seemessl seemesls seemsels seemsesl seemsles seemslse
seemssle seemssel seemsesl seemsels seemssel seemssle seemslse seemsles seelmess seelmess seelmses
seelmsse seelmsse seelmses seelemss seelemss seelesms seelessm seelessm seelesms seelsems seelsesm
seelsmes seelsmse seelssme seelssem seelsesm seelsems seelssem seelssme seelsmse seelsmes seeelmss
seeelmss seeelsms seeelssm seeelssm seeelsms seeemlss seeemlss seeemsls seeemssl seeemssl seeemsls
seeesmls seeesmsl seeeslms seeeslsm seeesslm seeessml seeesmsl seeesmls seeessml seeesslm seeeslsm
seeeslms seeslems seeslesm seeslmes seeslmse seeslsme seeslsem seeselms seeselsm seesemls seesemsl
seesesml seeseslm seesmels seesmesl seesmles seesmlse seesmsle seesmsel seesseml seesselm seessmel
seessmle seesslme seesslem seeslesm seeslems seeslsem seeslsme seeslmse seeslmes seeselsm seeselms
seeseslm seesesml seesemsl seesemls seesselm seesseml seesslem seesslme seessmle seessmel seesmesl
seesmels seesmsel seesmsle seesmlse seesmles sesmlees sesmlese sesmlees sesmlese sesmlsee sesmlsee
sesmeles sesmelse sesmeels sesmeesl sesmesel sesmesle sesmeels sesmeesl sesmeles sesmelse sesmesle
sesmesel sesmseel sesmsele sesmseel sesmsele sesmslee sesmslee seslmees seslmese seslmees seslmese
seslmsee seslmsee seslemes seslemse sesleems sesleesm seslesem seslesme sesleems sesleesm seslemes
seslemse seslesme seslesem seslseem seslseme seslseem seslseme seslsmee seslsmee seselmes seselmse
seselems seselesm seselsem seselsme sesemles sesemlse sesemels sesemesl sesemsel sesemsle seseemls
seseemsl seseelms seseelsm seseeslm seseesml sesesmel sesesmle seseseml seseselm seseslem seseslme
seselems seselesm seselmes seselmse seselsme seselsem seseelms seseelsm seseemls seseemsl seseesml
seseeslm sesemels sesemesl sesemles sesemlse sesemsle sesemsel seseseml seseselm sesesmel sesesmle
seseslme seseslem sessleem sessleme sessleem sessleme sesslmee sesslmee sesselem sesselme sesseelm
sesseeml sessemel sessemle sesseelm sesseeml sesselem sesselme sessemle sessemel sessmeel sessmele
sessmeel sessmele sessmlee sessmlee sesmlese sesmlees sesmlsee sesmlsee sesmlese sesmlees sesmelse
sesmeles sesmesle sesmesel sesmeesl sesmeels sesmsele sesmseel sesmslee sesmslee sesmsele sesmseel
sesmeesl sesmeels sesmesel sesmesle sesmelse sesmeles seslmese seslmees seslmsee seslmsee seslmese
seslmees seslemse seslemes seslesme seslesem sesleesm sesleems seslseme seslseem seslsmee seslsmee
seslseme seslseem sesleesm sesleems seslesem seslesme seslemse seslemes seselmse seselmes seselsme
seselsem seselesm seselems sesemlse sesemles sesemsle sesemsel sesemesl sesemels sesesmle sesesmel
seseslme seseslem seseselm seseseml seseemsl seseemls seseesml seseeslm seseelsm seseelms sessleme
sessleem sesslmee sesslmee sessleme sessleem sesselme sesselem sessemle sessemel sesseeml sesseelm
sessmele sessmeel sessmlee sessmlee sessmele sessmeel sesseeml sesseelm sessemel sessemle sesselme
sesselem seselesm seselems seselsem seselsme seselmse seselmes seseelsm seseelms seseeslm seseesml
seseemsl seseemls seseselm seseseml seseslem seseslme sesesmle sesesmel sesemesl sesemels sesemsel
sesemsle sesemlse sesemles ssemlees ssemlese ssemlees ssemlese ssemlsee ssemlsee ssemeles ssemelse
