easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

brasseaux

islandish

hydrosulphocyanic

paralogician

curtsying

invertin

hagged

legavissimusque

berretty

standley

levasy

macschmidt

farcie

scytodepsic

chlamydia

congrue

cheylard

liberace


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: rolesville
cipher variations:
spmftwjmmf tqnguxknng urohvylooh vspiwzmppi wtqjxanqqj
xurkyborrk yvslzcpssl zwtmadqttm axunberuun byvocfsvvo
czwpdgtwwp daxqehuxxq ebyrfivyyr fczsgjwzzs gdathkxaat
hebuilybbu ifcvjmzccv jgdwknaddw khexlobeex lifympcffy
mjgznqdggz nkhaorehha olibpsfiib pmjcqtgjjc qnkdruhkkd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: rolesville
Cipher: ilovheroov

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: rolesville
Cipher: BAAAA ABBAB ABABA AABAA BAAAB BBBAB ABAAA ABABA ABABA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: rolesville
cipher variations:
spmftwjmmfarindmziinitevncpeevqvadxsfaadyxwlhivwwlgzstrylsstwdkjlerkkjefgrvuhggr
mhczfkxcczujyhpanyyhclupzqduupknqxjgtqqxtqnguxknngbsjoenajjojufwodqffwrwbeytgbbe
zyxmijwxxmhatuszmttuxelkmfsllkfghswvihhsnidaglyddavkziqbozzidmvqarevvqlorykhurry
urohvyloohctkpfobkkpkvgxperggxsxcfzuhccfazynjkxyynibuvtanuuvyfmlngtmmlghitxwjiit
ojebhmzeebwlajrcpaajenwrbsfwwrmpszlivsszvspiwzmppidulqgpcllqlwhyqfshhytydgaviddg
bazoklyzzojcvwubovvwzgnmohunnmhijuyxkjjupkfcinaffcxmbksdqbbkfoxsctgxxsnqtamjwtta
wtqjxanqqjevmrhqdmmrmxizrgtiizuzehbwjeehcbaplmzaapkdwxvcpwwxahonpivoonijkvzylkkv
qlgdjobggdyncltercclgpytduhyytorubnkxuubxurkyborrkfwnsirennsnyjashujjavaficxkffi
dcbqmnabbqlexywdqxxybipoqjwppojklwazmllwrmhekpchhezodmufsddmhqzuevizzupsvcolyvvc
yvslzcpsslgxotjsfootozkbtivkkbwbgjdylggjedcrnobccrmfyzxeryyzcjqprkxqqpklmxbanmmx
sniflqdiifapenvgteeniravfwjaavqtwdpmzwwdzwtmadqttmhypuktgppupalcujwllcxchkezmhhk
fedsopcddsngzayfszzadkrqslyrrqlmnycbonnytojgmrejjgbqfowhuffojsbwgxkbbwruxeqnaxxe
axunberuunizqvluhqqvqbmdvkxmmdydilfaniilgfetpqdeetohabzgtaabelsrtmzssrmnozdcpooz
upkhnsfkkhcrgpxivggpktcxhylccxsvyfrobyyfbyvocfsvvojarwmvirrwrcnewlynnezejmgbojjm
hgfuqreffupibcahubbcfmtsunattsnopaedqppavqliotgllidshqyjwhhqludyizmddytwzgspczzg
