easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

rearden

psychologic

peragrabimus

phaedramque

paratransversan

unscratchable

sacalaits

priapean

movieize

subigerint

dustbin

addrest

compresent

vulneremus

freezerburn

ambrosetti

cumbe

skydiver


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: rottlerin
cipher variations:
spuumfsjo tqvvngtkp urwwohulq vsxxpivmr wtyyqjwns
xuzzrkxot yvaaslypu zwbbtmzqv axccunarw byddvobsx
czeewpcty daffxqduz ebggyreva fchhzsfwb gdiiatgxc
hejjbuhyd ifkkcvize jglldwjaf khmmexkbg linnfylch
mjoogzmdi nkpphanej olqqibofk pmrrjcpgl qnsskdqhm

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: rottlerin
Cipher: ilggovirm

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: rottlerin
Cipher: BAAAA ABBAB BAABA BAABA ABABA AABAA BAAAA ABAAA ABBAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: rottlerin
cipher variations:
spuumfsjoargginazoitssevipoqveeadqfoyxqqwlyvogzccstglowdaakjwroefmmgreho
mhyyczmxoujkkyhunoclwwupcdokniiqxktotqvvngtkpbshhjobapjuttfwjqprwffbergp
zyrrxmzwphaddtuhmpxebblkxspfgnnhsfipnizzdanypvkllzivopdmxxvqdeplojjrylup
urwwohulqctiikpcbqkvuugxkrqsxggcfshqazssynaxqibeeuvinqyfccmlytqghooitgjq
ojaaebozqwlmmajwpqenyywrefqmpkkszmvqvsxxpivmrdujjlqdcrlwvvhylsrtyhhdgtir
battzobyrjcffvwjorzgddnmzurhippjuhkrpkbbfcparxmnnbkxqrfozzxsfgrnqlltanwr
wtyyqjwnsevkkmredsmxwwizmtsuziiehujscbuuapczskdggwxkpsaheeonavsijqqkvils
qlccgdqbsynooclyrsgpaaytghsormmuboxsxuzzrkxotfwllnsfetnyxxjanutvajjfivkt
dcvvbqdatlehhxylqtbiffpobwtjkrrlwjmtrmddherctzoppdmzsthqbbzuhitpsnnvcpyt
yvaaslypugxmmotgfuozyykbovuwbkkgjwluedwwcrebumfiiyzmrucjggqpcxuklssmxknu
sneeifsduapqqenatuirccavijuqtoowdqzuzwbbtmzqvhynnpuhgvpazzlcpwvxcllhkxmv
fexxdsfcvngjjzansvdkhhrqdyvlmttnylovtoffjgtevbqrrfobuvjsddbwjkvruppxerav
axccunarwizooqvihwqbaamdqxwydmmilynwgfyyetgdwohkkabotweliisrezwmnuuozmpw
upggkhufwcrssgpcvwkteecxklwsvqqyfsbwbyddvobsxjapprwjixrcbbneryxzennjmzox
hgzzfuhexpillbcpuxfmjjtsfaxnovvpanqxvqhhlivgxdstthqdwxluffdylmxtwrrzgtcx
czeewpctykbqqsxkjysdccofszyafooknapyihaagvifyqjmmcdqvygnkkutgbyopwwqbory
wriimjwhyetuuirexymvggezmnyuxssahudydaffxqduzlcrrtylkzteddpgtazbgpplobqz
jibbhwjgzrknnderwzhollvuhczpqxxrcpszxsjjnkxizfuvvjsfyznwhhfanozvyttbivez
ebggyrevamdssuzmlaufeeqhubachqqmpcrakjccixkhaslooefsxaipmmwvidaqryysdqta
ytkkolyjagvwwktgzaoxiigbopawzuucjwfafchhzsfwbnettvanmbvgffrivcbdirrnqdsb
lkddjylibtmppfgtybjqnnxwjebrszzterubzullpmzkbhwxxluhabpyjjhcpqbxavvdkxgb
gdiiatgxcofuuwboncwhggsjwdcejssoretcmleekzmjcunqqghuzckrooyxkfcstaaufsvc
avmmqnalcixyymvibcqzkkidqrcybwwelyhchejjbuhydpgvvxcpodxihhtkxedfkttpsfud
nmfflankdvorrhivadlsppzylgdtubbvgtwdbwnnrobmdjyzznwjcdralljersdzcxxfmzid
ifkkcvizeqhwwydqpeyjiiulyfegluuqtgveonggmbolewpssijwbemtqqazmheuvccwhuxe
cxoospcnekzaaoxkdesbmmkfsteadyygnajejglldwjafrixxzerqfzkjjvmzgfhmvvruhwf
pohhncpmfxqttjkxcfnurrbanifvwddxivyfdypptqdoflabbpyleftcnnlgtufbezzhobkf
khmmexkbgsjyyafsrgalkkwnahginwwsvixgqpiiodqngyruuklydgovsscbojgwxeeyjwzg
ezqqurepgmbccqzmfgudoomhuvgcfaaipclglinnfylchtkzzbgtshbmllxobihjoxxtwjyh
rqjjperohzsvvlmzehpwttdcpkhxyffzkxahfarrvsfqhncddranghveppnivwhdgbbjqdmh
mjoogzmdiulaachuticnmmypcjikpyyuxkzisrkkqfspiatwwmnafiqxuuedqliyzggalybi
gbsswtgriodeesbohiwfqqojwxiehcckreninkpphanejvmbbdivujdonnzqdkjlqzzvylaj
tsllrgtqjbuxxnobgjryvvfermjzahhbmzcjhcttxuhsjpefftcpijxgrrpkxyjfiddlsfoj
olqqibofkwnccejwvkepooarelkmraawzmbkutmmshurkcvyyopchkszwwgfsnkabiicnadk
iduuyvitkqfggudqjkyhssqlyzkgjeemtgpkpmrrjcpglxoddfkxwlfqppbsfmlnsbbxancl
vunntivsldwzzpqdiltaxxhgtolbcjjdobeljevvzwjulrghhverklzittrmzalhkffnuhql
qnsskdqhmypeeglyxmgrqqctgnmotccybodmwvooujwtmexaaqrejmubyyihupmcdkkepcfm
kfwwaxkvmshiiwfslmajuusnabmilggovirmrottlerinzqffhmzynhsrrduhonpuddzcpen
xwppvkxunfybbrsfknvczzjivqndellfqdgnlgxxbylwntijjxgtmnbkvvtobcnjmhhpwjsn

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: rottlerin
Cipher: ebggyreva

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: rottlerin
Cipher: 244344441351244233

Extended Methods:
Method #1

Plaintext: rottlerin
method variations:
wtyyqkwosbyddvpbtxgdiiaugycmioofzmdh

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r o t t l e r i n 
2 4 4 4 1 5 2 4 3 
4 3 4 4 3 1 4 2 3 
They are then read out in rows:
244415243434431423
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: rottlerin
Cipher: rtvrssoqm

Read more ...
Method #3

Plaintext: rottlerin
method variations:
tstdxftmh stdxftmht tdxftmhts
dxftmhtst xftmhtstd ftmhtstdx
tmhtstdxf mhtstdxft htstdxftm