ssemeels ssemeesl ssemesel ssemesle ssemeels ssemeesl ssemeles ssemelse ssemesle ssemesel ssemseel
ssemsele ssemseel ssemsele ssemslee ssemslee sselmees sselmese sselmees sselmese sselmsee sselmsee
sselemes sselemse sseleems sseleesm sselesem sselesme sseleems sseleesm sselemes sselemse sselesme
sselesem sselseem sselseme sselseem sselseme sselsmee sselsmee sseelmes sseelmse sseelems sseelesm
sseelsem sseelsme sseemles sseemlse sseemels sseemesl sseemsel sseemsle sseeemls sseeemsl sseeelms
sseeelsm sseeeslm sseeesml sseesmel sseesmle sseeseml sseeselm sseeslem sseeslme sseelems sseelesm
sseelmes sseelmse sseelsme sseelsem sseeelms sseeelsm sseeemls sseeemsl sseeesml sseeeslm sseemels
sseemesl sseemles sseemlse sseemsle sseemsel sseeseml sseeselm sseesmel sseesmle sseeslme sseeslem
ssesleem ssesleme ssesleem ssesleme sseslmee sseslmee sseselem sseselme sseseelm sseseeml ssesemel
ssesemle sseseelm sseseeml sseselem sseselme ssesemle ssesemel ssesmeel ssesmele ssesmeel ssesmele
ssesmlee ssesmlee ssmelees ssmelese ssmelees ssmelese ssmelsee ssmelsee ssmeeles ssmeelse ssmeeels
ssmeeesl ssmeesel ssmeesle ssmeeels ssmeeesl ssmeeles ssmeelse ssmeesle ssmeesel ssmeseel ssmesele
ssmeseel ssmesele ssmeslee ssmeslee ssmleees ssmleese ssmleees ssmleese ssmlesee ssmlesee ssmleees
ssmleese ssmleees ssmleese ssmlesee ssmlesee ssmleees ssmleese ssmleees ssmleese ssmlesee ssmlesee
ssmlseee ssmlseee ssmlseee ssmlseee ssmlseee ssmlseee ssmelees ssmelese ssmelees ssmelese ssmelsee
ssmelsee ssmeeles ssmeelse ssmeeels ssmeeesl ssmeesel ssmeesle ssmeeels ssmeeesl ssmeeles ssmeelse
ssmeesle ssmeesel ssmeseel ssmesele ssmeseel ssmesele ssmeslee ssmeslee ssmelees ssmelese ssmelees
ssmelese ssmelsee ssmelsee ssmeeles ssmeelse ssmeeels ssmeeesl ssmeesel ssmeesle ssmeeels ssmeeesl
ssmeeles ssmeelse ssmeesle ssmeesel ssmeseel ssmesele ssmeseel ssmesele ssmeslee ssmeslee ssmsleee
ssmsleee ssmsleee ssmsleee ssmsleee ssmsleee ssmselee ssmselee ssmseele ssmseeel ssmseeel ssmseele
ssmseele ssmseeel ssmselee ssmselee ssmseele ssmseeel ssmseeel ssmseele ssmseeel ssmseele ssmselee
ssmselee sslmeees sslmeese sslmeees sslmeese sslmesee sslmesee sslmeees sslmeese sslmeees sslmeese
sslmesee sslmesee sslmeees sslmeese sslmeees sslmeese sslmesee sslmesee sslmseee sslmseee sslmseee
sslmseee sslmseee sslmseee sslemees sslemese sslemees sslemese sslemsee sslemsee ssleemes ssleemse
ssleeems ssleeesm ssleesem ssleesme ssleeems ssleeesm ssleemes ssleemse ssleesme ssleesem ssleseem
ssleseme ssleseem ssleseme sslesmee sslesmee ssleemes ssleemse ssleeems ssleeesm ssleesem ssleesme
sslemees sslemese sslemees sslemese sslemsee sslemsee ssleemes ssleemse ssleeems ssleeesm ssleesem
ssleesme sslesmee sslesmee ssleseme ssleseem ssleseem ssleseme ssleeems ssleeesm ssleemes ssleemse
ssleesme ssleesem ssleeems ssleeesm ssleemes ssleemse ssleesme ssleesem sslemees sslemese sslemees
sslemese sslemsee sslemsee ssleseme ssleseem sslesmee sslesmee ssleseme ssleseem sslseeem sslseeme
sslseeem sslseeme sslsemee sslsemee sslseeem sslseeme sslseeem sslseeme sslsemee sslsemee sslseeem
sslseeme sslseeem sslseeme sslsemee sslsemee sslsmeee sslsmeee sslsmeee sslsmeee sslsmeee sslsmeee
ssemlees ssemlese ssemlees ssemlese ssemlsee ssemlsee ssemeles ssemelse ssemeels ssemeesl ssemesel