czwpdgtwwpkbsxnwjssxsdofxmzoofafknhcpkknihgvrsfggvqjcdbivccdgnutvobuutopqbferqqb
wrmjpuhmmjetirzkxiirmvezjaneezuxahtqdaahdaxqehuxxqlctyoxkttytepgynappgbgloidqllo
jihwstghhwrkdecjwddehovuwpcvvupqrcgfsrrcxsnkqvinnkfujsalyjjsnwfakboffavybiurebbi
ebyrfivyyrmduzpyluuzufqhzobqqhchmpjermmpkjixtuhiixslefdkxeefipwvxqdwwvqrsdhgtssd
ytolrwjoolgvktbmzkktoxgblcpggbwzcjvsfccjfczsgjwzzsnevaqzmvvavgriapcrridinqkfsnnq
lkjyuvijjytmfgelyffgjqxwyrexxwrsteihuttezupmsxkppmhwlucnallupyhcmdqhhcxadkwtgddk
gdathkxaatofwbranwwbwhsjbqdssjejorlgtoormlkzvwjkkzunghfmzgghkryxzsfyyxstufjivuuf
avqntylqqnixmvdobmmvqzidneriidybelxuheelhebuilybbupgxcsboxxcxitkcrettkfkpsmhupps
nmlawxkllavohignahhilszyatgzzytuvgkjwvvgbwrouzmrrojynwepcnnwrajeofsjjezcfmyviffm
ifcvjmzccvqhydtcpyydyjuldsfuulglqtnivqqtonmbxylmmbwpijhobiijmtazbuhaazuvwhlkxwwh
cxspvansspkzoxfqdooxsbkfpgtkkfadgnzwjggnjgdwknaddwrizeudqzzezkvmetgvvmhmruojwrru
poncyzmnncxqjkipcjjknubacvibbavwximlyxxidytqwbottqlapygreppytclgqhullgbehoaxkhho
khexlobeexsjafveraafalwnfuhwwninsvpkxssvqpodzanoodyrkljqdkklovcbdwjccbwxyjnmzyyj
ezurxcpuurmbqzhsfqqzudmhrivmmhcfipbyliiplifympcffytkbgwfsbbgbmxogvixxojotwqlyttw
rqpeaboppezslmkrellmpwdcexkddcxyzkonazzkfavsydqvvsncraitgrravenisjwnnidgjqczmjjq
mjgznqdggzulchxgtcchcnyphwjyypkpuxrmzuuxsrqfbcpqqfatmnlsfmmnqxedfyleedyzalpobaal
gbwtzerwwtodsbjuhssbwfojtkxoojehkrdankkrnkhaorehhavmdiyhuddidozqixkzzqlqvysnavvy
tsrgcdqrrgbunomtgnnoryfegzmffezabmqpcbbmhcxuafsxxupetckvittcxgpkulyppkfilsebolls
olibpsfiibwnejziveejeparjylaarmrwztobwwzutshdersshcvopnuhoopszgfhanggfabcnrqdccn
idyvbgtyyvqfudlwjuudyhqlvmzqqlgjmtfcpmmtpmjcqtgjjcxofkajwffkfqbskzmbbsnsxaupcxxa
vutiefsttidwpqovippqtahgibohhgbcdosreddojezwchuzzwrgvemxkvvezirmwnarrmhknugdqnnu
qnkdruhkkdypglbkxgglgrctlancctotybvqdyybwvujfgtuujexqrpwjqqrubihjcpiihcdeptsfeep
kfaxdivaaxshwfnylwwfajsnxobssnilovheroovrolesvillezqhmclyhhmhsdumboddupuzcwrezzc
xwvkghuvvkfyrsqxkrrsvcjikdqjjidefqutgffqlgbyejwbbytixgozmxxgbktoypcttojmpwifsppw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: rolesville
Cipher: ebyrfivyyr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: rolesville
Cipher: 24431351341542131351