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: rottlerin

first 5040 cipher variations(362880 total)
rottlerin rottlerni rottleirn rottleinr rottlenir rottlenri rottlrein rottlreni rottlrien rottlrine rottlrnie
rottlrnei rottliren rottlirne rottliern rottlienr rottliner rottlinre rottlnrie rottlnrei rottlnire rottlnier
rottlneir rottlneri rottelrin rottelrni rottelirn rottelinr rottelnir rottelnri rotterlin rotterlni rotteriln
rotterinl rotternil rotternli rotteirln rotteirnl rotteilrn rotteilnr rotteinlr rotteinrl rottenril rottenrli
rottenirl rottenilr rottenlir rottenlri rottrelin rottrelni rottreiln rottreinl rottrenil rottrenli rottrlein
rottrleni rottrlien rottrline rottrlnie rottrlnei rottrilen rottrilne rottrieln rottrienl rottrinel rottrinle
rottrnlie rottrnlei rottrnile rottrniel rottrneil rottrneli rottierln rottiernl rottielrn rottielnr rottienlr
rottienrl rottireln rottirenl rottirlen rottirlne rottirnle rottirnel rottilren rottilrne rottilern rottilenr
rottilner rottilnre rottinrle rottinrel rottinlre rottinler rottinelr rottinerl rottneril rottnerli rottneirl
rottneilr rottnelir rottnelri rottnreil rottnreli rottnriel rottnrile rottnrlie rottnrlei rottnirel rottnirle
rottnierl rottnielr rottniler rottnilre rottnlrie rottnlrei rottnlire rottnlier rottnleir rottnleri rotlterin
rotlterni rotlteirn rotlteinr rotltenir rotltenri rotltrein rotltreni rotltrien rotltrine rotltrnie rotltrnei
rotltiren rotltirne rotltiern rotltienr rotltiner rotltinre rotltnrie rotltnrei rotltnire rotltnier rotltneir
rotltneri rotletrin rotletrni rotletirn rotletinr rotletnir rotletnri rotlertin rotlertni rotleritn rotlerint
rotlernit rotlernti rotleirtn rotleirnt rotleitrn rotleitnr rotleintr rotleinrt rotlenrit rotlenrti rotlenirt
rotlenitr rotlentir rotlentri rotlretin rotlretni rotlreitn rotlreint rotlrenit rotlrenti rotlrtein rotlrteni
rotlrtien rotlrtine rotlrtnie rotlrtnei rotlriten rotlritne rotlrietn rotlrient rotlrinet rotlrinte rotlrntie
rotlrntei rotlrnite rotlrniet rotlrneit rotlrneti rotliertn rotliernt rotlietrn rotlietnr rotlientr rotlienrt
rotliretn rotlirent rotlirten rotlirtne rotlirnte rotlirnet rotlitren rotlitrne rotlitern rotlitenr rotlitner
rotlitnre rotlinrte rotlinret rotlintre rotlinter rotlinetr rotlinert rotlnerit rotlnerti rotlneirt rotlneitr
rotlnetir rotlnetri rotlnreit rotlnreti rotlnriet rotlnrite rotlnrtie rotlnrtei rotlniret rotlnirte rotlniert
rotlnietr rotlniter rotlnitre rotlntrie rotlntrei rotlntire rotlntier rotlnteir rotlnteri roteltrin roteltrni
roteltirn roteltinr roteltnir roteltnri rotelrtin rotelrtni rotelritn rotelrint rotelrnit rotelrnti rotelirtn
rotelirnt rotelitrn rotelitnr rotelintr rotelinrt rotelnrit rotelnrti rotelnirt rotelnitr rotelntir rotelntri
rotetlrin rotetlrni rotetlirn rotetlinr rotetlnir rotetlnri rotetrlin rotetrlni rotetriln rotetrinl rotetrnil
rotetrnli rotetirln rotetirnl rotetilrn rotetilnr rotetinlr rotetinrl rotetnril rotetnrli rotetnirl rotetnilr
rotetnlir rotetnlri rotertlin rotertlni rotertiln rotertinl rotertnil rotertnli roterltin roterltni roterlitn
roterlint roterlnit roterlnti roteriltn roterilnt roteritln roteritnl roterintl roterinlt roternlit roternlti
roternilt roternitl roterntil roterntli roteitrln roteitrnl roteitlrn roteitlnr roteitnlr roteitnrl roteirtln
roteirtnl roteirltn roteirlnt roteirnlt roteirntl roteilrtn roteilrnt roteiltrn roteiltnr roteilntr roteilnrt
roteinrlt roteinrtl roteinlrt roteinltr roteintlr roteintrl rotentril rotentrli rotentirl rotentilr rotentlir
rotentlri rotenrtil rotenrtli rotenritl rotenrilt rotenrlit rotenrlti rotenirtl rotenirlt rotenitrl rotenitlr
roteniltr rotenilrt rotenlrit rotenlrti rotenlirt rotenlitr rotenltir rotenltri rotrletin rotrletni rotrleitn
rotrleint rotrlenit rotrlenti rotrltein rotrlteni rotrltien rotrltine rotrltnie rotrltnei rotrliten rotrlitne
rotrlietn rotrlient rotrlinet rotrlinte rotrlntie rotrlntei rotrlnite rotrlniet rotrlneit rotrlneti rotreltin
rotreltni rotrelitn rotrelint rotrelnit rotrelnti rotretlin rotretlni rotretiln rotretinl rotretnil rotretnli
rotreitln rotreitnl rotreiltn rotreilnt rotreinlt rotreintl rotrentil rotrentli rotrenitl rotrenilt rotrenlit
rotrenlti rotrtelin rotrtelni rotrteiln rotrteinl rotrtenil rotrtenli rotrtlein rotrtleni rotrtlien rotrtline
rotrtlnie rotrtlnei rotrtilen rotrtilne rotrtieln rotrtienl rotrtinel rotrtinle rotrtnlie rotrtnlei rotrtnile
rotrtniel rotrtneil rotrtneli rotrietln rotrietnl rotrieltn rotrielnt rotrienlt rotrientl rotriteln rotritenl
rotritlen rotritlne rotritnle rotritnel rotrilten rotriltne rotriletn rotrilent rotrilnet rotrilnte rotrintle
rotrintel rotrinlte rotrinlet rotrinelt rotrinetl rotrnetil rotrnetli rotrneitl rotrneilt rotrnelit rotrnelti
rotrnteil rotrnteli rotrntiel rotrntile rotrntlie rotrntlei rotrnitel rotrnitle rotrnietl rotrnielt rotrnilet
rotrnilte rotrnltie rotrnltei rotrnlite rotrnliet rotrnleit rotrnleti rotilertn rotilernt rotiletrn rotiletnr
rotilentr rotilenrt rotilretn rotilrent rotilrten rotilrtne rotilrnte rotilrnet rotiltren rotiltrne rotiltern
rotiltenr rotiltner rotiltnre rotilnrte rotilnret rotilntre rotilnter rotilnetr rotilnert rotielrtn rotielrnt
rotieltrn rotieltnr rotielntr rotielnrt rotierltn rotierlnt rotiertln rotiertnl rotierntl rotiernlt rotietrln
rotietrnl rotietlrn rotietlnr rotietnlr rotietnrl rotienrtl rotienrlt rotientrl rotientlr rotienltr rotienlrt
rotireltn rotirelnt rotiretln rotiretnl rotirentl rotirenlt rotirletn rotirlent rotirlten rotirltne rotirlnte
rotirlnet rotirtlen rotirtlne rotirteln rotirtenl rotirtnel rotirtnle rotirnlte rotirnlet rotirntle rotirntel
rotirnetl rotirnelt rotiterln rotiternl rotitelrn rotitelnr rotitenlr rotitenrl rotitreln rotitrenl rotitrlen
rotitrlne rotitrnle rotitrnel rotitlren rotitlrne rotitlern rotitlenr rotitlner rotitlnre rotitnrle rotitnrel
rotitnlre rotitnler rotitnelr rotitnerl rotinertl rotinerlt rotinetrl rotinetlr rotineltr rotinelrt rotinretl
rotinrelt rotinrtel rotinrtle rotinrlte rotinrlet rotintrel rotintrle rotinterl rotintelr rotintler rotintlre
rotinlrte rotinlret rotinltre rotinlter rotinletr rotinlert rotnlerit rotnlerti rotnleirt rotnleitr rotnletir
rotnletri rotnlreit rotnlreti rotnlriet rotnlrite rotnlrtie rotnlrtei rotnliret rotnlirte rotnliert rotnlietr
rotnliter rotnlitre rotnltrie rotnltrei rotnltire rotnltier rotnlteir rotnlteri rotnelrit rotnelrti rotnelirt
rotnelitr rotneltir rotneltri rotnerlit rotnerlti rotnerilt rotneritl rotnertil rotnertli rotneirlt rotneirtl
rotneilrt rotneiltr rotneitlr rotneitrl rotnetril rotnetrli rotnetirl rotnetilr rotnetlir rotnetlri rotnrelit
rotnrelti rotnreilt rotnreitl rotnretil rotnretli rotnrleit rotnrleti rotnrliet rotnrlite rotnrltie rotnrltei
rotnrilet rotnrilte rotnrielt rotnrietl rotnritel rotnritle rotnrtlie rotnrtlei rotnrtile rotnrtiel rotnrteil
rotnrteli rotnierlt rotniertl rotnielrt rotnieltr rotnietlr rotnietrl rotnirelt rotniretl rotnirlet rotnirlte
rotnirtle rotnirtel rotnilret rotnilrte rotnilert rotniletr rotnilter rotniltre rotnitrle rotnitrel rotnitlre
rotnitler rotnitelr rotniterl rotnteril rotnterli rotnteirl rotnteilr rotntelir rotntelri rotntreil rotntreli
rotntriel rotntrile rotntrlie rotntrlei rotntirel rotntirle rotntierl rotntielr rotntiler rotntilre rotntlrie