ssemesle ssemeels ssemeesl ssemeles ssemelse ssemesle ssemesel ssemseel ssemsele ssemseel ssemsele
ssemslee ssemslee sselmees sselmese sselmees sselmese sselmsee sselmsee sselemes sselemse sseleems
sseleesm sselesem sselesme sseleems sseleesm sselemes sselemse sselesme sselesem sselseem sselseme
sselseem sselseme sselsmee sselsmee sseelmes sseelmse sseelems sseelesm sseelsem sseelsme sseemles
sseemlse sseemels sseemesl sseemsel sseemsle sseeemls sseeemsl sseeelms sseeelsm sseeeslm sseeesml
sseesmel sseesmle sseeseml sseeselm sseeslem sseeslme sseelems sseelesm sseelmes sseelmse sseelsme
sseelsem sseeelms sseeelsm sseeemls sseeemsl sseeesml sseeeslm sseemels sseemesl sseemles sseemlse
sseemsle sseemsel sseeseml sseeselm sseesmel sseesmle sseeslme sseeslem ssesleem ssesleme ssesleem
ssesleme sseslmee sseslmee sseselem sseselme sseseelm sseseeml ssesemel ssesemle sseseelm sseseeml
sseselem sseselme ssesemle ssesemel ssesmeel ssesmele ssesmeel ssesmele ssesmlee ssesmlee ssemlees
ssemlese ssemlees ssemlese ssemlsee ssemlsee ssemeles ssemelse ssemeels ssemeesl ssemesel ssemesle
ssemeels ssemeesl ssemeles ssemelse ssemesle ssemesel ssemseel ssemsele ssemseel ssemsele ssemslee
ssemslee sselmees sselmese sselmees sselmese sselmsee sselmsee sselemes sselemse sseleems sseleesm
sselesem sselesme sseleems sseleesm sselemes sselemse sselesme sselesem sselseem sselseme sselseem
sselseme sselsmee sselsmee sseelmes sseelmse sseelems sseelesm sseelsem sseelsme sseemles sseemlse
sseemels sseemesl sseemsel sseemsle sseeemls sseeemsl sseeelms sseeelsm sseeeslm sseeesml sseesmel
sseesmle sseeseml sseeselm sseeslem sseeslme sseelems sseelesm sseelmes sseelmse sseelsme sseelsem
sseeelms sseeelsm sseeemls sseeemsl sseeesml sseeeslm sseemels sseemesl sseemles sseemlse sseemsle
sseemsel sseeseml sseeselm sseesmel sseesmle sseeslme sseeslem ssesleem ssesleme ssesleem ssesleme
sseslmee sseslmee sseselem sseselme sseseelm sseseeml ssesemel ssesemle sseseelm sseseeml sseselem
sseselme ssesemle ssesemel ssesmeel ssesmele ssesmeel ssesmele ssesmlee ssesmlee sssmleee sssmleee
sssmleee sssmleee sssmleee sssmleee sssmelee sssmelee sssmeele sssmeeel sssmeeel sssmeele sssmeele
sssmeeel sssmelee sssmelee sssmeele sssmeeel sssmeeel sssmeele sssmeeel sssmeele sssmelee sssmelee
ssslmeee ssslmeee ssslmeee ssslmeee ssslmeee ssslmeee ssslemee ssslemee sssleeme sssleeem sssleeem
sssleeme sssleeme sssleeem ssslemee ssslemee sssleeme sssleeem sssleeem sssleeme sssleeem sssleeme
ssslemee ssslemee ssselmee ssselmee ssseleme ssseleem ssseleem ssseleme sssemlee sssemlee sssemele
sssemeel sssemeel sssemele ssseemle ssseemel ssseelme ssseelem ssseeelm ssseeeml ssseemel ssseemle
ssseeeml ssseeelm ssseelem ssseelme ssseleme ssseleem ssselmee ssselmee ssseleme ssseleem ssseelme
ssseelem ssseemle ssseemel ssseeeml ssseeelm sssemele sssemeel sssemlee sssemlee sssemele sssemeel
ssseeeml ssseeelm ssseemel ssseemle ssseelme ssseelem ssseleem ssseleme ssseleem ssseleme ssselmee
ssselmee ssseelem ssseelme ssseeelm ssseeeml ssseemel ssseemle ssseeelm ssseeeml ssseelem ssseelme
ssseemle ssseemel sssemeel sssemele sssemeel sssemele sssemlee sssemlee ssemlese ssemlees ssemlsee
