easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

socker

pawlowski

oenochoe

ophthalmectomy

flagitavisse

decanted

nutritory

gesserantque

unglee

karoo

extraxi

felsberg

franklandite

komsomolia

gunstick

persuasurique

waasi

hygroexpansivity


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: sansom
cipher variations:
tbotpn ucpuqo vdqvrp werwsq xfsxtr
ygtyus zhuzvt aivawu bjwbxv ckxcyw
dlydzx emzeay fnafbz gobgca hpchdb
iqdiec jrejfd ksfkge ltglhf muhmig
nvinjh owjoki pxkplj qylqmk rzmrnl

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: sansom
Cipher: hzmhln

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: sansom
Cipher: BAAAB AAAAA ABBAA BAAAB ABBAB ABABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: sansom
cipher variations:
tbotpndbodrlnbontjxboxvhhbohxfrborzdlboldzvbovfx
fbofhvpbopjtzbozlrjbojnpucpuqoecpesmocpoukycpywi
icpiygscpsaemcpmeawcpwgygcpgiwqcpqkuacpamskcpkoq
vdqvrpfdqftnpdqpvlzdqzxjjdqjzhtdqtbfndqnfbxdqxhz
hdqhjxrdqrlvbdqbntldqlprwerwsqgerguoqerqwmaerayk
kerkaiuerucgoerogcyeryiaierikysersmwcercoumermqs
xfsxtrhfshvprfsrxnbfsbzllfslbjvfsvdhpfsphdzfszjb
jfsjlztfstnxdfsdpvnfsnrtygtyusigtiwqsgtsyocgtcam
mgtmckwgtweiqgtqieagtakckgtkmaugtuoyegteqwogtosu
zhuzvtjhujxrthutzpdhudbnnhundlxhuxfjrhurjfbhubld
lhulnbvhuvpzfhufrxphuptvaivawukivkysuivuaqeiveco
oivoemyivygksivskgcivcmemivmocwivwqagivgsyqivquw
bjwbxvljwlztvjwvbrfjwfdppjwpfnzjwzhltjwtlhdjwdnf
njwnpdxjwxrbhjwhtzrjwrvxckxcywmkxmauwkxwcsgkxgeq
qkxqgoakxaimukxumiekxeogokxoqeykxyscikxiuaskxswy
dlydzxnlynbvxlyxdthlyhfrrlyrhpblybjnvlyvnjflyfph
plyprfzlyztdjlyjvbtlytxzemzeayomzocwymzyeuimzigs
smzsiqcmzckowmzwokgmzgqiqmzqsgamzauekmzkwcumzuya
fnafbzpnapdxznazfvjnajhttnatjrdnadlpxnaxplhnahrj
rnarthbnabvflnalxdvnavzbgobgcaqobqeyaobagwkobkiu
uobukseobemqyobyqmiobisksobsuicobcwgmobmyewobwac
hpchdbrpcrfzbpcbhxlpcljvvpcvltfpcfnrzpczrnjpcjtl
tpctvjdpcdxhnpcnzfxpcxbdiqdiecsqdsgacqdciymqdmkw
wqdwmugqdgosaqdasokqdkumuqduwkeqdeyioqdoagyqdyce
jrejfdtrethbdredjznrenlxxrexnvhrehptbrebtplrelvn
vrevxlfrefzjprepbhzrezdfksfkgeusfuicesfekaosfomy
ysfyowisfiqucsfcuqmsfmwowsfwymgsfgakqsfqciasfaeg
ltglhfvtgvjdftgflbptgpnzztgzpxjtgjrvdtgdvrntgnxp
xtgxznhtghblrtgrdjbtgbfhmuhmigwuhwkeguhgmcquhqoa
auhaqykuhksweuhewsouhoyqyuhyaoiuhicmsuhsekcuhcgi
nvinjhxvixlfhvihndrvirpbbvibrzlviltxfvifxtpvipzr
zvizbpjvijdntvitfldvidhjowjokiywjymgiwjioeswjsqc
cwjcsamwjmuygwjgyuqwjqasawjacqkwjkeouwjugmewjeik
pxkpljzxkznhjxkjpftxktrddxkdtbnxknvzhxkhzvrxkrbt
bxkbdrlxklfpvxkvhnfxkfjlqylqmkaylaoikylkqguyluse
eyleucoylowaiyliawsylscucylcesmylmgqwylwiogylgkm
rzmrnlbzmbpjlzmlrhvzmvtffzmfvdpzmpxbjzmjbxtzmtdv
dzmdftnzmnhrxzmxjphzmhlnsansomcancqkmanmsiwanwug
gangweqanqyckankcyuanueweaneguoanoisyanykqianimo