rotntlrei rotntlire rotntlier rotntleir rotntleri rottlerin rottlerni rottleirn rottleinr rottlenir rottlenri
rottlrein rottlreni rottlrien rottlrine rottlrnie rottlrnei rottliren rottlirne rottliern rottlienr rottliner
rottlinre rottlnrie rottlnrei rottlnire rottlnier rottlneir rottlneri rottelrin rottelrni rottelirn rottelinr
rottelnir rottelnri rotterlin rotterlni rotteriln rotterinl rotternil rotternli rotteirln rotteirnl rotteilrn
rotteilnr rotteinlr rotteinrl rottenril rottenrli rottenirl rottenilr rottenlir rottenlri rottrelin rottrelni
rottreiln rottreinl rottrenil rottrenli rottrlein rottrleni rottrlien rottrline rottrlnie rottrlnei rottrilen
rottrilne rottrieln rottrienl rottrinel rottrinle rottrnlie rottrnlei rottrnile rottrniel rottrneil rottrneli
rottierln rottiernl rottielrn rottielnr rottienlr rottienrl rottireln rottirenl rottirlen rottirlne rottirnle
rottirnel rottilren rottilrne rottilern rottilenr rottilner rottilnre rottinrle rottinrel rottinlre rottinler
rottinelr rottinerl rottneril rottnerli rottneirl rottneilr rottnelir rottnelri rottnreil rottnreli rottnriel
rottnrile rottnrlie rottnrlei rottnirel rottnirle rottnierl rottnielr rottniler rottnilre rottnlrie rottnlrei
rottnlire rottnlier rottnleir rottnleri rotlterin rotlterni rotlteirn rotlteinr rotltenir rotltenri rotltrein
rotltreni rotltrien rotltrine rotltrnie rotltrnei rotltiren rotltirne rotltiern rotltienr rotltiner rotltinre
rotltnrie rotltnrei rotltnire rotltnier rotltneir rotltneri rotletrin rotletrni rotletirn rotletinr rotletnir
rotletnri rotlertin rotlertni rotleritn rotlerint rotlernit rotlernti rotleirtn rotleirnt rotleitrn rotleitnr
rotleintr rotleinrt rotlenrit rotlenrti rotlenirt rotlenitr rotlentir rotlentri rotlretin rotlretni rotlreitn
rotlreint rotlrenit rotlrenti rotlrtein rotlrteni rotlrtien rotlrtine rotlrtnie rotlrtnei rotlriten rotlritne
rotlrietn rotlrient rotlrinet rotlrinte rotlrntie rotlrntei rotlrnite rotlrniet rotlrneit rotlrneti rotliertn
rotliernt rotlietrn rotlietnr rotlientr rotlienrt rotliretn rotlirent rotlirten rotlirtne rotlirnte rotlirnet
rotlitren rotlitrne rotlitern rotlitenr rotlitner rotlitnre rotlinrte rotlinret rotlintre rotlinter rotlinetr
rotlinert rotlnerit rotlnerti rotlneirt rotlneitr rotlnetir rotlnetri rotlnreit rotlnreti rotlnriet rotlnrite
rotlnrtie rotlnrtei rotlniret rotlnirte rotlniert rotlnietr rotlniter rotlnitre rotlntrie rotlntrei rotlntire
rotlntier rotlnteir rotlnteri roteltrin roteltrni roteltirn roteltinr roteltnir roteltnri rotelrtin rotelrtni
rotelritn rotelrint rotelrnit rotelrnti rotelirtn rotelirnt rotelitrn rotelitnr rotelintr rotelinrt rotelnrit
rotelnrti rotelnirt rotelnitr rotelntir rotelntri rotetlrin rotetlrni rotetlirn rotetlinr rotetlnir rotetlnri
rotetrlin rotetrlni rotetriln rotetrinl rotetrnil rotetrnli rotetirln rotetirnl rotetilrn rotetilnr rotetinlr
rotetinrl rotetnril rotetnrli rotetnirl rotetnilr rotetnlir rotetnlri rotertlin rotertlni rotertiln rotertinl
rotertnil rotertnli roterltin roterltni roterlitn roterlint roterlnit roterlnti roteriltn roterilnt roteritln
roteritnl roterintl roterinlt roternlit roternlti roternilt roternitl roterntil roterntli roteitrln roteitrnl
roteitlrn roteitlnr roteitnlr roteitnrl roteirtln roteirtnl roteirltn roteirlnt roteirnlt roteirntl roteilrtn
roteilrnt roteiltrn roteiltnr roteilntr roteilnrt roteinrlt roteinrtl roteinlrt roteinltr roteintlr roteintrl
rotentril rotentrli rotentirl rotentilr rotentlir rotentlri rotenrtil rotenrtli rotenritl rotenrilt rotenrlit
rotenrlti rotenirtl rotenirlt rotenitrl rotenitlr roteniltr rotenilrt rotenlrit rotenlrti rotenlirt rotenlitr
rotenltir rotenltri rotrletin rotrletni rotrleitn rotrleint rotrlenit rotrlenti rotrltein rotrlteni rotrltien
rotrltine rotrltnie rotrltnei rotrliten rotrlitne rotrlietn rotrlient rotrlinet rotrlinte rotrlntie rotrlntei
rotrlnite rotrlniet rotrlneit rotrlneti rotreltin rotreltni rotrelitn rotrelint rotrelnit rotrelnti rotretlin
rotretlni rotretiln rotretinl rotretnil rotretnli rotreitln rotreitnl rotreiltn rotreilnt rotreinlt rotreintl
rotrentil rotrentli rotrenitl rotrenilt rotrenlit rotrenlti rotrtelin rotrtelni rotrteiln rotrteinl rotrtenil
rotrtenli rotrtlein rotrtleni rotrtlien rotrtline rotrtlnie rotrtlnei rotrtilen rotrtilne rotrtieln rotrtienl
rotrtinel rotrtinle rotrtnlie rotrtnlei rotrtnile rotrtniel rotrtneil rotrtneli rotrietln rotrietnl rotrieltn
rotrielnt rotrienlt rotrientl rotriteln rotritenl rotritlen rotritlne rotritnle rotritnel rotrilten rotriltne
rotriletn rotrilent rotrilnet rotrilnte rotrintle rotrintel rotrinlte rotrinlet rotrinelt rotrinetl rotrnetil
rotrnetli rotrneitl rotrneilt rotrnelit rotrnelti rotrnteil rotrnteli rotrntiel rotrntile rotrntlie rotrntlei
rotrnitel rotrnitle rotrnietl rotrnielt rotrnilet rotrnilte rotrnltie rotrnltei rotrnlite rotrnliet rotrnleit
rotrnleti rotilertn rotilernt rotiletrn rotiletnr rotilentr rotilenrt rotilretn rotilrent rotilrten rotilrtne
rotilrnte rotilrnet rotiltren rotiltrne rotiltern rotiltenr rotiltner rotiltnre rotilnrte rotilnret rotilntre
rotilnter rotilnetr rotilnert rotielrtn rotielrnt rotieltrn rotieltnr rotielntr rotielnrt rotierltn rotierlnt
rotiertln rotiertnl rotierntl rotiernlt rotietrln rotietrnl rotietlrn rotietlnr rotietnlr rotietnrl rotienrtl
rotienrlt rotientrl rotientlr rotienltr rotienlrt rotireltn rotirelnt rotiretln rotiretnl rotirentl rotirenlt
rotirletn rotirlent rotirlten rotirltne rotirlnte rotirlnet rotirtlen rotirtlne rotirteln rotirtenl rotirtnel
rotirtnle rotirnlte rotirnlet rotirntle rotirntel rotirnetl rotirnelt rotiterln rotiternl rotitelrn rotitelnr
rotitenlr rotitenrl rotitreln rotitrenl rotitrlen rotitrlne rotitrnle rotitrnel rotitlren rotitlrne rotitlern
rotitlenr rotitlner rotitlnre rotitnrle rotitnrel rotitnlre rotitnler rotitnelr rotitnerl rotinertl rotinerlt
rotinetrl rotinetlr rotineltr rotinelrt rotinretl rotinrelt rotinrtel rotinrtle rotinrlte rotinrlet rotintrel
rotintrle rotinterl rotintelr rotintler rotintlre rotinlrte rotinlret rotinltre rotinlter rotinletr rotinlert
rotnlerit rotnlerti rotnleirt rotnleitr rotnletir rotnletri rotnlreit rotnlreti rotnlriet rotnlrite rotnlrtie
rotnlrtei rotnliret rotnlirte rotnliert rotnlietr rotnliter rotnlitre rotnltrie rotnltrei rotnltire rotnltier
rotnlteir rotnlteri rotnelrit rotnelrti rotnelirt rotnelitr rotneltir rotneltri rotnerlit rotnerlti rotnerilt
rotneritl rotnertil rotnertli rotneirlt rotneirtl rotneilrt rotneiltr rotneitlr rotneitrl rotnetril rotnetrli
rotnetirl rotnetilr rotnetlir rotnetlri rotnrelit rotnrelti rotnreilt rotnreitl rotnretil rotnretli rotnrleit
rotnrleti rotnrliet rotnrlite rotnrltie rotnrltei rotnrilet rotnrilte rotnrielt rotnrietl rotnritel rotnritle
rotnrtlie rotnrtlei rotnrtile rotnrtiel rotnrteil rotnrteli rotnierlt rotniertl rotnielrt rotnieltr rotnietlr
rotnietrl rotnirelt rotniretl rotnirlet rotnirlte rotnirtle rotnirtel rotnilret rotnilrte rotnilert rotniletr
rotnilter rotniltre rotnitrle rotnitrel rotnitlre rotnitler rotnitelr rotniterl rotnteril rotnterli rotnteirl
rotnteilr rotntelir rotntelri rotntreil rotntreli rotntriel rotntrile rotntrlie rotntrlei rotntirel rotntirle