ssemlsee ssemlese ssemlees ssemelse ssemeles ssemesle ssemesel ssemeesl ssemeels ssemsele ssemseel
ssemslee ssemslee ssemsele ssemseel ssemeesl ssemeels ssemesel ssemesle ssemelse ssemeles sselmese
sselmees sselmsee sselmsee sselmese sselmees sselemse sselemes sselesme sselesem sseleesm sseleems
sselseme sselseem sselsmee sselsmee sselseme sselseem sseleesm sseleems sselesem sselesme sselemse
sselemes sseelmse sseelmes sseelsme sseelsem sseelesm sseelems sseemlse sseemles sseemsle sseemsel
sseemesl sseemels sseesmle sseesmel sseeslme sseeslem sseeselm sseeseml sseeemsl sseeemls sseeesml
sseeeslm sseeelsm sseeelms ssesleme ssesleem sseslmee sseslmee ssesleme ssesleem sseselme sseselem
ssesemle ssesemel sseseeml sseseelm ssesmele ssesmeel ssesmlee ssesmlee ssesmele ssesmeel sseseeml
sseseelm ssesemel ssesemle sseselme sseselem sseelesm sseelems sseelsem sseelsme sseelmse sseelmes
sseeelsm sseeelms sseeeslm sseeesml sseeemsl sseeemls sseeselm sseeseml sseeslem sseeslme sseesmle
sseesmel sseemesl sseemels sseemsel sseemsle sseemlse sseemles ssmelese ssmelees ssmelsee ssmelsee
ssmelese ssmelees ssmeelse ssmeeles ssmeesle ssmeesel ssmeeesl ssmeeels ssmesele ssmeseel ssmeslee
ssmeslee ssmesele ssmeseel ssmeeesl ssmeeels ssmeesel ssmeesle ssmeelse ssmeeles ssmleese ssmleees
ssmlesee ssmlesee ssmleese ssmleees ssmleese ssmleees ssmlesee ssmlesee ssmleese ssmleees ssmlseee
ssmlseee ssmlseee ssmlseee ssmlseee ssmlseee ssmleese ssmleees ssmlesee ssmlesee ssmleese ssmleees
ssmelese ssmelees ssmelsee ssmelsee ssmelese ssmelees ssmeelse ssmeeles ssmeesle ssmeesel ssmeeesl
ssmeeels ssmesele ssmeseel ssmeslee ssmeslee ssmesele ssmeseel ssmeeesl ssmeeels ssmeesel ssmeesle
ssmeelse ssmeeles ssmsleee ssmsleee ssmsleee ssmsleee ssmsleee ssmsleee ssmselee ssmselee ssmseele
ssmseeel ssmseeel ssmseele ssmseele ssmseeel ssmselee ssmselee ssmseele ssmseeel ssmseeel ssmseele
ssmseeel ssmseele ssmselee ssmselee ssmelese ssmelees ssmelsee ssmelsee ssmelese ssmelees ssmeelse
ssmeeles ssmeesle ssmeesel ssmeeesl ssmeeels ssmesele ssmeseel ssmeslee ssmeslee ssmesele ssmeseel
ssmeeesl ssmeeels ssmeesel ssmeesle ssmeelse ssmeeles sslmeese sslmeees sslmesee sslmesee sslmeese
sslmeees sslmeese sslmeees sslmesee sslmesee sslmeese sslmeees sslmseee sslmseee sslmseee sslmseee
sslmseee sslmseee sslmeese sslmeees sslmesee sslmesee sslmeese sslmeees sslemese sslemees sslemsee
sslemsee sslemese sslemees ssleemse ssleemes ssleesme ssleesem ssleeesm ssleeems ssleseme ssleseem
sslesmee sslesmee ssleseme ssleseem ssleeesm ssleeems ssleesem ssleesme ssleemse ssleemes ssleemse
ssleemes ssleesme ssleesem ssleeesm ssleeems sslemese sslemees sslemsee sslemsee sslemese sslemees
sslesmee sslesmee ssleseme ssleseem ssleseem ssleseme ssleemse ssleemes ssleesme ssleesem ssleeesm
ssleeems sslseeme sslseeem sslsemee sslsemee sslseeme sslseeem sslseeme sslseeem sslsemee sslsemee
sslseeme sslseeem sslsmeee sslsmeee sslsmeee sslsmeee sslsmeee sslsmeee sslseeme sslseeem sslsemee
sslsemee sslseeme sslseeem ssleeesm ssleeems ssleesem ssleesme ssleemse ssleemes ssleeesm ssleeems
ssleesem ssleesme ssleemse ssleemes ssleseem ssleseme ssleseem ssleseme sslesmee sslesmee sslemese
sslemees sslemsee sslemsee sslemese sslemees ssemlese ssemlees ssemlsee ssemlsee ssemlese ssemlees