Extended Methods:
Method #1

Plaintext: rolesville
method variations:
wtqkxaoqqkbyvpcftvvpgdauhlyaaumifznqdffz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r o l e s v i l l e 
2 4 1 5 3 1 4 1 1 5 
4 3 3 1 4 5 2 3 3 1 
They are then read out in rows:
24153141154331452331
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: rolesville
Cipher: rvcdvocymc

Read more ...
Method #3

Plaintext: rolesville
method variations:
tcxldubcxf cxldubcxft xldubcxftc
ldubcxftcx dubcxftcxl ubcxftcxld
bcxftcxldu cxftcxldub xftcxldubc
ftcxldubcx

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: rolesville

first 5040 cipher variations(3628800 total)
rolesville rolesvilel rolesville rolesvilel rolesviell rolesviell rolesvlile rolesvliel rolesvllie rolesvllei rolesvleli
rolesvleil rolesvllie rolesvllei rolesvlile rolesvliel rolesvleil rolesvleli rolesvelli rolesvelil rolesvelli rolesvelil
rolesveill rolesveill rolesivlle rolesivlel rolesivlle rolesivlel rolesivell rolesivell rolesilvle rolesilvel rolesillve
rolesillev rolesilelv rolesilevl rolesillve rolesillev rolesilvle rolesilvel rolesilevl rolesilelv rolesiellv rolesielvl
rolesiellv rolesielvl rolesievll rolesievll roleslivle roleslivel roleslilve roleslilev roleslielv roleslievl roleslvile
roleslviel roleslvlie roleslvlei roleslveli roleslveil rolesllvie rolesllvei rolesllive roleslliev roleslleiv rolesllevi
roleslevli roleslevil roleslelvi rolesleliv rolesleilv rolesleivl roleslilve roleslilev roleslivle roleslivel roleslievl
roleslielv rolesllive roleslliev rolesllvie rolesllvei rolesllevi roleslleiv roleslvlie roleslvlei roleslvile roleslviel
roleslveil roleslveli roleslelvi rolesleliv roleslevli roleslevil rolesleivl rolesleilv roleseillv roleseilvl roleseillv
roleseilvl roleseivll roleseivll roleselilv roleselivl roleselliv rolesellvi roleselvli roleselvil roleselliv rolesellvi
roleselilv roleselivl roleselvil roleselvli rolesevlli rolesevlil rolesevlli rolesevlil rolesevill rolesevill rolevsille
rolevsilel rolevsille rolevsilel rolevsiell rolevsiell rolevslile rolevsliel rolevsllie rolevsllei rolevsleli rolevsleil
rolevsllie rolevsllei rolevslile rolevsliel rolevsleil rolevsleli rolevselli rolevselil rolevselli rolevselil rolevseill
rolevseill rolevislle rolevislel rolevislle rolevislel rolevisell rolevisell rolevilsle rolevilsel rolevillse rolevilles
rolevilels rolevilesl rolevillse rolevilles rolevilsle rolevilsel rolevilesl rolevilels roleviells rolevielsl roleviells
rolevielsl roleviesll roleviesll rolevlisle rolevlisel rolevlilse rolevliles rolevliels rolevliesl rolevlsile rolevlsiel
rolevlslie rolevlslei rolevlseli rolevlseil rolevllsie rolevllsei rolevllise rolevllies rolevlleis rolevllesi rolevlesli
rolevlesil rolevlelsi rolevlelis rolevleils rolevleisl rolevlilse rolevliles rolevlisle rolevlisel rolevliesl rolevliels
rolevllise rolevllies rolevllsie rolevllsei rolevllesi rolevlleis rolevlslie rolevlslei rolevlsile rolevlsiel rolevlseil
rolevlseli rolevlelsi rolevlelis rolevlesli rolevlesil rolevleisl rolevleils roleveills roleveilsl roleveills roleveilsl
roleveisll roleveisll rolevelils rolevelisl rolevellis rolevellsi rolevelsli rolevelsil rolevellis rolevellsi rolevelils
rolevelisl rolevelsil rolevelsli roleveslli roleveslil roleveslli roleveslil rolevesill rolevesill roleivslle roleivslel
roleivslle roleivslel roleivsell roleivsell roleivlsle roleivlsel roleivllse roleivlles roleivlels roleivlesl roleivllse