rotntierl rotntielr rotntiler rotntilre rotntlrie rotntlrei rotntlire rotntlier rotntleir rotntleri roltterin
roltterni roltteirn roltteinr rolttenir rolttenri rolttrein rolttreni rolttrien rolttrine rolttrnie rolttrnei
rolttiren rolttirne rolttiern rolttienr rolttiner rolttinre rolttnrie rolttnrei rolttnire rolttnier rolttneir
rolttneri roltetrin roltetrni roltetirn roltetinr roltetnir roltetnri roltertin roltertni rolteritn rolterint
rolternit rolternti rolteirtn rolteirnt rolteitrn rolteitnr rolteintr rolteinrt roltenrit roltenrti roltenirt
roltenitr roltentir roltentri roltretin roltretni roltreitn roltreint roltrenit roltrenti roltrtein roltrteni
roltrtien roltrtine roltrtnie roltrtnei roltriten roltritne roltrietn roltrient roltrinet roltrinte roltrntie
roltrntei roltrnite roltrniet roltrneit roltrneti roltiertn roltiernt roltietrn roltietnr roltientr roltienrt
roltiretn roltirent roltirten roltirtne roltirnte roltirnet roltitren roltitrne roltitern roltitenr roltitner
roltitnre roltinrte roltinret roltintre roltinter roltinetr roltinert roltnerit roltnerti roltneirt roltneitr
roltnetir roltnetri roltnreit roltnreti roltnriet roltnrite roltnrtie roltnrtei roltniret roltnirte roltniert
roltnietr roltniter roltnitre roltntrie roltntrei roltntire roltntier roltnteir roltnteri roltterin roltterni
roltteirn roltteinr rolttenir rolttenri rolttrein rolttreni rolttrien rolttrine rolttrnie rolttrnei rolttiren
rolttirne rolttiern rolttienr rolttiner rolttinre rolttnrie rolttnrei rolttnire rolttnier rolttneir rolttneri
roltetrin roltetrni roltetirn roltetinr roltetnir roltetnri roltertin roltertni rolteritn rolterint rolternit
rolternti rolteirtn rolteirnt rolteitrn rolteitnr rolteintr rolteinrt roltenrit roltenrti roltenirt roltenitr
roltentir roltentri roltretin roltretni roltreitn roltreint roltrenit roltrenti roltrtein roltrteni roltrtien
roltrtine roltrtnie roltrtnei roltriten roltritne roltrietn roltrient roltrinet roltrinte roltrntie roltrntei
roltrnite roltrniet roltrneit roltrneti roltiertn roltiernt roltietrn roltietnr roltientr roltienrt roltiretn
roltirent roltirten roltirtne roltirnte roltirnet roltitren roltitrne roltitern roltitenr roltitner roltitnre
roltinrte roltinret roltintre roltinter roltinetr roltinert roltnerit roltnerti roltneirt roltneitr roltnetir
roltnetri roltnreit roltnreti roltnriet roltnrite roltnrtie roltnrtei roltniret roltnirte roltniert roltnietr
roltniter roltnitre roltntrie roltntrei roltntire roltntier roltnteir roltnteri rolettrin rolettrni rolettirn
rolettinr rolettnir rolettnri roletrtin roletrtni roletritn roletrint roletrnit roletrnti roletirtn roletirnt
roletitrn roletitnr roletintr roletinrt roletnrit roletnrti roletnirt roletnitr roletntir roletntri rolettrin
rolettrni rolettirn rolettinr rolettnir rolettnri roletrtin roletrtni roletritn roletrint roletrnit roletrnti
roletirtn roletirnt roletitrn roletitnr roletintr roletinrt roletnrit roletnrti roletnirt roletnitr roletntir
roletntri rolerttin rolerttni rolertitn rolertint rolertnit rolertnti rolerttin rolerttni rolertitn rolertint
rolertnit rolertnti rolerittn roleritnt rolerittn roleritnt rolerintt rolerintt rolerntit rolerntti rolernitt
rolernitt rolerntit rolerntti roleitrtn roleitrnt roleittrn roleittnr roleitntr roleitnrt roleirttn roleirtnt
roleirttn roleirtnt roleirntt roleirntt roleitrtn roleitrnt roleittrn roleittnr roleitntr roleitnrt roleinrtt
roleinrtt roleintrt roleinttr roleinttr roleintrt rolentrit rolentrti rolentirt rolentitr rolenttir rolenttri
rolenrtit rolenrtti rolenritt rolenritt rolenrtit rolenrtti rolenirtt rolenirtt rolenitrt rolenittr rolenittr
rolenitrt rolentrit rolentrti rolentirt rolentitr rolenttir rolenttri rolrtetin rolrtetni rolrteitn rolrteint
rolrtenit rolrtenti rolrttein rolrtteni rolrttien rolrttine rolrttnie rolrttnei rolrtiten rolrtitne rolrtietn
rolrtient rolrtinet rolrtinte rolrtntie rolrtntei rolrtnite rolrtniet rolrtneit rolrtneti rolrettin rolrettni
rolretitn rolretint rolretnit rolretnti rolrettin rolrettni rolretitn rolretint rolretnit rolretnti rolreittn
rolreitnt rolreittn rolreitnt rolreintt rolreintt rolrentit rolrentti rolrenitt rolrenitt rolrentit rolrentti
rolrtetin rolrtetni rolrteitn rolrteint rolrtenit rolrtenti rolrttein rolrtteni rolrttien rolrttine rolrttnie
rolrttnei rolrtiten rolrtitne rolrtietn rolrtient rolrtinet rolrtinte rolrtntie rolrtntei rolrtnite rolrtniet
rolrtneit rolrtneti rolriettn rolrietnt rolriettn rolrietnt rolrientt rolrientt rolritetn rolritent rolritten
rolrittne rolritnte rolritnet rolritten rolrittne rolritetn rolritent rolritnet rolritnte rolrintte rolrintet
rolrintte rolrintet rolrinett rolrinett rolrnetit rolrnetti rolrneitt rolrneitt rolrnetit rolrnetti rolrnteit
rolrnteti rolrntiet rolrntite rolrnttie rolrnttei rolrnitet rolrnitte rolrniett rolrniett rolrnitet rolrnitte
rolrnttie rolrnttei rolrntite rolrntiet rolrnteit rolrnteti rolitertn roliternt rolitetrn rolitetnr rolitentr
rolitenrt rolitretn rolitrent rolitrten rolitrtne rolitrnte rolitrnet rolittren rolittrne rolittern rolittenr
rolittner rolittnre rolitnrte rolitnret rolitntre rolitnter rolitnetr rolitnert rolietrtn rolietrnt roliettrn
roliettnr rolietntr rolietnrt rolierttn roliertnt rolierttn roliertnt rolierntt rolierntt rolietrtn rolietrnt
roliettrn roliettnr rolietntr rolietnrt rolienrtt rolienrtt rolientrt rolienttr rolienttr rolientrt rolirettn
roliretnt rolirettn roliretnt rolirentt rolirentt rolirtetn rolirtent rolirtten rolirttne rolirtnte rolirtnet
rolirtten rolirttne rolirtetn rolirtent rolirtnet rolirtnte rolirntte rolirntet rolirntte rolirntet rolirnett
rolirnett rolitertn roliternt rolitetrn rolitetnr rolitentr rolitenrt rolitretn rolitrent rolitrten rolitrtne
rolitrnte rolitrnet rolittren rolittrne rolittern rolittenr rolittner rolittnre rolitnrte rolitnret rolitntre
rolitnter rolitnetr rolitnert rolinertt rolinertt rolinetrt rolinettr rolinettr rolinetrt rolinrett rolinrett
rolinrtet rolinrtte rolinrtte rolinrtet rolintret rolintrte rolintert rolintetr rolintter rolinttre rolintrte
rolintret rolinttre rolintter rolintetr rolintert rolnterit rolnterti rolnteirt rolnteitr rolntetir rolntetri
rolntreit rolntreti rolntriet rolntrite rolntrtie rolntrtei rolntiret rolntirte rolntiert rolntietr rolntiter
rolntitre rolnttrie rolnttrei rolnttire rolnttier rolntteir rolntteri rolnetrit rolnetrti rolnetirt rolnetitr
rolnettir rolnettri rolnertit rolnertti rolneritt rolneritt rolnertit rolnertti rolneirtt rolneirtt rolneitrt
rolneittr rolneittr rolneitrt rolnetrit rolnetrti rolnetirt rolnetitr rolnettir rolnettri rolnretit rolnretti
rolnreitt rolnreitt rolnretit rolnretti rolnrteit rolnrteti rolnrtiet rolnrtite rolnrttie rolnrttei rolnritet
rolnritte rolnriett rolnriett rolnritet rolnritte rolnrttie rolnrttei rolnrtite rolnrtiet rolnrteit rolnrteti
rolniertt rolniertt rolnietrt rolniettr rolniettr rolnietrt rolnirett rolnirett rolnirtet rolnirtte rolnirtte
rolnirtet rolnitret rolnitrte rolnitert rolnitetr rolnitter rolnittre rolnitrte rolnitret rolnittre rolnitter
rolnitetr rolnitert rolnterit rolnterti rolnteirt rolnteitr rolntetir rolntetri rolntreit rolntreti rolntriet
rolntrite rolntrtie rolntrtei rolntiret rolntirte rolntiert rolntietr rolntiter rolntitre rolnttrie rolnttrei