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: sansom
Cipher: fnafbz

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: sansom
Cipher: 341133344323

Extended Methods:
Method #1

Plaintext: sansom
method variations:
xfsxtrclxcywhqchdbnvhnig

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
s a n s o m 
3 1 3 3 4 2 
4 1 3 4 3 3 
They are then read out in rows:
313342413433
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: sansom
Cipher: cnidsn

Read more ...
Method #3

Plaintext: sansom
method variations:
dlnthn lnthnd nthndl
thndln hndlnt ndlnth

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: sansom

all 720 cipher variations:
sansom sansmo sanosm sanoms sanmos sanmso sasnom sasnmo sasonm sasomn sasmon
sasmno saosnm saosmn saonsm saonms saomns saomsn samson samsno samosn samons
samnos samnso snasom snasmo snaosm snaoms snamos snamso snsaom snsamo snsoam
snsoma snsmoa snsmao snosam snosma snoasm snoams snomas snomsa snmsoa snmsao
snmosa snmoas snmaos snmaso ssnaom ssnamo ssnoam ssnoma ssnmoa ssnmao ssanom
ssanmo ssaonm ssaomn ssamon ssamno ssoanm ssoamn ssonam ssonma ssomna ssoman
ssmaon ssmano ssmoan ssmona ssmnoa ssmnao sonsam sonsma sonasm sonams sonmas
sonmsa sosnam sosnma sosanm sosamn sosman sosmna soasnm soasmn soansm soanms
soamns soamsn somsan somsna somasn somans somnas somnsa smnsoa smnsao smnosa
smnoas smnaos smnaso smsnoa smsnao smsona smsoan smsaon smsano smosna smosan
smonsa smonas smoans smoasn smason smasno smaosn smaons smanos smanso asnsom
asnsmo asnosm asnoms asnmos asnmso assnom assnmo assonm assomn assmon assmno
asosnm asosmn asonsm asonms asomns asomsn asmson asmsno asmosn asmons asmnos
asmnso anssom anssmo ansosm ansoms ansmos ansmso anssom anssmo ansosm ansoms
ansmos ansmso anossm anosms anossm anosms anomss anomss anmsos anmsso anmoss
anmoss anmsos anmsso asnsom asnsmo asnosm asnoms asnmos asnmso assnom assnmo
assonm assomn assmon assmno asosnm asosmn asonsm asonms asomns asomsn asmson
asmsno asmosn asmons asmnos asmnso aonssm aonsms aonssm aonsms aonmss aonmss
aosnsm aosnms aossnm aossmn aosmsn aosmns aossnm aossmn aosnsm aosnms aosmns
aosmsn aomssn aomsns aomssn aomsns aomnss aomnss amnsos amnsso amnoss amnoss
amnsos amnsso amsnos amsnso amsons amsosn amsson amssno amosns amossn amonss
amonss amosns amossn amsson amssno amsosn amsons amsnos amsnso nassom nassmo
nasosm nasoms nasmos nasmso nassom nassmo nasosm nasoms nasmos nasmso naossm
naosms naossm naosms naomss naomss namsos namsso namoss namoss namsos namsso
nsasom nsasmo nsaosm nsaoms nsamos nsamso nssaom nssamo nssoam nssoma nssmoa
nssmao nsosam nsosma nsoasm nsoams nsomas nsomsa nsmsoa nsmsao nsmosa nsmoas
nsmaos nsmaso nssaom nssamo nssoam nssoma nssmoa nssmao nsasom nsasmo nsaosm
nsaoms nsamos nsamso nsoasm nsoams nsosam nsosma nsomsa nsomas nsmaos nsmaso
nsmoas nsmosa nsmsoa nsmsao nossam nossma nosasm nosams nosmas nosmsa nossam