roleivlles roleivlsle roleivlsel roleivlesl roleivlels roleivells roleivelsl roleivells roleivelsl roleivesll roleivesll
roleisvlle roleisvlel roleisvlle roleisvlel roleisvell roleisvell roleislvle roleislvel roleisllve roleisllev roleislelv
roleislevl roleisllve roleisllev roleislvle roleislvel roleislevl roleislelv roleisellv roleiselvl roleisellv roleiselvl
roleisevll roleisevll roleilsvle roleilsvel roleilslve roleilslev roleilselv roleilsevl roleilvsle roleilvsel roleilvlse
roleilvles roleilvels roleilvesl roleillvse roleillves roleillsve roleillsev roleillesv roleillevs roleilevls roleilevsl
roleilelvs roleilelsv roleileslv roleilesvl roleilslve roleilslev roleilsvle roleilsvel roleilsevl roleilselv roleillsve
roleillsev roleillvse roleillves roleillevs roleillesv roleilvlse roleilvles roleilvsle roleilvsel roleilvesl roleilvels
roleilelvs roleilelsv roleilevls roleilevsl roleilesvl roleileslv roleiesllv roleieslvl roleiesllv roleieslvl roleiesvll
roleiesvll roleielslv roleielsvl roleiellsv roleiellvs roleielvls roleielvsl roleiellsv roleiellvs roleielslv roleielsvl
roleielvsl roleielvls roleievlls roleievlsl roleievlls roleievlsl roleievsll roleievsll rolelvisle rolelvisel rolelvilse
rolelviles rolelviels rolelviesl rolelvsile rolelvsiel rolelvslie rolelvslei rolelvseli rolelvseil rolelvlsie rolelvlsei
rolelvlise rolelvlies rolelvleis rolelvlesi rolelvesli rolelvesil rolelvelsi rolelvelis rolelveils rolelveisl rolelivsle
rolelivsel rolelivlse rolelivles rolelivels rolelivesl rolelisvle rolelisvel rolelislve rolelislev roleliselv rolelisevl
rolelilsve rolelilsev rolelilvse rolelilves rolelilevs rolelilesv rolelieslv roleliesvl rolelielsv rolelielvs rolelievls
rolelievsl rolelsivle rolelsivel rolelsilve rolelsilev rolelsielv rolelsievl rolelsvile rolelsviel rolelsvlie rolelsvlei
rolelsveli rolelsveil rolelslvie rolelslvei rolelslive rolelsliev rolelsleiv rolelslevi rolelsevli rolelsevil rolelselvi
rolelseliv rolelseilv rolelseivl rolellisve rolellisev rolellivse rolellives rolellievs rolelliesv rolellsive rolellsiev
rolellsvie rolellsvei rolellsevi rolellseiv rolellvsie rolellvsei rolellvise rolellvies rolellveis rolellvesi rolellesvi
rolellesiv rolellevsi rolellevis rolelleivs rolelleisv roleleislv roleleisvl roleleilsv roleleilvs roleleivls roleleivsl
rolelesilv rolelesivl rolelesliv roleleslvi rolelesvli rolelesvil rolelelsiv rolelelsvi rolelelisv rolelelivs rolelelvis
rolelelvsi rolelevsli rolelevsil rolelevlsi rolelevlis rolelevils rolelevisl rolelvilse rolelviles rolelvisle rolelvisel
rolelviesl rolelviels rolelvlise rolelvlies rolelvlsie rolelvlsei rolelvlesi rolelvleis rolelvslie rolelvslei rolelvsile
rolelvsiel rolelvseil rolelvseli rolelvelsi rolelvelis rolelvesli rolelvesil rolelveisl rolelveils rolelivlse rolelivles
rolelivsle rolelivsel rolelivesl rolelivels rolelilvse rolelilves rolelilsve rolelilsev rolelilesv rolelilevs rolelislve
rolelislev rolelisvle rolelisvel rolelisevl roleliselv rolelielsv rolelielvs rolelieslv roleliesvl rolelievsl rolelievls
rolellivse rolellives rolellisve rolellisev rolelliesv rolellievs rolellvise rolellvies rolellvsie rolellvsei rolellvesi
rolellveis rolellsvie rolellsvei rolellsive rolellsiev rolellseiv rolellsevi rolellevsi rolellevis rolellesvi rolellesiv
rolelleisv rolelleivs rolelsilve rolelsilev rolelsivle rolelsivel rolelsievl rolelsielv rolelslive rolelsliev rolelslvie