rolnttire rolnttier rolntteir rolntteri roetltrin roetltrni roetltirn roetltinr roetltnir roetltnri roetlrtin
roetlrtni roetlritn roetlrint roetlrnit roetlrnti roetlirtn roetlirnt roetlitrn roetlitnr roetlintr roetlinrt
roetlnrit roetlnrti roetlnirt roetlnitr roetlntir roetlntri roettlrin roettlrni roettlirn roettlinr roettlnir
roettlnri roettrlin roettrlni roettriln roettrinl roettrnil roettrnli roettirln roettirnl roettilrn roettilnr
roettinlr roettinrl roettnril roettnrli roettnirl roettnilr roettnlir roettnlri roetrtlin roetrtlni roetrtiln
roetrtinl roetrtnil roetrtnli roetrltin roetrltni roetrlitn roetrlint roetrlnit roetrlnti roetriltn roetrilnt
roetritln roetritnl roetrintl roetrinlt roetrnlit roetrnlti roetrnilt roetrnitl roetrntil roetrntli roetitrln
roetitrnl roetitlrn roetitlnr roetitnlr roetitnrl roetirtln roetirtnl roetirltn roetirlnt roetirnlt roetirntl
roetilrtn roetilrnt roetiltrn roetiltnr roetilntr roetilnrt roetinrlt roetinrtl roetinlrt roetinltr roetintlr
roetintrl roetntril roetntrli roetntirl roetntilr roetntlir roetntlri roetnrtil roetnrtli roetnritl roetnrilt
roetnrlit roetnrlti roetnirtl roetnirlt roetnitrl roetnitlr roetniltr roetnilrt roetnlrit roetnlrti roetnlirt
roetnlitr roetnltir roetnltri roelttrin roelttrni roelttirn roelttinr roelttnir roelttnri roeltrtin roeltrtni
roeltritn roeltrint roeltrnit roeltrnti roeltirtn roeltirnt roeltitrn roeltitnr roeltintr roeltinrt roeltnrit
roeltnrti roeltnirt roeltnitr roeltntir roeltntri roelttrin roelttrni roelttirn roelttinr roelttnir roelttnri
roeltrtin roeltrtni roeltritn roeltrint roeltrnit roeltrnti roeltirtn roeltirnt roeltitrn roeltitnr roeltintr
roeltinrt roeltnrit roeltnrti roeltnirt roeltnitr roeltntir roeltntri roelrttin roelrttni roelrtitn roelrtint
roelrtnit roelrtnti roelrttin roelrttni roelrtitn roelrtint roelrtnit roelrtnti roelrittn roelritnt roelrittn
roelritnt roelrintt roelrintt roelrntit roelrntti roelrnitt roelrnitt roelrntit roelrntti roelitrtn roelitrnt
roelittrn roelittnr roelitntr roelitnrt roelirttn roelirtnt roelirttn roelirtnt roelirntt roelirntt roelitrtn
roelitrnt roelittrn roelittnr roelitntr roelitnrt roelinrtt roelinrtt roelintrt roelinttr roelinttr roelintrt
roelntrit roelntrti roelntirt roelntitr roelnttir roelnttri roelnrtit roelnrtti roelnritt roelnritt roelnrtit
roelnrtti roelnirtt roelnirtt roelnitrt roelnittr roelnittr roelnitrt roelntrit roelntrti roelntirt roelntitr
roelnttir roelnttri roetltrin roetltrni roetltirn roetltinr roetltnir roetltnri roetlrtin roetlrtni roetlritn
roetlrint roetlrnit roetlrnti roetlirtn roetlirnt roetlitrn roetlitnr roetlintr roetlinrt roetlnrit roetlnrti
roetlnirt roetlnitr roetlntir roetlntri roettlrin roettlrni roettlirn roettlinr roettlnir roettlnri roettrlin
roettrlni roettriln roettrinl roettrnil roettrnli roettirln roettirnl roettilrn roettilnr roettinlr roettinrl
roettnril roettnrli roettnirl roettnilr roettnlir roettnlri roetrtlin roetrtlni roetrtiln roetrtinl roetrtnil
roetrtnli roetrltin roetrltni roetrlitn roetrlint roetrlnit roetrlnti roetriltn roetrilnt roetritln roetritnl
roetrintl roetrinlt roetrnlit roetrnlti roetrnilt roetrnitl roetrntil roetrntli roetitrln roetitrnl roetitlrn
roetitlnr roetitnlr roetitnrl roetirtln roetirtnl roetirltn roetirlnt roetirnlt roetirntl roetilrtn roetilrnt
roetiltrn roetiltnr roetilntr roetilnrt roetinrlt roetinrtl roetinlrt roetinltr roetintlr roetintrl roetntril
roetntrli roetntirl roetntilr roetntlir roetntlri roetnrtil roetnrtli roetnritl roetnrilt roetnrlit roetnrlti
roetnirtl roetnirlt roetnitrl roetnitlr roetniltr roetnilrt roetnlrit roetnlrti roetnlirt roetnlitr roetnltir
roetnltri roerlttin roerlttni roerltitn roerltint roerltnit roerltnti roerlttin roerlttni roerltitn roerltint
roerltnit roerltnti roerlittn roerlitnt roerlittn roerlitnt roerlintt roerlintt roerlntit roerlntti roerlnitt
roerlnitt roerlntit roerlntti roertltin roertltni roertlitn roertlint roertlnit roertlnti roerttlin roerttlni
roerttiln roerttinl roerttnil roerttnli roertitln roertitnl roertiltn roertilnt roertinlt roertintl roertntil
roertntli roertnitl roertnilt roertnlit roertnlti roerttlin roerttlni roerttiln roerttinl roerttnil roerttnli
roertltin roertltni roertlitn roertlint roertlnit roertlnti roertiltn roertilnt roertitln roertitnl roertintl
roertinlt roertnlit roertnlti roertnilt roertnitl roertntil roertntli roerittln roerittnl roeritltn roeritlnt
roeritnlt roeritntl roerittln roerittnl roeritltn roeritlnt roeritnlt roeritntl roerilttn roeriltnt roerilttn
roeriltnt roerilntt roerilntt roerintlt roerinttl roerinltt roerinltt roerintlt roerinttl roernttil roernttli
roerntitl roerntilt roerntlit roerntlti roernttil roernttli roerntitl roerntilt roerntlit roerntlti roernittl
roernitlt roernittl roernitlt roerniltt roerniltt roernltit roernltti roernlitt roernlitt roernltit roernltti
roeiltrtn roeiltrnt roeilttrn roeilttnr roeiltntr roeiltnrt roeilrttn roeilrtnt roeilrttn roeilrtnt roeilrntt
roeilrntt roeiltrtn roeiltrnt roeilttrn roeilttnr roeiltntr roeiltnrt roeilnrtt roeilnrtt roeilntrt roeilnttr
roeilnttr roeilntrt roeitlrtn roeitlrnt roeitltrn roeitltnr roeitlntr roeitlnrt roeitrltn roeitrlnt roeitrtln
roeitrtnl roeitrntl roeitrnlt roeittrln roeittrnl roeittlrn roeittlnr roeittnlr roeittnrl roeitnrtl roeitnrlt
roeitntrl roeitntlr roeitnltr roeitnlrt roeirtltn roeirtlnt roeirttln roeirttnl roeirtntl roeirtnlt roeirlttn
roeirltnt roeirlttn roeirltnt roeirlntt roeirlntt roeirtltn roeirtlnt roeirttln roeirttnl roeirtntl roeirtnlt
roeirnltt roeirnltt roeirntlt roeirnttl roeirnttl roeirntlt roeittrln roeittrnl roeittlrn roeittlnr roeittnlr
roeittnrl roeitrtln roeitrtnl roeitrltn roeitrlnt roeitrnlt roeitrntl roeitlrtn roeitlrnt roeitltrn roeitltnr
roeitlntr roeitlnrt roeitnrlt roeitnrtl roeitnlrt roeitnltr roeitntlr roeitntrl roeintrtl roeintrlt roeinttrl
roeinttlr roeintltr roeintlrt roeinrttl roeinrtlt roeinrttl roeinrtlt roeinrltt roeinrltt roeintrtl roeintrlt
roeinttrl roeinttlr roeintltr roeintlrt roeinlrtt roeinlrtt roeinltrt roeinlttr roeinlttr roeinltrt roenltrit
roenltrti roenltirt roenltitr roenlttir roenlttri roenlrtit roenlrtti roenlritt roenlritt roenlrtit roenlrtti
roenlirtt roenlirtt roenlitrt roenlittr roenlittr roenlitrt roenltrit roenltrti roenltirt roenltitr roenlttir
roenlttri roentlrit roentlrti roentlirt roentlitr roentltir roentltri roentrlit roentrlti roentrilt roentritl
roentrtil roentrtli roentirlt roentirtl roentilrt roentiltr roentitlr roentitrl roenttril roenttrli roenttirl
roenttilr roenttlir roenttlri roenrtlit roenrtlti roenrtilt roenrtitl roenrttil roenrttli roenrltit roenrltti
roenrlitt roenrlitt roenrltit roenrltti roenriltt roenriltt roenritlt roenrittl roenrittl roenritlt roenrtlit
roenrtlti roenrtilt roenrtitl roenrttil roenrttli roenitrlt roenitrtl roenitlrt roenitltr roenittlr roenittrl
roenirtlt roenirttl roenirltt roenirltt roenirtlt roenirttl roenilrtt roenilrtt roeniltrt roenilttr roenilttr
roeniltrt roenitrlt roenitrtl roenitlrt roenitltr roenittlr roenittrl roenttril roenttrli roenttirl roenttilr
roenttlir roenttlri roentrtil roentrtli roentritl roentrilt roentrlit roentrlti roentirtl roentirlt roentitrl
roentitlr roentiltr roentilrt roentlrit roentlrti roentlirt roentlitr roentltir roentltri rortletin rortletni