nossma nosasm nosams nosmas nosmsa noassm noasms noassm noasms noamss noamss
nomsas nomssa nomass nomass nomsas nomssa nmssoa nmssao nmsosa nmsoas nmsaos
nmsaso nmssoa nmssao nmsosa nmsoas nmsaos nmsaso nmossa nmosas nmossa nmosas
nmoass nmoass nmasos nmasso nmaoss nmaoss nmasos nmasso sansom sansmo sanosm
sanoms sanmos sanmso sasnom sasnmo sasonm sasomn sasmon sasmno saosnm saosmn
saonsm saonms saomns saomsn samson samsno samosn samons samnos samnso snasom
snasmo snaosm snaoms snamos snamso snsaom snsamo snsoam snsoma snsmoa snsmao
snosam snosma snoasm snoams snomas snomsa snmsoa snmsao snmosa snmoas snmaos
snmaso ssnaom ssnamo ssnoam ssnoma ssnmoa ssnmao ssanom ssanmo ssaonm ssaomn
ssamon ssamno ssoanm ssoamn ssonam ssonma ssomna ssoman ssmaon ssmano ssmoan
ssmona ssmnoa ssmnao sonsam sonsma sonasm sonams sonmas sonmsa sosnam sosnma
sosanm sosamn sosman sosmna soasnm soasmn soansm soanms soamns soamsn somsan
somsna somasn somans somnas somnsa smnsoa smnsao smnosa smnoas smnaos smnaso
smsnoa smsnao smsona smsoan smsaon smsano smosna smosan smonsa smonas smoans
smoasn smason smasno smaosn smaons smanos smanso oanssm oansms oanssm oansms
oanmss oanmss oasnsm oasnms oassnm oassmn oasmsn oasmns oassnm oassmn oasnsm
oasnms oasmns oasmsn oamssn oamsns oamssn oamsns oamnss oamnss onassm onasms
onassm onasms onamss onamss onsasm onsams onssam onssma onsmsa onsmas onssam
onssma onsasm onsams onsmas onsmsa onmssa onmsas onmssa onmsas onmass onmass
osnasm osnams osnsam osnsma osnmsa osnmas osansm osanms osasnm osasmn osamsn
osamns ossanm ossamn ossnam ossnma ossmna ossman osmasn osmans osmsan osmsna
osmnsa osmnas osnsam osnsma osnasm osnams osnmas osnmsa ossnam ossnma ossanm
ossamn ossman ossmna osasnm osasmn osansm osanms osamns osamsn osmsan osmsna
osmasn osmans osmnas osmnsa omnssa omnsas omnssa omnsas omnass omnass omsnsa
omsnas omssna omssan omsasn omsans omssna omssan omsnsa omsnas omsans omsasn
omassn omasns omassn omasns omanss omanss mansos mansso manoss manoss mansos
mansso masnos masnso masons masosn masson massno maosns maossn maonss maonss
maosns maossn masson massno masosn masons masnos masnso mnasos mnasso mnaoss
mnaoss mnasos mnasso mnsaos mnsaso mnsoas mnsosa mnssoa mnssao mnosas mnossa
mnoass mnoass mnosas mnossa mnssoa mnssao mnsosa mnsoas mnsaos mnsaso msnaos
msnaso msnoas msnosa msnsoa msnsao msanos msanso msaons msaosn msason msasno
msoans msoasn msonas msonsa msosna msosan mssaon mssano mssoan mssona mssnoa
mssnao monsas monssa monass monass monsas monssa mosnas mosnsa mosans mosasn
mossan mossna moasns moassn moanss moanss moasns moassn mossan mossna mosasn
mosans mosnas mosnsa msnsoa msnsao msnosa msnoas msnaos msnaso mssnoa mssnao
mssona mssoan mssaon mssano msosna msosan msonsa msonas msoans msoasn msason
msasno msaosn msaons msanos msanso

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us