easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

mensik

whipps

lusignan

bereaven

unconvicting

koraje

ramean

lienteric

poignancy

fugientium

intangibility

samario

rosenberg

syringing

druggister

mondavi

loegria

burushaski


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: sasses
cipher variations:
tbttft ucuugu vdvvhv wewwiw xfxxjx
ygyyky zhzzlz aiaama bjbbnb ckccoc
dlddpd emeeqe fnffrf goggsg hphhth
iqiiui jrjjvj kskkwk ltllxl mummym
nvnnzn owooao pxppbp qyqqcq rzrrdr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: sasses
Cipher: hzhhvh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: sasses
Cipher: BAAAB AAAAA BAAAB BAAAB AABAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: sasses
cipher variations:
tbttftdbddndnbnnvnxbxxdxhbhhlhrbrrtrlblljlvbvvrv
fbffzfpbpphpzbzzpzjbjjxjucuugueceeoeocoowoycyyey
iciimiscssusmcmmkmwcwwswgcggagqcqqiqacaaqakckkyk
vdvvhvfdffpfpdppxpzdzzfzjdjjnjtdttvtndnnlnxdxxtx
hdhhbhrdrrjrbdbbrbldllzlwewwiwgeggqgqeqqyqaeaaga
kekkokueuuwuoeoomoyeyyuyieiicisessksceccscmemmam
xfxxjxhfhhrhrfrrzrbfbbhblfllplvfvvxvpfppnpzfzzvz
jfjjdjtfttltdfddtdnfnnbnygyykyigiisisgssascgccic
mgmmqmwgwwywqgqqoqagaawakgkkekuguumuegeeueogooco
zhzzlzjhjjtjthttbtdhddjdnhnnrnxhxxzxrhrrprbhbbxb
lhllflvhvvnvfhffvfphppdpaiaamakikkukuiuucueieeke
oioosoyiyyaysissqsciccycmimmgmwiwwowgiggwgqiqqeq
bjbbnbljllvlvjvvdvfjfflfpjpptpzjzzbztjttrtdjddzd
njnnhnxjxxpxhjhhxhrjrrfrckccocmkmmwmwkwwewgkggmg
qkqquqakaacaukuusuekeeaeokooioykyyqyikiiyiskssgs
dlddpdnlnnxnxlxxfxhlhhnhrlrrvrblbbdbvlvvtvflffbf
plppjpzlzzrzjljjzjtltthtemeeqeomooyoymyygyimiioi
smsswscmccecwmwwuwgmggcgqmqqkqamaasakmkkakumuuiu
fnffrfpnppzpznzzhzjnjjpjtnttxtdnddfdxnxxvxhnhhdh
rnrrlrbnbbtblnllblvnvvjvgoggsgqoqqaqaoaaiakokkqk
uouuyueoeegeyoyywyioiieisossmscoccucmommcmwowwkw
hphhthrprrbrbpbbjblpllrlvpvvzvfpffhfzpzzxzjpjjfj
tpttntdpddvdnpnndnxpxxlxiqiiuisqsscscqcckcmqmmsm
wqwwawgqggigaqaayakqkkgkuquuoueqeeweoqooeoyqyymy
jrjjvjtrttdtdrddldnrnntnxrxxbxhrhhjhbrbbzblrllhl
vrvvpvfrffxfprppfpzrzznzkskkwkusuueueseemeosoouo
ysyycyisiikicsccacmsmmimwswwqwgsggygqsqqgqasaaoa
ltllxlvtvvfvftffnfptppvpztzzdzjtjjljdtddbdntnnjn
xtxxrxhthhzhrtrrhrbtbbpbmummymwuwwgwguggogquqqwq
auaaeakukkmkeueeceouookoyuyysyiuiiaisussiscuccqc
nvnnznxvxxhxhvhhphrvrrxrbvbbfblvllnlfvffdfpvpplp
zvzztzjvjjbjtvttjtdvddrdowooaoywyyiyiwiiqiswssys
cwccgcmwmmomgwggegqwqqmqawaauakwkkckuwuukueweese
pxppbpzxzzjzjxjjrjtxttztdxddhdnxnnpnhxhhfhrxrrnr
bxbbvblxlldlvxvvlvfxfftfqyqqcqayaakakykkskuyuuau
eyeeieoyooqoiyiigisyssoscyccwcmymmemwywwmwgyggug
rzrrdrbzbblblzlltlvzvvbvfzffjfpzpprpjzjjhjtzttpt
dzddxdnznnfnxzxxnxhzhhvhsassescaccmcmammumwawwcw
gaggkgqaqqsqkakkikuauuqueaeeyeoaoogoyayyoyiaiiwi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: sasses
Cipher: fnffrf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: sasses
Cipher: 341134345134

Extended Methods:
Method #1

Plaintext: sasses
method variations:
xfxxkxclccpchqhhuhnvnnzn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s a s s e s 
3 1 3 3 5 3 
4 1 4 4 1 4 
They are then read out in rows:
313353414414
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: sasses
Cipher: cnpdtq

