easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

erraveratis

mantoniella

nepotisms

normative

mycele

divisibilities

osnabrueck

maleleel

rohrbacher

pervium

irrevertible

bleimor

tingid

entitles

cubomedusan

pemiscot

gelidly

nodule


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: sawbwa
cipher variations:
tbxcxb ucydyc vdzezd weafae xfbgbf
ygchcg zhdidh aiejei bjfkfj ckglgk
dlhmhl eminim fnjojn gokpko hplqlp
iqmrmq jrnsnr ksotos ltpupt muqvqu
nvrwrv owsxsw pxtytx qyuzuy rzvavz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: sawbwa
Cipher: hzdydz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: sawbwa
Cipher: BAAAB AAAAA BABAA AAAAB BABAA AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: sawbwa
cipher variations:
tbxcxbdbpepbnbhghbxbzizbhbrkrbrbjmjblbtqtbvblslb
fbdudbpbvwvbzbnynbjbfafbucydycecqfqcocihicycajac
icslscscknkcmcurucwcmtmcgcevecqcwxwcacozockcgbgc
vdzezdfdrgrdpdjijdzdbkbdjdtmtdtdloldndvsvdxdnund
hdfwfdrdxyxdbdpapdldhchdweafaegeshseqekjkeaeclce
keunueuempmeoewtweyeovoeiegxgeseyzyeceqbqemeidie
xfbgbfhftitfrflklfbfdmdflfvovfvfnqnfpfxuxfzfpwpf
jfhyhftfzazfdfrcrfnfjejfygchcgigujugsgmlmgcgeneg
mgwpwgwgorogqgyvygagqxqgkgizigugabagegsdsgogkfkg
zhdidhjhvkvhthnmnhdhfofhnhxqxhxhpsphrhzwzhbhryrh
lhjajhvhbcbhfhtethphlglhaiejeikiwlwiuionoieigpgi
oiyryiyiqtqisiaxaiciszsimikbkiwicdcigiufuiqimhmi
bjfkfjljxmxjvjpopjfjhqhjpjzszjzjrurjtjbybjdjtatj
njlcljxjdedjhjvgvjrjninjckglgkmkynykwkqpqkgkirik
qkatakaksvskukczckekubukokmdmkykefekikwhwkskojok
dlhmhlnlzozlxlrqrlhljsjlrlbublbltwtlvldadlflvcvl
plnenlzlfgfljlxixltlpkpleminimomapamymsrsmimktkm
smcvcmcmuxumwmebemgmwdwmqmofomamghgmkmyjymumqlqm
fnjojnpnbqbnzntstnjnlulntndwdndnvyvnxnfcfnhnxexn
rnpgpnbnhihnlnzkznvnrmrngokpkoqocrcoaoutuokomvmo
uoexeoeowzwoyogdgoioyfyosoqhqocoijiomoalaowosnso
hplqlprpdsdpbpvuvplpnwnpvpfyfpfpxaxpzphehpjpzgzp
tprirpdpjkjpnpbmbpxptotpiqmrmqsqeteqcqwvwqmqoxoq
wqgzgqgqybyqaqifiqkqahaquqsjsqeqklkqoqcncqyqupuq
jrnsnrtrfufrdrxwxrnrpyprxrhahrhrzczrbrjgjrlrbibr
vrtktrfrlmlrprdodrzrvqvrksotosusgvgsesyxysosqzqs
ysibisisadascskhksmscjcswsulusgsmnmsqsepesaswrws
ltpuptvthwhtftzyztptrartztjcjtjtbebtdtliltntdkdt
xtvmvthtnontrtfqftbtxsxtmuqvquwuixiuguazauqusbsu
aukdkukucfcueumjmuoueleuyuwnwuiuopousugrgucuytyu
nvrwrvxvjyjvhvbabvrvtctvbvlelvlvdgdvfvnknvpvfmfv
zvxoxvjvpqpvtvhshvdvzuzvowsxswywkzkwiwcbcwswuduw
cwmfmwmwehewgwolowqwgngwawypywkwqrqwuwitiwewavaw
pxtytxzxlalxjxdcdxtxvevxdxngnxnxfifxhxpmpxrxhohx
bxzqzxlxrsrxvxjujxfxbwbxqyuzuyaymbmykyedeyuywfwy
eyohoyoygjgyiyqnqysyipiycyaraymystsywykvkygycxcy
rzvavzbzncnzlzfefzvzxgxzfzpipzpzhkhzjzrorztzjqjz
dzbsbznztutzxzlwlzhzdydzsawbwacaodoamagfgawayhya
gaqjqaqailiakaspsauakrkaeactcaoauvuayamxmaiaezea

