easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

negavimus

collegesprings

tamber

cardiomelanosis

anthranyl

subahship

haedi

aclastic

creationary

bogomilian

substrator

khensu

backwardation

haggling

steinbrecher

labiomancy

postpositional

balawu


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: seduce
cipher variations:
tfevdf ugfweg vhgxfh wihygi xjizhj
ykjaik zlkbjl amlckm bnmdln conemo
dpofnp eqpgoq frqhpr gsriqs htsjrt
iutksu jvultv kwvmuw lxwnvx myxowy
nzypxz oazqya pbarzb qcbsac rdctbd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: seduce
Cipher: hvwfxv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: seduce
Cipher: BAAAB AABAA AAABB BAABB AAABA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: seduce
cipher variations:
tfevdfdnkjhnnvqxlvxdwlpdhlcztlrtinxtljupfjvradjr
fzgrnzphmfrhzpstvpjxyhzxugfwegeolkioowrymwyexmqe
imdaumsujoyumkvqgkwsbeksgahsoaqingsiaqtuwqkyziay
vhgxfhfpmljppxsznxzfynrfjnebvntvkpzvnlwrhlxtcflt
hbitpbrjohtjbruvxrlzajbzwihygigqnmkqqytaoyagzosg
kofcwouwlqawomxsimyudgmuicjuqcskpiukcsvwysmabkca
xjizhjhronlrrzubpzbhapthlpgdxpvxmrbxpnytjnzvehnv
jdkvrdtlqjvldtwxztnbcldbykjaikispomssavcqacibqui
mqheyqwynscyqozukoawfiowkelwseumrkwmeuxyauocdmec
zlkbjljtqpnttbwdrbdjcrvjnrifzrxzotdzrpavlpbxgjpx
lfmxtfvnslxnfvyzbvpdenfdamlckmkurqouucxescekdswk
osjgasyapueasqbwmqcyhkqymgnyugwotmyogwzacwqefoge
bnmdlnlvsrpvvdyftdfletxlptkhbtzbqvfbtrcxnrdzilrz
nhozvhxpunzphxabdxrfgphfconemomwtsqwwezguegmfuym
qulicuacrwgcusdyoseajmsaoipawiyqvoaqiybceysghqig
dpofnpnxutrxxfahvfhngvznrvmjdvbdsxhdvtezptfbkntb
pjqbxjzrwpbrjzcdfzthirjheqpgoqoyvusyygbiwgiohwao
swnkewcetyiewufaqugcloucqkrcykasxqcskadegauijski
frqhprpzwvtzzhcjxhjpixbptxolfxdfuzjfxvgbrvhdmpvd
rlsdzlbtyrdtlbefhbvjktljgsriqsqaxwuaaidkyikqjycq
uypmgyegvakgywhcswienqwesmteamcuzseumcfgicwklumk
htsjrtrbyxvbbjelzjlrkzdrvzqnhzfhwblhzxidtxjforxf
tnufbndvatfvndghjdxlmvnliutksusczywcckfmakmslaes
waroiagixcmiayjeuykgpsyguovgcoewbugwoehikeymnwom
jvultvtdazxddlgnblntmbftxbspjbhjydnjbzkfvzlhqtzh
vpwhdpfxcvhxpfijlfznoxpnkwvmuwuebayeemhocmouncgu
yctqkcikzeokcalgwamiruaiwqxieqgydwiyqgjkmgaopyqo
lxwnvxvfcbzffnipdnpvodhvzdurldjlafpldbmhxbnjsvbj
xryjfrhzexjzrhklnhbpqzrpmyxowywgdcaggojqeoqwpeiw
aevsmekmbgqmecniycoktwckyszkgsiafykasilmoicqrasq
nzypxzxhedbhhpkrfprxqfjxbfwtnflnchrnfdojzdpluxdl
ztalhtjbgzlbtjmnpjdrsbtroazqyayifeciiqlsgqsyrgky
cgxuogmodisogepkaeqmvyemaubmiukchamcuknoqkestcus
pbarzbzjgfdjjrmthrtzshlzdhyvphnpejtphfqlbfrnwzfn
bvcnjvldibndvloprlftudvtqcbsacakhgekksnuisuatima
eizwqioqfkuqigrmcgsoxagocwdokwmejcoewmpqsmguvewu
rdctbdblihflltovjtvbujnbfjaxrjprglvrjhsndhtpybhp
dxeplxnfkdpfxnqrtnhvwfxvseducecmjigmmupwkuwcvkoc
gkbyskqshmwskitoeiuqzciqeyfqmyogleqgyorsuoiwxgyw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: seduce
Cipher: frqhpr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: seduce
Cipher: 345141543151