ssemelse ssemeles ssemesle ssemesel ssemeesl ssemeels ssemsele ssemseel ssemslee ssemslee ssemsele
ssemseel ssemeesl ssemeels ssemesel ssemesle ssemelse ssemeles sselmese sselmees sselmsee sselmsee
sselmese sselmees sselemse sselemes sselesme sselesem sseleesm sseleems sselseme sselseem sselsmee
sselsmee sselseme sselseem sseleesm sseleems sselesem sselesme sselemse sselemes sseelmse sseelmes
sseelsme sseelsem sseelesm sseelems sseemlse sseemles sseemsle sseemsel sseemesl sseemels sseesmle
sseesmel sseeslme sseeslem sseeselm sseeseml sseeemsl sseeemls sseeesml sseeeslm sseeelsm sseeelms
ssesleme ssesleem sseslmee sseslmee ssesleme ssesleem sseselme sseselem ssesemle ssesemel sseseeml
sseseelm ssesmele ssesmeel ssesmlee ssesmlee ssesmele ssesmeel sseseeml sseseelm ssesemel ssesemle
sseselme sseselem sseelesm sseelems sseelsem sseelsme sseelmse sseelmes sseeelsm sseeelms sseeeslm
sseeesml sseeemsl sseeemls sseeselm sseeseml sseeslem sseeslme sseesmle sseesmel sseemesl sseemels
sseemsel sseemsle sseemlse sseemles sssmleee sssmleee sssmleee sssmleee sssmleee sssmleee sssmelee
sssmelee sssmeele sssmeeel sssmeeel sssmeele sssmeele sssmeeel sssmelee sssmelee sssmeele sssmeeel
sssmeeel sssmeele sssmeeel sssmeele sssmelee sssmelee ssslmeee ssslmeee ssslmeee ssslmeee ssslmeee
ssslmeee ssslemee ssslemee sssleeme sssleeem sssleeem sssleeme sssleeme sssleeem ssslemee ssslemee
sssleeme sssleeem sssleeem sssleeme sssleeem sssleeme ssslemee ssslemee ssselmee ssselmee ssseleme
ssseleem ssseleem ssseleme sssemlee sssemlee sssemele sssemeel sssemeel sssemele ssseemle ssseemel
ssseelme ssseelem ssseeelm ssseeeml ssseemel ssseemle ssseeeml ssseeelm ssseelem ssseelme ssseleme
ssseleem ssselmee ssselmee ssseleme ssseleem ssseelme ssseelem ssseemle ssseemel ssseeeml ssseeelm
sssemele sssemeel sssemlee sssemlee sssemele sssemeel ssseeeml ssseeelm ssseemel ssseemle ssseelme
ssseelem ssseleem ssseleme ssseleem ssseleme ssselmee ssselmee ssseelem ssseelme ssseeelm ssseeeml
ssseemel ssseemle ssseeelm ssseeeml ssseelem ssseelme ssseemle ssseemel sssemeel sssemele sssemeel
sssemele sssemlee sssemlee ssemlese ssemlees ssemlsee ssemlsee ssemlese ssemlees ssemelse ssemeles
ssemesle ssemesel ssemeesl ssemeels ssemsele ssemseel ssemslee ssemslee ssemsele ssemseel ssemeesl
ssemeels ssemesel ssemesle ssemelse ssemeles sselmese sselmees sselmsee sselmsee sselmese sselmees
sselemse sselemes sselesme sselesem sseleesm sseleems sselseme sselseem sselsmee sselsmee sselseme
sselseem sseleesm sseleems sselesem sselesme sselemse sselemes sseelmse sseelmes sseelsme sseelsem
sseelesm sseelems sseemlse sseemles sseemsle sseemsel sseemesl sseemels sseesmle sseesmel sseeslme
sseeslem sseeselm sseeseml sseeemsl sseeemls sseeesml sseeeslm sseeelsm sseeelms ssesleme ssesleem
sseslmee sseslmee ssesleme ssesleem sseselme sseselem ssesemle ssesemel sseseeml sseseelm ssesmele
ssesmeel ssesmlee ssesmlee ssesmele ssesmeel sseseeml sseseelm ssesemel ssesemle sseselme sseselem
sseelesm sseelems sseelsem sseelsme sseelmse sseelmes sseeelsm sseeelms sseeeslm sseeesml sseeemsl
sseeemls sseeselm sseeseml sseeslem sseeslme sseesmle sseesmel sseemesl sseemels sseemsel sseemsle
sseemlse sseemles

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us