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: sawbwa
Cipher: fnjojn

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: sawbwa
Cipher: 341125212511

Extended Methods:
Method #1

Plaintext: sawbwa
method variations:
xfbgbfclgmglhqmrmqnvrwrv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s a w b w a 
3 1 2 2 2 1 
4 1 5 1 5 1 
They are then read out in rows:
312221415151
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: sawbwa
Cipher: cgbdee

Read more ...
Method #3

Plaintext: sawbwa
method variations:
dfkfel fkfeld kfeldf
feldfk eldfkf ldfkfe

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: sawbwa

all 720 cipher variations:
sawbwa sawbaw sawwba sawwab sawawb sawabw sabwwa sabwaw sabwwa sabwaw sabaww
sabaww sawbwa sawbaw sawwba sawwab sawawb sawabw saabww saabww saawbw saawwb
saawwb saawbw swabwa swabaw swawba swawab swaawb swaabw swbawa swbaaw swbwaa
swbwaa swbawa swbaaw swwbaa swwbaa swwaba swwaab swwaab swwaba swabwa swabaw
swawba swawab swaawb swaabw sbwawa sbwaaw sbwwaa sbwwaa sbwawa sbwaaw sbawwa
sbawaw sbawwa sbawaw sbaaww sbaaww sbwawa sbwaaw sbwwaa sbwwaa sbwawa sbwaaw
sbaaww sbaaww sbawaw sbawwa sbawwa sbawaw swwbaa swwbaa swwaba swwaab swwaab
swwaba swbwaa swbwaa swbawa swbaaw swbaaw swbawa swabwa swabaw swawba swawab
swaawb swaabw swabaw swabwa swaabw swaawb swawab swawba sawbwa sawbaw sawwba
sawwab sawawb sawabw sabwwa sabwaw sabwwa sabwaw sabaww sabaww sawbwa sawbaw
sawwba sawwab sawawb sawabw saabww saabww saawbw saawwb saawwb saawbw aswbwa
aswbaw aswwba aswwab aswawb aswabw asbwwa asbwaw asbwwa asbwaw asbaww asbaww
aswbwa aswbaw aswwba aswwab aswawb aswabw asabww asabww asawbw asawwb asawwb
asawbw awsbwa awsbaw awswba awswab awsawb awsabw awbswa awbsaw awbwsa awbwas
awbaws awbasw awwbsa awwbas awwsba awwsab awwasb awwabs awabws awabsw awawbs
awawsb awaswb awasbw abwswa abwsaw abwwsa abwwas abwaws abwasw abswwa abswaw
abswwa abswaw absaww absaww abwswa abwsaw abwwsa abwwas abwaws abwasw abasww
abasww abawsw abawws abawws abawsw awwbsa awwbas awwsba awwsab awwasb awwabs
awbwsa awbwas awbswa awbsaw awbasw awbaws awsbwa awsbaw awswba awswab awsawb
awsabw awabsw awabws awasbw awaswb awawsb awawbs aawbws aawbsw aawwbs aawwsb
aawswb aawsbw aabwws aabwsw aabwws aabwsw aabsww aabsww aawbws aawbsw aawwbs
aawwsb aawswb aawsbw aasbww aasbww aaswbw aaswwb aaswwb aaswbw wasbwa wasbaw
waswba waswab wasawb wasabw wabswa wabsaw wabwsa wabwas wabaws wabasw wawbsa
wawbas wawsba wawsab wawasb wawabs waabws waabsw waawbs waawsb waaswb waasbw
wsabwa wsabaw wsawba wsawab wsaawb wsaabw wsbawa wsbaaw wsbwaa wsbwaa wsbawa
wsbaaw wswbaa wswbaa wswaba wswaab wswaab wswaba wsabwa wsabaw wsawba wsawab
wsaawb wsaabw wbsawa wbsaaw wbswaa wbswaa wbsawa wbsaaw wbaswa wbasaw wbawsa
wbawas wbaaws wbaasw wbwasa wbwaas wbwsaa wbwsaa wbwasa wbwaas wbaaws wbaasw
wbawas wbawsa wbaswa wbasaw wwsbaa wwsbaa wwsaba wwsaab wwsaab wwsaba wwbsaa