rortleitn rortleint rortlenit rortlenti rortltein rortlteni rortltien rortltine rortltnie rortltnei rortliten
rortlitne rortlietn rortlient rortlinet rortlinte rortlntie rortlntei rortlnite rortlniet rortlneit rortlneti
rorteltin rorteltni rortelitn rortelint rortelnit rortelnti rortetlin rortetlni rortetiln rortetinl rortetnil
rortetnli rorteitln rorteitnl rorteiltn rorteilnt rorteinlt rorteintl rortentil rortentli rortenitl rortenilt
rortenlit rortenlti rorttelin rorttelni rortteiln rortteinl rorttenil rorttenli rorttlein rorttleni rorttlien
rorttline rorttlnie rorttlnei rorttilen rorttilne rorttieln rorttienl rorttinel rorttinle rorttnlie rorttnlei
rorttnile rorttniel rorttneil rorttneli rortietln rortietnl rortieltn rortielnt rortienlt rortientl rortiteln
rortitenl rortitlen rortitlne rortitnle rortitnel rortilten rortiltne rortiletn rortilent rortilnet rortilnte
rortintle rortintel rortinlte rortinlet rortinelt rortinetl rortnetil rortnetli rortneitl rortneilt rortnelit
rortnelti rortnteil rortnteli rortntiel rortntile rortntlie rortntlei rortnitel rortnitle rortnietl rortnielt
rortnilet rortnilte rortnltie rortnltei rortnlite rortnliet rortnleit rortnleti rorltetin rorltetni rorlteitn
rorlteint rorltenit rorltenti rorlttein rorltteni rorlttien rorlttine rorlttnie rorlttnei rorltiten rorltitne
rorltietn rorltient rorltinet rorltinte rorltntie rorltntei rorltnite rorltniet rorltneit rorltneti rorlettin
rorlettni rorletitn rorletint rorletnit rorletnti rorlettin rorlettni rorletitn rorletint rorletnit rorletnti
rorleittn rorleitnt rorleittn rorleitnt rorleintt rorleintt rorlentit rorlentti rorlenitt rorlenitt rorlentit
rorlentti rorltetin rorltetni rorlteitn rorlteint rorltenit rorltenti rorlttein rorltteni rorlttien rorlttine
rorlttnie rorlttnei rorltiten rorltitne rorltietn rorltient rorltinet rorltinte rorltntie rorltntei rorltnite
rorltniet rorltneit rorltneti rorliettn rorlietnt rorliettn rorlietnt rorlientt rorlientt rorlitetn rorlitent
rorlitten rorlittne rorlitnte rorlitnet rorlitten rorlittne rorlitetn rorlitent rorlitnet rorlitnte rorlintte
rorlintet rorlintte rorlintet rorlinett rorlinett rorlnetit rorlnetti rorlneitt rorlneitt rorlnetit rorlnetti
rorlnteit rorlnteti rorlntiet rorlntite rorlnttie rorlnttei rorlnitet rorlnitte rorlniett rorlniett rorlnitet
rorlnitte rorlnttie rorlnttei rorlntite rorlntiet rorlnteit rorlnteti rorelttin rorelttni roreltitn roreltint
roreltnit roreltnti rorelttin rorelttni roreltitn roreltint roreltnit roreltnti rorelittn rorelitnt rorelittn
rorelitnt rorelintt rorelintt rorelntit rorelntti rorelnitt rorelnitt rorelntit rorelntti roretltin roretltni
roretlitn roretlint roretlnit roretlnti rorettlin rorettlni rorettiln rorettinl rorettnil rorettnli roretitln
roretitnl roretiltn roretilnt roretinlt roretintl roretntil roretntli roretnitl roretnilt roretnlit roretnlti
rorettlin rorettlni rorettiln rorettinl rorettnil rorettnli roretltin roretltni roretlitn roretlint roretlnit
roretlnti roretiltn roretilnt roretitln roretitnl roretintl roretinlt roretnlit roretnlti roretnilt roretnitl
roretntil roretntli roreittln roreittnl roreitltn roreitlnt roreitnlt roreitntl roreittln roreittnl roreitltn
roreitlnt roreitnlt roreitntl roreilttn roreiltnt roreilttn roreiltnt roreilntt roreilntt roreintlt roreinttl
roreinltt roreinltt roreintlt roreinttl rorenttil rorenttli rorentitl rorentilt rorentlit rorentlti rorenttil
rorenttli rorentitl rorentilt rorentlit rorentlti rorenittl rorenitlt rorenittl rorenitlt roreniltt roreniltt
rorenltit rorenltti rorenlitt rorenlitt rorenltit rorenltti rortletin rortletni rortleitn rortleint rortlenit
rortlenti rortltein rortlteni rortltien rortltine rortltnie rortltnei rortliten rortlitne rortlietn rortlient
rortlinet rortlinte rortlntie rortlntei rortlnite rortlniet rortlneit rortlneti rorteltin rorteltni rortelitn
rortelint rortelnit rortelnti rortetlin rortetlni rortetiln rortetinl rortetnil rortetnli rorteitln rorteitnl
rorteiltn rorteilnt rorteinlt rorteintl rortentil rortentli rortenitl rortenilt rortenlit rortenlti rorttelin
rorttelni rortteiln rortteinl rorttenil rorttenli rorttlein rorttleni rorttlien rorttline rorttlnie rorttlnei
rorttilen rorttilne rorttieln rorttienl rorttinel rorttinle rorttnlie rorttnlei rorttnile rorttniel rorttneil
rorttneli rortietln rortietnl rortieltn rortielnt rortienlt rortientl rortiteln rortitenl rortitlen rortitlne
rortitnle rortitnel rortilten rortiltne rortiletn rortilent rortilnet rortilnte rortintle rortintel rortinlte
rortinlet rortinelt rortinetl rortnetil rortnetli rortneitl rortneilt rortnelit rortnelti rortnteil rortnteli
rortntiel rortntile rortntlie rortntlei rortnitel rortnitle rortnietl rortnielt rortnilet rortnilte rortnltie
rortnltei rortnlite rortnliet rortnleit rortnleti rorilettn roriletnt rorilettn roriletnt rorilentt rorilentt
roriltetn roriltent roriltten rorilttne roriltnte roriltnet roriltten rorilttne roriltetn roriltent roriltnet
roriltnte rorilntte rorilntet rorilntte rorilntet rorilnett rorilnett rorielttn rorieltnt rorielttn rorieltnt
rorielntt rorielntt rorietltn rorietlnt roriettln roriettnl rorietntl rorietnlt roriettln roriettnl rorietltn
rorietlnt rorietnlt rorietntl rorienttl rorientlt rorienttl rorientlt rorienltt rorienltt roriteltn roritelnt
roritetln roritetnl roritentl roritenlt roritletn roritlent roritlten roritltne roritlnte roritlnet rorittlen
rorittlne roritteln rorittenl rorittnel rorittnle roritnlte roritnlet roritntle roritntel roritnetl roritnelt
roritetln roritetnl roriteltn roritelnt roritenlt roritentl roritteln rorittenl rorittlen rorittlne rorittnle
rorittnel roritlten roritltne roritletn roritlent roritlnet roritlnte roritntle roritntel roritnlte roritnlet
roritnelt roritnetl rorinettl rorinetlt rorinettl rorinetlt rorineltt rorineltt rorintetl rorintelt rorinttel
rorinttle rorintlte rorintlet rorinttel rorinttle rorintetl rorintelt rorintlet rorintlte rorinltte rorinltet
rorinltte rorinltet rorinlett rorinlett rornletit rornletti rornleitt rornleitt rornletit rornletti rornlteit
rornlteti rornltiet rornltite rornlttie rornlttei rornlitet rornlitte rornliett rornliett rornlitet rornlitte
rornlttie rornlttei rornltite rornltiet rornlteit rornlteti rorneltit rorneltti rornelitt rornelitt rorneltit
rorneltti rornetlit rornetlti rornetilt rornetitl rornettil rornettli rorneitlt rorneittl rorneiltt rorneiltt
rorneitlt rorneittl rornettil rornettli rornetitl rornetilt rornetlit rornetlti rorntelit rorntelti rornteilt
rornteitl rorntetil rorntetli rorntleit rorntleti rorntliet rorntlite rorntltie rorntltei rorntilet rorntilte
rorntielt rorntietl rorntitel rorntitle rornttlie rornttlei rornttile rornttiel rorntteil rorntteli rornietlt
rorniettl rornieltt rornieltt rornietlt rorniettl rornitelt rornitetl rornitlet rornitlte rornittle rornittel
rorniltet rorniltte rornilett rornilett rorniltet rorniltte rornittle rornittel rornitlte rornitlet rornitelt
rornitetl rorntetil rorntetli rornteitl rornteilt rorntelit rorntelti rorntteil rorntteli rornttiel rornttile
rornttlie rornttlei rorntitel rorntitle rorntietl rorntielt rorntilet rorntilte rorntltie rorntltei rorntlite