Extended Methods:
Method #1

Plaintext: seduce
method variations:
xkizhkcpoenphutksunzypxz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s e d u c e 
3 5 4 5 3 5 
4 1 1 4 1 1 
They are then read out in rows:
354535411411
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: seduce
Cipher: xyxdqa

Read more ...
Method #3

Plaintext: seduce
method variations:
yqvovl qvovly vovlyq
ovlyqv vlyqvo lyqvov

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: seduce

all 720 cipher variations:
seduce seduec sedcue sedceu sedecu sedeuc seudce seudec seucde seuced seuecd
seuedc secude secued secdue secdeu secedu seceud seeucd seeudc seecud seecdu
seedcu seeduc sdeuce sdeuec sdecue sdeceu sdeecu sdeeuc sduece sdueec sducee
sducee sduece sdueec sdcuee sdcuee sdceue sdceeu sdceeu sdceue sdeuce sdeuec
sdecue sdeceu sdeecu sdeeuc sudece sudeec sudcee sudcee sudece sudeec suedce
suedec suecde sueced sueecd sueedc sucede suceed sucdee sucdee sucede suceed
sueecd sueedc sueced suecde suedce suedec scduee scduee scdeue scdeeu scdeeu
scdeue scudee scudee scuede scueed scueed scuede sceude sceued scedue scedeu
sceedu sceeud sceued sceude sceeud sceedu scedeu scedue seduce seduec sedcue
sedceu sedecu sedeuc seudce seudec seucde seuced seuecd seuedc secude secued
secdue secdeu secedu seceud seeucd seeudc seecud seecdu seedcu seeduc esduce
esduec esdcue esdceu esdecu esdeuc esudce esudec esucde esuced esuecd esuedc
escude escued escdue escdeu escedu esceud eseucd eseudc esecud esecdu esedcu
eseduc edsuce edsuec edscue edsceu edsecu edseuc edusce edusec educse educes
eduecs eduesc edcuse edcues edcsue edcseu edcesu edceus edeucs edeusc edecus
edecsu edescu edesuc eudsce eudsec eudcse eudces eudecs eudesc eusdce eusdec
euscde eusced eusecd eusedc eucsde eucsed eucdse eucdes euceds eucesd euescd
euesdc euecsd euecds euedcs euedsc ecduse ecdues ecdsue ecdseu ecdesu ecdeus
ecudse ecudes ecusde ecused ecuesd ecueds ecsude ecsued ecsdue ecsdeu ecsedu
ecseud eceusd eceuds ecesud ecesdu ecedsu ecedus eeducs eedusc eedcus eedcsu
eedscu eedsuc eeudcs eeudsc eeucds eeucsd eeuscd eeusdc eecuds eecusd eecdus
eecdsu eecsdu eecsud eesucd eesudc eescud eescdu eesdcu eesduc desuce desuec
descue desceu desecu deseuc deusce deusec deucse deuces deuecs deuesc decuse
decues decsue decseu decesu deceus deeucs deeusc deecus deecsu deescu deesuc
dseuce dseuec dsecue dseceu dseecu dseeuc dsuece dsueec dsucee dsucee dsuece
dsueec dscuee dscuee dsceue dsceeu dsceeu dsceue dseuce dseuec dsecue dseceu
dseecu dseeuc dusece duseec duscee duscee dusece duseec duesce duesec duecse
dueces dueecs dueesc ducese ducees ducsee ducsee ducese ducees dueecs dueesc
dueces duecse duesce duesec dcsuee dcsuee dcseue dcseeu dcseeu dcseue dcusee
dcusee dcuese dcuees dcuees dcuese dceuse dceues dcesue dceseu dceesu dceeus