wwbsaa wwbasa wwbaas wwbaas wwbasa wwabsa wwabas wwasba wwasab wwaasb wwaabs
wwabas wwabsa wwaabs wwaasb wwasab wwasba wasbwa wasbaw waswba waswab wasawb
wasabw wabswa wabsaw wabwsa wabwas wabaws wabasw wawbsa wawbas wawsba wawsab
wawasb wawabs waabws waabsw waawbs waawsb waaswb waasbw bawswa bawsaw bawwsa
bawwas bawaws bawasw baswwa baswaw baswwa baswaw basaww basaww bawswa bawsaw
bawwsa bawwas bawaws bawasw baasww baasww baawsw baawws baawws baawsw bwaswa
bwasaw bwawsa bwawas bwaaws bwaasw bwsawa bwsaaw bwswaa bwswaa bwsawa bwsaaw
bwwsaa bwwsaa bwwasa bwwaas bwwaas bwwasa bwaswa bwasaw bwawsa bwawas bwaaws
bwaasw bswawa bswaaw bswwaa bswwaa bswawa bswaaw bsawwa bsawaw bsawwa bsawaw
bsaaww bsaaww bswawa bswaaw bswwaa bswwaa bswawa bswaaw bsaaww bsaaww bsawaw
bsawwa bsawwa bsawaw bwwsaa bwwsaa bwwasa bwwaas bwwaas bwwasa bwswaa bwswaa
bwsawa bwsaaw bwsaaw bwsawa bwaswa bwasaw bwawsa bwawas bwaaws bwaasw bwasaw
bwaswa bwaasw bwaaws bwawas bwawsa bawswa bawsaw bawwsa bawwas bawaws bawasw
baswwa baswaw baswwa baswaw basaww basaww bawswa bawsaw bawwsa bawwas bawaws
bawasw baasww baasww baawsw baawws baawws baawsw wawbsa wawbas wawsba wawsab
wawasb wawabs wabwsa wabwas wabswa wabsaw wabasw wabaws wasbwa wasbaw waswba
waswab wasawb wasabw waabsw waabws waasbw waaswb waawsb waawbs wwabsa wwabas
wwasba wwasab wwaasb wwaabs wwbasa wwbaas wwbsaa wwbsaa wwbasa wwbaas wwsbaa
wwsbaa wwsaba wwsaab wwsaab wwsaba wwabsa wwabas wwasba wwasab wwaasb wwaabs
wbwasa wbwaas wbwsaa wbwsaa wbwasa wbwaas wbawsa wbawas wbaswa wbasaw wbaasw
wbaaws wbsawa wbsaaw wbswaa wbswaa wbsawa wbsaaw wbaasw wbaaws wbasaw wbaswa
wbawsa wbawas wswbaa wswbaa wswaba wswaab wswaab wswaba wsbwaa wsbwaa wsbawa
wsbaaw wsbaaw wsbawa wsabwa wsabaw wsawba wsawab wsaawb wsaabw wsabaw wsabwa
wsaabw wsaawb wsawab wsawba wawbsa wawbas wawsba wawsab wawasb wawabs wabwsa
wabwas wabswa wabsaw wabasw wabaws wasbwa wasbaw waswba waswab wasawb wasabw
waabsw waabws waasbw waaswb waawsb waawbs aawbws aawbsw aawwbs aawwsb aawswb
aawsbw aabwws aabwsw aabwws aabwsw aabsww aabsww aawbws aawbsw aawwbs aawwsb
aawswb aawsbw aasbww aasbww aaswbw aaswwb aaswwb aaswbw awabws awabsw awawbs
awawsb awaswb awasbw awbaws awbasw awbwas awbwsa awbswa awbsaw awwbas awwbsa
awwabs awwasb awwsab awwsba awsbwa awsbaw awswba awswab awsawb awsabw abwaws
abwasw abwwas abwwsa abwswa abwsaw abawws abawsw abawws abawsw abasww abasww
abwaws abwasw abwwas abwwsa abwswa abwsaw absaww absaww abswaw abswwa abswwa
abswaw awwbas awwbsa awwabs awwasb awwsab awwsba awbwas awbwsa awbaws awbasw
awbsaw awbswa awabws awabsw awawbs awawsb awaswb awasbw awsbaw awsbwa awsabw
awsawb awswab awswba aswbwa aswbaw aswwba aswwab aswawb aswabw asbwwa asbwaw
asbwwa asbwaw asbaww asbaww aswbwa aswbaw aswwba aswwab aswawb aswabw asabww
asabww asawbw asawwb asawwb asawbw

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us