rorntliet rorntleit rorntleti roitlertn roitlernt roitletrn roitletnr roitlentr roitlenrt roitlretn roitlrent
roitlrten roitlrtne roitlrnte roitlrnet roitltren roitltrne roitltern roitltenr roitltner roitltnre roitlnrte
roitlnret roitlntre roitlnter roitlnetr roitlnert roitelrtn roitelrnt roiteltrn roiteltnr roitelntr roitelnrt
roiterltn roiterlnt roitertln roitertnl roiterntl roiternlt roitetrln roitetrnl roitetlrn roitetlnr roitetnlr
roitetnrl roitenrtl roitenrlt roitentrl roitentlr roitenltr roitenlrt roitreltn roitrelnt roitretln roitretnl
roitrentl roitrenlt roitrletn roitrlent roitrlten roitrltne roitrlnte roitrlnet roitrtlen roitrtlne roitrteln
roitrtenl roitrtnel roitrtnle roitrnlte roitrnlet roitrntle roitrntel roitrnetl roitrnelt roitterln roitternl
roittelrn roittelnr roittenlr roittenrl roittreln roittrenl roittrlen roittrlne roittrnle roittrnel roittlren
roittlrne roittlern roittlenr roittlner roittlnre roittnrle roittnrel roittnlre roittnler roittnelr roittnerl
roitnertl roitnerlt roitnetrl roitnetlr roitneltr roitnelrt roitnretl roitnrelt roitnrtel roitnrtle roitnrlte
roitnrlet roitntrel roitntrle roitnterl roitntelr roitntler roitntlre roitnlrte roitnlret roitnltre roitnlter
roitnletr roitnlert roiltertn roilternt roiltetrn roiltetnr roiltentr roiltenrt roiltretn roiltrent roiltrten
roiltrtne roiltrnte roiltrnet roilttren roilttrne roilttern roilttenr roilttner roilttnre roiltnrte roiltnret
roiltntre roiltnter roiltnetr roiltnert roiletrtn roiletrnt roilettrn roilettnr roiletntr roiletnrt roilerttn
roilertnt roilerttn roilertnt roilerntt roilerntt roiletrtn roiletrnt roilettrn roilettnr roiletntr roiletnrt
roilenrtt roilenrtt roilentrt roilenttr roilenttr roilentrt roilrettn roilretnt roilrettn roilretnt roilrentt
roilrentt roilrtetn roilrtent roilrtten roilrttne roilrtnte roilrtnet roilrtten roilrttne roilrtetn roilrtent
roilrtnet roilrtnte roilrntte roilrntet roilrntte roilrntet roilrnett roilrnett roiltertn roilternt roiltetrn
roiltetnr roiltentr roiltenrt roiltretn roiltrent roiltrten roiltrtne roiltrnte roiltrnet roilttren roilttrne
roilttern roilttenr roilttner roilttnre roiltnrte roiltnret roiltntre roiltnter roiltnetr roiltnert roilnertt
roilnertt roilnetrt roilnettr roilnettr roilnetrt roilnrett roilnrett roilnrtet roilnrtte roilnrtte roilnrtet
roilntret roilntrte roilntert roilntetr roilntter roilnttre roilntrte roilntret roilnttre roilntter roilntetr
roilntert roieltrtn roieltrnt roielttrn roielttnr roieltntr roieltnrt roielrttn roielrtnt roielrttn roielrtnt
roielrntt roielrntt roieltrtn roieltrnt roielttrn roielttnr roieltntr roieltnrt roielnrtt roielnrtt roielntrt
roielnttr roielnttr roielntrt roietlrtn roietlrnt roietltrn roietltnr roietlntr roietlnrt roietrltn roietrlnt
roietrtln roietrtnl roietrntl roietrnlt roiettrln roiettrnl roiettlrn roiettlnr roiettnlr roiettnrl roietnrtl
roietnrlt roietntrl roietntlr roietnltr roietnlrt roiertltn roiertlnt roierttln roierttnl roiertntl roiertnlt
roierlttn roierltnt roierlttn roierltnt roierlntt roierlntt roiertltn roiertlnt roierttln roierttnl roiertntl
roiertnlt roiernltt roiernltt roierntlt roiernttl roiernttl roierntlt roiettrln roiettrnl roiettlrn roiettlnr
roiettnlr roiettnrl roietrtln roietrtnl roietrltn roietrlnt roietrnlt roietrntl roietlrtn roietlrnt roietltrn
roietltnr roietlntr roietlnrt roietnrlt roietnrtl roietnlrt roietnltr roietntlr roietntrl roientrtl roientrlt
roienttrl roienttlr roientltr roientlrt roienrttl roienrtlt roienrttl roienrtlt roienrltt roienrltt roientrtl
roientrlt roienttrl roienttlr roientltr roientlrt roienlrtt roienlrtt roienltrt roienlttr roienlttr roienltrt
roirlettn roirletnt roirlettn roirletnt roirlentt roirlentt roirltetn roirltent roirltten roirlttne roirltnte
roirltnet roirltten roirlttne roirltetn roirltent roirltnet roirltnte roirlntte roirlntet roirlntte roirlntet
roirlnett roirlnett roirelttn roireltnt roirelttn roireltnt roirelntt roirelntt roiretltn roiretlnt roirettln
roirettnl roiretntl roiretnlt roirettln roirettnl roiretltn roiretlnt roiretnlt roiretntl roirenttl roirentlt
roirenttl roirentlt roirenltt roirenltt roirteltn roirtelnt roirtetln roirtetnl roirtentl roirtenlt roirtletn
roirtlent roirtlten roirtltne roirtlnte roirtlnet roirttlen roirttlne roirtteln roirttenl roirttnel roirttnle
roirtnlte roirtnlet roirtntle roirtntel roirtnetl roirtnelt roirtetln roirtetnl roirteltn roirtelnt roirtenlt
roirtentl roirtteln roirttenl roirttlen roirttlne roirttnle roirttnel roirtlten roirtltne roirtletn roirtlent
roirtlnet roirtlnte roirtntle roirtntel roirtnlte roirtnlet roirtnelt roirtnetl roirnettl roirnetlt roirnettl
roirnetlt roirneltt roirneltt roirntetl roirntelt roirnttel roirnttle roirntlte roirntlet roirnttel roirnttle
roirntetl roirntelt roirntlet roirntlte roirnltte roirnltet roirnltte roirnltet roirnlett roirnlett roitlertn
roitlernt roitletrn roitletnr roitlentr roitlenrt roitlretn roitlrent roitlrten roitlrtne roitlrnte roitlrnet
roitltren roitltrne roitltern roitltenr roitltner roitltnre roitlnrte roitlnret roitlntre roitlnter roitlnetr
roitlnert roitelrtn roitelrnt roiteltrn roiteltnr roitelntr roitelnrt roiterltn roiterlnt roitertln roitertnl
roiterntl roiternlt roitetrln roitetrnl roitetlrn roitetlnr roitetnlr roitetnrl roitenrtl roitenrlt roitentrl
roitentlr roitenltr roitenlrt roitreltn roitrelnt roitretln roitretnl roitrentl roitrenlt roitrletn roitrlent
roitrlten roitrltne roitrlnte roitrlnet roitrtlen roitrtlne roitrteln roitrtenl roitrtnel roitrtnle roitrnlte
roitrnlet roitrntle roitrntel roitrnetl roitrnelt roitterln roitternl roittelrn roittelnr roittenlr roittenrl
roittreln roittrenl roittrlen roittrlne roittrnle roittrnel roittlren roittlrne roittlern roittlenr roittlner
roittlnre roittnrle roittnrel roittnlre roittnler roittnelr roittnerl roitnertl roitnerlt roitnetrl roitnetlr
roitneltr roitnelrt roitnretl roitnrelt roitnrtel roitnrtle roitnrlte roitnrlet roitntrel roitntrle roitnterl
roitntelr roitntler roitntlre roitnlrte roitnlret roitnltre roitnlter roitnletr roitnlert roinlertt roinlertt
roinletrt roinlettr roinlettr roinletrt roinlrett roinlrett roinlrtet roinlrtte roinlrtte roinlrtet roinltret
roinltrte roinltert roinltetr roinltter roinlttre roinltrte roinltret roinlttre roinltter roinltetr roinltert
roinelrtt roinelrtt roineltrt roinelttr roinelttr roineltrt roinerltt roinerltt roinertlt roinerttl roinerttl
roinertlt roinetrlt roinetrtl roinetlrt roinetltr roinettlr roinettrl roinetrtl roinetrlt roinettrl roinettlr
roinetltr roinetlrt roinreltt roinreltt roinretlt roinrettl roinrettl roinretlt roinrlett roinrlett roinrltet
roinrltte roinrltte roinrltet roinrtlet roinrtlte roinrtelt roinrtetl roinrttel roinrttle roinrtlte roinrtlet
roinrttle roinrttel roinrtetl roinrtelt rointerlt rointertl rointelrt rointeltr rointetlr rointetrl rointrelt
rointretl rointrlet rointrlte rointrtle rointrtel rointlret rointlrte rointlert rointletr rointlter rointltre
rointtrle rointtrel rointtlre rointtler rointtelr rointterl rointertl rointerlt rointetrl rointetlr rointeltr
rointelrt rointretl rointrelt rointrtel rointrtle rointrlte rointrlet rointtrel rointtrle rointterl rointtelr
rointtler rointtlre rointlrte rointlret rointltre rointlter rointletr rointlert rontlerit rontlerti rontleirt