Read more ...
Method #3

Plaintext: sasses
method variations:
dloylo loylod oylodl
ylodlo lodloy odloyl

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: sasses

all 720 cipher variations:
sasses sassse sasess sasess sasses sassse sasses sassse sasess sasess sasses
sassse saesss saesss saesss saesss saesss saesss sasses sassse sasess sasess
sasses sassse ssases ssasse ssaess ssaess ssases ssasse sssaes sssase ssseas
sssesa ssssea ssssae ssesas ssessa sseass sseass ssesas ssessa ssssea ssssae
sssesa ssseas sssaes sssase sssaes sssase ssseas sssesa ssssea ssssae ssases
ssasse ssaess ssaess ssases ssasse sseass sseass ssesas ssessa ssessa ssesas
sssaes sssase ssseas sssesa ssssea ssssae sessas sesssa sesass sesass sessas
sesssa sessas sesssa sesass sesass sessas sesssa seasss seasss seasss seasss
seasss seasss sessas sesssa sesass sesass sessas sesssa ssssea ssssae sssesa
ssseas sssaes sssase ssssea ssssae sssesa ssseas sssaes sssase ssessa ssesas
ssessa ssesas sseass sseass ssases ssasse ssaess ssaess ssases ssasse assses
asssse assess assess assses asssse assses asssse assess assess assses asssse
asesss asesss asesss asesss asesss asesss assses asssse assess assess assses
asssse assses asssse assess assess assses asssse assses asssse assess assess
assses asssse asesss asesss asesss asesss asesss asesss assses asssse assess
assess assses asssse assses asssse assess assess assses asssse assses asssse
assess assess assses asssse asesss asesss asesss asesss asesss asesss assses
asssse assess assess assses asssse aessss aessss aessss aessss aessss aessss
aessss aessss aessss aessss aessss aessss aessss aessss aessss aessss aessss
aessss aessss aessss aessss aessss aessss aessss assses asssse assess assess
assses asssse assses asssse assess assess assses asssse asesss asesss asesss
asesss asesss asesss assses asssse assess assess assses asssse sasses sassse
sasess sasess sasses sassse sasses sassse sasess sasess sasses sassse saesss
saesss saesss saesss saesss saesss sasses sassse sasess sasess sasses sassse
ssases ssasse ssaess ssaess ssases ssasse sssaes sssase ssseas sssesa ssssea
ssssae ssesas ssessa sseass sseass ssesas ssessa ssssea ssssae sssesa ssseas
sssaes sssase sssaes sssase ssseas sssesa ssssea ssssae ssases ssasse ssaess
ssaess ssases ssasse sseass sseass ssesas ssessa ssessa ssesas sssaes sssase
ssseas sssesa ssssea ssssae sessas sesssa sesass sesass sessas sesssa sessas
sesssa sesass sesass sessas sesssa seasss seasss seasss seasss seasss seasss
sessas sesssa sesass sesass sessas sesssa ssssea ssssae sssesa ssseas sssaes
sssase ssssea ssssae sssesa ssseas sssaes sssase ssessa ssesas ssessa ssesas
sseass sseass ssases ssasse ssaess ssaess ssases ssasse sasses sassse sasess
sasess sasses sassse sasses sassse sasess sasess sasses sassse saesss saesss
saesss saesss saesss saesss sasses sassse sasess sasess sasses sassse ssases
ssasse ssaess ssaess ssases ssasse sssaes sssase ssseas sssesa ssssea ssssae
ssesas ssessa sseass sseass ssesas ssessa ssssea ssssae sssesa ssseas sssaes
sssase sssaes sssase ssseas sssesa ssssea ssssae ssases ssasse ssaess ssaess
ssases ssasse sseass sseass ssesas ssessa ssessa ssesas sssaes sssase ssseas
sssesa ssssea ssssae sessas sesssa sesass sesass sessas sesssa sessas sesssa
sesass sesass sessas sesssa seasss seasss seasss seasss seasss seasss sessas
sesssa sesass sesass sessas sesssa ssssea ssssae sssesa ssseas sssaes sssase
ssssea ssssae sssesa ssseas sssaes sssase ssessa ssesas ssessa ssesas sseass
sseass ssases ssasse ssaess ssaess ssases ssasse eassss eassss eassss eassss
eassss eassss eassss eassss eassss eassss eassss eassss eassss eassss eassss
eassss eassss eassss eassss eassss eassss eassss eassss eassss esasss esasss
esasss esasss esasss esasss essass essass esssas essssa essssa esssas esssas
essssa essass essass esssas essssa essssa esssas essssa esssas essass essass
essass essass esssas essssa essssa esssas esasss esasss esasss esasss esasss
esasss essass essass esssas essssa essssa esssas essass essass esssas essssa
essssa esssas esssas essssa essass essass esssas essssa esssas essssa essass
essass esssas essssa esasss esasss esasss esasss esasss esasss esssas essssa
essass essass esssas essssa essssa esssas essssa esssas essass essass essssa
esssas essssa esssas essass essass essssa esssas essssa esssas essass essass
esasss esasss esasss esasss esasss esasss sasses sassse sasess sasess sasses
sassse sasses sassse sasess sasess sasses sassse saesss saesss saesss saesss
saesss saesss sasses sassse sasess sasess sasses sassse ssases ssasse ssaess
ssaess ssases ssasse sssaes sssase ssseas sssesa ssssea ssssae ssesas ssessa
sseass sseass ssesas ssessa ssssea ssssae sssesa ssseas sssaes sssase sssaes
sssase ssseas sssesa ssssea ssssae ssases ssasse ssaess ssaess ssases ssasse
sseass sseass ssesas ssessa ssessa ssesas sssaes sssase ssseas sssesa ssssea
ssssae sessas sesssa sesass sesass sessas sesssa sessas sesssa sesass sesass
sessas sesssa seasss seasss seasss seasss seasss seasss sessas sesssa sesass
sesass sessas sesssa ssssea ssssae sssesa ssseas sssaes sssase ssssea ssssae
sssesa ssseas sssaes sssase ssessa ssesas ssessa ssesas sseass sseass ssases
ssasse ssaess ssaess ssases ssasse

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us