rolelslvei rolelslevi rolelsleiv rolelsvlie rolelsvlei rolelsvile rolelsviel rolelsveil rolelsveli rolelselvi rolelseliv
rolelsevli rolelsevil rolelseivl rolelseilv roleleilsv roleleilvs roleleislv roleleisvl roleleivsl roleleivls rolelelisv
rolelelivs rolelelsiv rolelelsvi rolelelvsi rolelelvis rolelesliv roleleslvi rolelesilv rolelesivl rolelesvil rolelesvli
rolelevlsi rolelevlis rolelevsli rolelevsil rolelevisl rolelevils roleevills roleevilsl roleevills roleevilsl roleevisll
roleevisll roleevlils roleevlisl roleevllis roleevllsi roleevlsli roleevlsil roleevllis roleevllsi roleevlils roleevlisl
roleevlsil roleevlsli roleevslli roleevslil roleevslli roleevslil roleevsill roleevsill roleeivlls roleeivlsl roleeivlls
roleeivlsl roleeivsll roleeivsll roleeilvls roleeilvsl roleeillvs roleeillsv roleeilslv roleeilsvl roleeillvs roleeillsv
roleeilvls roleeilvsl roleeilsvl roleeilslv roleeisllv roleeislvl roleeisllv roleeislvl roleeisvll roleeisvll roleelivls
roleelivsl roleelilvs roleelilsv roleelislv roleelisvl roleelvils roleelvisl roleelvlis roleelvlsi roleelvsli roleelvsil
roleellvis roleellvsi roleellivs roleellisv roleellsiv roleellsvi roleelsvli roleelsvil roleelslvi roleelsliv roleelsilv
roleelsivl roleelilvs roleelilsv roleelivls roleelivsl roleelisvl roleelislv roleellivs roleellisv roleellvis roleellvsi
roleellsvi roleellsiv roleelvlis roleelvlsi roleelvils roleelvisl roleelvsil roleelvsli roleelslvi roleelsliv roleelsvli
roleelsvil roleelsivl roleelsilv roleesillv roleesilvl roleesillv roleesilvl roleesivll roleesivll roleeslilv roleeslivl
roleeslliv roleesllvi roleeslvli roleeslvil roleeslliv roleesllvi roleeslilv roleeslivl roleeslvil roleeslvli roleesvlli
roleesvlil roleesvlli roleesvlil roleesvill roleesvill rolseville rolsevilel rolseville rolsevilel rolseviell rolseviell
rolsevlile rolsevliel rolsevllie rolsevllei rolsevleli rolsevleil rolsevllie rolsevllei rolsevlile rolsevliel rolsevleil
rolsevleli rolsevelli rolsevelil rolsevelli rolsevelil rolseveill rolseveill rolseivlle rolseivlel rolseivlle rolseivlel
rolseivell rolseivell rolseilvle rolseilvel rolseillve rolseillev rolseilelv rolseilevl rolseillve rolseillev rolseilvle
rolseilvel rolseilevl rolseilelv rolseiellv rolseielvl rolseiellv rolseielvl rolseievll rolseievll rolselivle rolselivel
rolselilve rolselilev rolselielv rolselievl rolselvile rolselviel rolselvlie rolselvlei rolselveli rolselveil rolsellvie
rolsellvei rolsellive rolselliev rolselleiv rolsellevi rolselevli rolselevil rolselelvi rolseleliv rolseleilv rolseleivl
rolselilve rolselilev rolselivle rolselivel rolselievl rolselielv rolsellive rolselliev rolsellvie rolsellvei rolsellevi
rolselleiv rolselvlie rolselvlei rolselvile rolselviel rolselveil rolselveli rolselelvi rolseleliv rolselevli rolselevil
rolseleivl rolseleilv rolseeillv rolseeilvl rolseeillv rolseeilvl rolseeivll rolseeivll rolseelilv rolseelivl rolseelliv
rolseellvi rolseelvli rolseelvil rolseelliv rolseellvi rolseelilv rolseelivl rolseelvil rolseelvli rolseevlli rolseevlil
rolseevlli rolseevlil rolseevill rolseevill rolsveille rolsveilel rolsveille rolsveilel rolsveiell rolsveiell rolsvelile
rolsveliel rolsvellie rolsvellei rolsveleli rolsveleil rolsvellie rolsvellei rolsvelile rolsveliel rolsveleil rolsveleli
rolsveelli rolsveelil rolsveelli rolsveelil rolsveeill rolsveeill rolsvielle rolsvielel rolsvielle rolsvielel rolsvieell