rontleitr rontletir rontletri rontlreit rontlreti rontlriet rontlrite rontlrtie rontlrtei rontliret rontlirte
rontliert rontlietr rontliter rontlitre rontltrie rontltrei rontltire rontltier rontlteir rontlteri rontelrit
rontelrti rontelirt rontelitr ronteltir ronteltri ronterlit ronterlti ronterilt ronteritl rontertil rontertli
ronteirlt ronteirtl ronteilrt ronteiltr ronteitlr ronteitrl rontetril rontetrli rontetirl rontetilr rontetlir
rontetlri rontrelit rontrelti rontreilt rontreitl rontretil rontretli rontrleit rontrleti rontrliet rontrlite
rontrltie rontrltei rontrilet rontrilte rontrielt rontrietl rontritel rontritle rontrtlie rontrtlei rontrtile
rontrtiel rontrteil rontrteli rontierlt rontiertl rontielrt rontieltr rontietlr rontietrl rontirelt rontiretl
rontirlet rontirlte rontirtle rontirtel rontilret rontilrte rontilert rontiletr rontilter rontiltre rontitrle
rontitrel rontitlre rontitler rontitelr rontiterl rontteril rontterli rontteirl rontteilr ronttelir ronttelri
ronttreil ronttreli ronttriel ronttrile ronttrlie ronttrlei ronttirel ronttirle ronttierl ronttielr ronttiler
ronttilre ronttlrie ronttlrei ronttlire ronttlier ronttleir ronttleri ronlterit ronlterti ronlteirt ronlteitr
ronltetir ronltetri ronltreit ronltreti ronltriet ronltrite ronltrtie ronltrtei ronltiret ronltirte ronltiert
ronltietr ronltiter ronltitre ronlttrie ronlttrei ronlttire ronlttier ronltteir ronltteri ronletrit ronletrti
ronletirt ronletitr ronlettir ronlettri ronlertit ronlertti ronleritt ronleritt ronlertit ronlertti ronleirtt
ronleirtt ronleitrt ronleittr ronleittr ronleitrt ronletrit ronletrti ronletirt ronletitr ronlettir ronlettri
ronlretit ronlretti ronlreitt ronlreitt ronlretit ronlretti ronlrteit ronlrteti ronlrtiet ronlrtite ronlrttie
ronlrttei ronlritet ronlritte ronlriett ronlriett ronlritet ronlritte ronlrttie ronlrttei ronlrtite ronlrtiet
ronlrteit ronlrteti ronliertt ronliertt ronlietrt ronliettr ronliettr ronlietrt ronlirett ronlirett ronlirtet
ronlirtte ronlirtte ronlirtet ronlitret ronlitrte ronlitert ronlitetr ronlitter ronlittre ronlitrte ronlitret
ronlittre ronlitter ronlitetr ronlitert ronlterit ronlterti ronlteirt ronlteitr ronltetir ronltetri ronltreit
ronltreti ronltriet ronltrite ronltrtie ronltrtei ronltiret ronltirte ronltiert ronltietr ronltiter ronltitre
ronlttrie ronlttrei ronlttire ronlttier ronltteir ronltteri roneltrit roneltrti roneltirt roneltitr ronelttir
ronelttri ronelrtit ronelrtti ronelritt ronelritt ronelrtit ronelrtti ronelirtt ronelirtt ronelitrt ronelittr
ronelittr ronelitrt roneltrit roneltrti roneltirt roneltitr ronelttir ronelttri ronetlrit ronetlrti ronetlirt
ronetlitr ronetltir ronetltri ronetrlit ronetrlti ronetrilt ronetritl ronetrtil ronetrtli ronetirlt ronetirtl
ronetilrt ronetiltr ronetitlr ronetitrl ronettril ronettrli ronettirl ronettilr ronettlir ronettlri ronertlit
ronertlti ronertilt ronertitl ronerttil ronerttli ronerltit ronerltti ronerlitt ronerlitt ronerltit ronerltti
roneriltt roneriltt roneritlt ronerittl ronerittl roneritlt ronertlit ronertlti ronertilt ronertitl ronerttil
ronerttli roneitrlt roneitrtl roneitlrt roneitltr roneittlr roneittrl roneirtlt roneirttl roneirltt roneirltt
roneirtlt roneirttl roneilrtt roneilrtt roneiltrt roneilttr roneilttr roneiltrt roneitrlt roneitrtl roneitlrt
roneitltr roneittlr roneittrl ronettril ronettrli ronettirl ronettilr ronettlir ronettlri ronetrtil ronetrtli
ronetritl ronetrilt ronetrlit ronetrlti ronetirtl ronetirlt ronetitrl ronetitlr ronetiltr ronetilrt ronetlrit
ronetlrti ronetlirt ronetlitr ronetltir ronetltri ronrletit ronrletti ronrleitt ronrleitt ronrletit ronrletti
ronrlteit ronrlteti ronrltiet ronrltite ronrlttie ronrlttei ronrlitet ronrlitte ronrliett ronrliett ronrlitet
ronrlitte ronrlttie ronrlttei ronrltite ronrltiet ronrlteit ronrlteti ronreltit ronreltti ronrelitt ronrelitt
ronreltit ronreltti ronretlit ronretlti ronretilt ronretitl ronrettil ronrettli ronreitlt ronreittl ronreiltt
ronreiltt ronreitlt ronreittl ronrettil ronrettli ronretitl ronretilt ronretlit ronretlti ronrtelit ronrtelti
ronrteilt ronrteitl ronrtetil ronrtetli ronrtleit ronrtleti ronrtliet ronrtlite ronrtltie ronrtltei ronrtilet
ronrtilte ronrtielt ronrtietl ronrtitel ronrtitle ronrttlie ronrttlei ronrttile ronrttiel ronrtteil ronrtteli
ronrietlt ronriettl ronrieltt ronrieltt ronrietlt ronriettl ronritelt ronritetl ronritlet ronritlte ronrittle
ronrittel ronriltet ronriltte ronrilett ronrilett ronriltet ronriltte ronrittle ronrittel ronritlte ronritlet
ronritelt ronritetl ronrtetil ronrtetli ronrteitl ronrteilt ronrtelit ronrtelti ronrtteil ronrtteli ronrttiel
ronrttile ronrttlie ronrttlei ronrtitel ronrtitle ronrtietl ronrtielt ronrtilet ronrtilte ronrtltie ronrtltei
ronrtlite ronrtliet ronrtleit ronrtleti ronilertt ronilertt roniletrt ronilettr ronilettr roniletrt ronilrett
ronilrett ronilrtet ronilrtte ronilrtte ronilrtet roniltret roniltrte roniltert roniltetr roniltter ronilttre
roniltrte roniltret ronilttre roniltter roniltetr roniltert ronielrtt ronielrtt ronieltrt ronielttr ronielttr
ronieltrt ronierltt ronierltt roniertlt ronierttl ronierttl roniertlt ronietrlt ronietrtl ronietlrt ronietltr
roniettlr roniettrl ronietrtl ronietrlt roniettrl roniettlr ronietltr ronietlrt ronireltt ronireltt roniretlt
ronirettl ronirettl roniretlt ronirlett ronirlett ronirltet ronirltte ronirltte ronirltet ronirtlet ronirtlte
ronirtelt ronirtetl ronirttel ronirttle ronirtlte ronirtlet ronirttle ronirttel ronirtetl ronirtelt roniterlt
ronitertl ronitelrt roniteltr ronitetlr ronitetrl ronitrelt ronitretl ronitrlet ronitrlte ronitrtle ronitrtel
ronitlret ronitlrte ronitlert ronitletr ronitlter ronitltre ronittrle ronittrel ronittlre ronittler ronittelr
ronitterl ronitertl roniterlt ronitetrl ronitetlr roniteltr ronitelrt ronitretl ronitrelt ronitrtel ronitrtle
ronitrlte ronitrlet ronittrel ronittrle ronitterl ronittelr ronittler ronittlre ronitlrte ronitlret ronitltre
ronitlter ronitletr ronitlert rontlerit rontlerti rontleirt rontleitr rontletir rontletri rontlreit rontlreti
rontlriet rontlrite rontlrtie rontlrtei rontliret rontlirte rontliert rontlietr rontliter rontlitre rontltrie
rontltrei rontltire rontltier rontlteir rontlteri rontelrit rontelrti rontelirt rontelitr ronteltir ronteltri
ronterlit ronterlti ronterilt ronteritl rontertil rontertli ronteirlt ronteirtl ronteilrt ronteiltr ronteitlr
ronteitrl rontetril rontetrli rontetirl rontetilr rontetlir rontetlri rontrelit rontrelti rontreilt rontreitl
rontretil rontretli rontrleit rontrleti rontrliet rontrlite rontrltie rontrltei rontrilet rontrilte rontrielt
rontrietl rontritel rontritle rontrtlie rontrtlei rontrtile rontrtiel rontrteil rontrteli rontierlt rontiertl
rontielrt rontieltr rontietlr rontietrl rontirelt rontiretl rontirlet rontirlte rontirtle rontirtel rontilret
rontilrte rontilert rontiletr rontilter rontiltre rontitrle rontitrel rontitlre rontitler rontitelr rontiterl
rontteril rontterli rontteirl rontteilr ronttelir ronttelri ronttreil ronttreli ronttriel ronttrile ronttrlie
ronttrlei ronttirel ronttirle ronttierl ronttielr ronttiler ronttilre ronttlrie ronttlrei ronttlire ronttlier
ronttleir ronttleri

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us