dceues dceuse dceeus dceesu dceseu dcesue desuce desuec descue desceu desecu
deseuc deusce deusec deucse deuces deuecs deuesc decuse decues decsue decseu
decesu deceus deeucs deeusc deecus deecsu deescu deesuc uedsce uedsec uedcse
uedces uedecs uedesc uesdce uesdec uescde uesced uesecd uesedc uecsde uecsed
uecdse uecdes ueceds uecesd ueescd ueesdc ueecsd ueecds ueedcs ueedsc udesce
udesec udecse udeces udeecs udeesc udsece udseec udscee udscee udsece udseec
udcsee udcsee udcese udcees udcees udcese udesce udesec udecse udeces udeecs
udeesc usdece usdeec usdcee usdcee usdece usdeec usedce usedec usecde useced
useecd useedc uscede usceed uscdee uscdee uscede usceed useecd useedc useced
usecde usedce usedec ucdsee ucdsee ucdese ucdees ucdees ucdese ucsdee ucsdee
ucsede ucseed ucseed ucsede ucesde ucesed ucedse ucedes uceeds uceesd ucesed
ucesde uceesd uceeds ucedes ucedse uedsce uedsec uedcse uedces uedecs uedesc
uesdce uesdec uescde uesced uesecd uesedc uecsde uecsed uecdse uecdes ueceds
uecesd ueescd ueesdc ueecsd ueecds ueedcs ueedsc ceduse cedues cedsue cedseu
cedesu cedeus ceudse ceudes ceusde ceused ceuesd ceueds cesude cesued cesdue
cesdeu cesedu ceseud ceeusd ceeuds ceesud ceesdu ceedsu ceedus cdeuse cdeues
cdesue cdeseu cdeesu cdeeus cduese cduees cdusee cdusee cduese cduees cdsuee
cdsuee cdseue cdseeu cdseeu cdseue cdeuse cdeues cdesue cdeseu cdeesu cdeeus
cudese cudees cudsee cudsee cudese cudees cuedse cuedes cuesde cuesed cueesd
cueeds cusede cuseed cusdee cusdee cusede cuseed cueesd cueeds cuesed cuesde
cuedse cuedes csduee csduee csdeue csdeeu csdeeu csdeue csudee csudee csuede
csueed csueed csuede cseude cseued csedue csedeu cseedu cseeud cseued cseude
cseeud cseedu csedeu csedue ceduse cedues cedsue cedseu cedesu cedeus ceudse
ceudes ceusde ceused ceuesd ceueds cesude cesued cesdue cesdeu cesedu ceseud
ceeusd ceeuds ceesud ceesdu ceedsu ceedus eeducs eedusc eedcus eedcsu eedscu
eedsuc eeudcs eeudsc eeucds eeucsd eeuscd eeusdc eecuds eecusd eecdus eecdsu
eecsdu eecsud eesucd eesudc eescud eescdu eesdcu eesduc edeucs edeusc edecus
edecsu edescu edesuc eduecs eduesc educes educse edusce edusec edcues edcuse
edceus edcesu edcseu edcsue edsuce edsuec edscue edsceu edsecu edseuc eudecs
eudesc eudces eudcse eudsce eudsec euedcs euedsc euecds euecsd euescd euesdc
euceds eucesd eucdes eucdse eucsde eucsed eusecd eusedc eusced euscde eusdce
eusdec ecdues ecduse ecdeus ecdesu ecdseu ecdsue ecudes ecudse ecueds ecuesd
ecused ecusde eceuds eceusd ecedus ecedsu ecesdu ecesud ecsued ecsude ecseud
ecsedu ecsdeu ecsdue esduce esduec esdcue esdceu esdecu esdeuc esudce esudec
esucde esuced esuecd esuedc escude escued escdue escdeu escedu esceud eseucd
eseudc esecud esecdu esedcu eseduc

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us