rolsvieell rolsvilele rolsvileel rolsvillee rolsvillee rolsvilele rolsvileel rolsvillee rolsvillee rolsvilele rolsvileel
rolsvileel rolsvilele rolsvielle rolsvielel rolsvielle rolsvielel rolsvieell rolsvieell rolsvliele rolsvlieel rolsvlilee
rolsvlilee rolsvliele rolsvlieel rolsvleile rolsvleiel rolsvlelie rolsvlelei rolsvleeli rolsvleeil rolsvlleie rolsvlleei
rolsvlliee rolsvlliee rolsvlleie rolsvlleei rolsvleeli rolsvleeil rolsvlelei rolsvlelie rolsvleile rolsvleiel rolsvlilee
rolsvlilee rolsvliele rolsvlieel rolsvlieel rolsvliele rolsvlliee rolsvlliee rolsvlleie rolsvlleei rolsvlleei rolsvlleie
rolsvlelie rolsvlelei rolsvleile rolsvleiel rolsvleeil rolsvleeli rolsvlelei rolsvlelie rolsvleeli rolsvleeil rolsvleiel
rolsvleile rolsveille rolsveilel rolsveille rolsveilel rolsveiell rolsveiell rolsvelile rolsveliel rolsvellie rolsvellei
rolsveleli rolsveleil rolsvellie rolsvellei rolsvelile rolsveliel rolsveleil rolsveleli rolsveelli rolsveelil rolsveelli
rolsveelil rolsveeill rolsveeill rolsivelle rolsivelel rolsivelle rolsivelel rolsiveell rolsiveell rolsivlele rolsivleel
rolsivllee rolsivllee rolsivlele rolsivleel rolsivllee rolsivllee rolsivlele rolsivleel rolsivleel rolsivlele rolsivelle
rolsivelel rolsivelle rolsivelel rolsiveell rolsiveell rolsievlle rolsievlel rolsievlle rolsievlel rolsievell rolsievell
rolsielvle rolsielvel rolsiellve rolsiellev rolsielelv rolsielevl rolsiellve rolsiellev rolsielvle rolsielvel rolsielevl
rolsielelv rolsieellv rolsieelvl rolsieellv rolsieelvl rolsieevll rolsieevll rolsilevle rolsilevel rolsilelve rolsilelev
rolsileelv rolsileevl rolsilvele rolsilveel rolsilvlee rolsilvlee rolsilvele rolsilveel rolsillvee rolsillvee rolsilleve
rolsilleev rolsilleev rolsilleve rolsilevle rolsilevel rolsilelve rolsilelev rolsileelv rolsileevl rolsilelve rolsilelev
rolsilevle rolsilevel rolsileevl rolsileelv rolsilleve rolsilleev rolsillvee rolsillvee rolsilleve rolsilleev rolsilvlee
rolsilvlee rolsilvele rolsilveel rolsilveel rolsilvele rolsilelve rolsilelev rolsilevle rolsilevel rolsileevl rolsileelv
rolsieellv rolsieelvl rolsieellv rolsieelvl rolsieevll rolsieevll rolsielelv rolsielevl rolsiellev rolsiellve rolsielvle
rolsielvel rolsiellev rolsiellve rolsielelv rolsielevl rolsielvel rolsielvle rolsievlle rolsievlel rolsievlle rolsievlel
rolsievell rolsievell rolslviele rolslvieel rolslvilee rolslvilee rolslviele rolslvieel rolslveile rolslveiel rolslvelie
rolslvelei rolslveeli rolslveeil rolslvleie rolslvleei rolslvliee rolslvliee rolslvleie rolslvleei rolslveeli rolslveeil
rolslvelei rolslvelie rolslveile rolslveiel rolslivele rolsliveel rolslivlee rolslivlee rolslivele rolsliveel rolslievle
rolslievel rolslielve rolslielev rolslieelv rolslieevl rolslileve rolslileev rolslilvee rolslilvee rolslileve rolslileev
rolslieelv rolslieevl rolslielev rolslielve rolslievle rolslievel rolsleivle rolsleivel rolsleilve rolsleilev rolsleielv
rolsleievl rolslevile rolsleviel rolslevlie rolslevlei rolsleveli rolsleveil rolslelvie rolslelvei rolslelive rolsleliev
rolsleleiv rolslelevi rolsleevli rolsleevil rolsleelvi rolsleeliv rolsleeilv rolsleeivl rolsllieve rolsllieev rolsllivee
rolsllivee rolsllieve rolsllieev rolslleive rolslleiev rolsllevie rolsllevei rolslleevi rolslleeiv rolsllveie rolsllveei
rolsllviee rolsllviee rolsllveie rolsllveei rolslleevi rolslleeiv rolsllevei rolsllevie rolslleive rolslleiev rolsleielv
rolsleievl rolsleilev rolsleilve rolsleivle rolsleivel rolsleeilv rolsleeivl rolsleeliv rolsleelvi rolsleevli rolsleevil
rolsleleiv rolslelevi rolsleliev rolslelive rolslelvie rolslelvei rolsleveli rolsleveil rolslevlei rolslevlie rolslevile
rolsleviel rolslvilee rolslvilee rolslviele rolslvieel rolslvieel rolslviele rolslvliee rolslvliee rolslvleie rolslvleei
rolslvleei rolslvleie rolslvelie rolslvelei rolslveile rolslveiel rolslveeil rolslveeli rolslvelei rolslvelie rolslveeli
rolslveeil rolslveiel rolslveile rolslivlee rolslivlee rolslivele rolsliveel rolsliveel rolslivele rolslilvee rolslilvee
rolslileve rolslileev rolslileev rolslileve rolslielve rolslielev rolslievle rolslievel rolslieevl rolslieelv rolslielev
rolslielve rolslieelv rolslieevl rolslievel rolslievle rolsllivee rolsllivee rolsllieve rolsllieev rolsllieev rolsllieve
rolsllviee rolsllviee rolsllveie rolsllveei rolsllveei rolsllveie rolsllevie rolsllevei rolslleive rolslleiev rolslleeiv
rolslleevi rolsllevei rolsllevie rolslleevi rolslleeiv rolslleiev rolslleive rolsleilve rolsleilev rolsleivle rolsleivel
rolsleievl rolsleielv rolslelive rolsleliev rolslelvie rolslelvei rolslelevi rolsleleiv rolslevlie rolslevlei rolslevile
rolsleviel rolsleveil rolsleveli rolsleelvi rolsleeliv rolsleevli rolsleevil rolsleeivl rolsleeilv rolsleilev rolsleilve
rolsleielv rolsleievl rolsleivel rolsleivle rolsleliev rolslelive rolsleleiv rolslelevi rolslelvei rolslelvie rolsleeliv
rolsleelvi rolsleeilv rolsleeivl rolsleevil rolsleevli rolslevlei rolslevlie rolsleveli rolsleveil rolsleviel rolslevile
rolseville rolsevilel rolseville rolsevilel rolseviell rolseviell rolsevlile rolsevliel rolsevllie rolsevllei rolsevleli
rolsevleil rolsevllie rolsevllei rolsevlile rolsevliel rolsevleil rolsevleli rolsevelli rolsevelil rolsevelli rolsevelil
rolseveill rolseveill rolseivlle rolseivlel rolseivlle rolseivlel rolseivell rolseivell rolseilvle rolseilvel rolseillve
rolseillev rolseilelv rolseilevl rolseillve rolseillev rolseilvle rolseilvel rolseilevl rolseilelv rolseiellv rolseielvl
rolseiellv rolseielvl rolseievll rolseievll rolselivle rolselivel rolselilve rolselilev rolselielv rolselievl rolselvile
rolselviel rolselvlie rolselvlei rolselveli rolselveil rolsellvie rolsellvei rolsellive rolselliev rolselleiv rolsellevi
rolselevli rolselevil rolselelvi rolseleliv rolseleilv rolseleivl rolselilve rolselilev rolselivle rolselivel rolselievl
rolselielv rolsellive rolselliev rolsellvie rolsellvei rolsellevi rolselleiv rolselvlie rolselvlei rolselvile rolselviel
rolselveil rolselveli rolselelvi rolseleliv rolselevli rolselevil rolseleivl rolseleilv rolseeillv rolseeilvl rolseeillv
rolseeilvl rolseeivll rolseeivll rolseelilv rolseelivl rolseelliv rolseellvi rolseelvli rolseelvil rolseelliv rolseellvi
rolseelilv rolseelivl rolseelvil rolseelvli rolseevlli rolseevlil rolseevlli rolseevlil rolseevill rolseevill rolvseille
rolvseilel rolvseille rolvseilel rolvseiell rolvseiell rolvselile rolvseliel rolvsellie rolvsellei rolvseleli rolvseleil
rolvsellie rolvsellei rolvselile rolvseliel rolvseleil rolvseleli rolvseelli rolvseelil rolvseelli rolvseelil rolvseeill
rolvseeill rolvsielle rolvsielel rolvsielle rolvsielel rolvsieell rolvsieell rolvsilele rolvsileel rolvsillee rolvsillee
rolvsilele rolvsileel rolvsillee rolvsillee rolvsilele rolvsileel rolvsileel rolvsilele rolvsielle rolvsielel rolvsielle
rolvsielel rolvsieell rolvsieell rolvsliele rolvslieel rolvslilee rolvslilee rolvsliele rolvslieel rolvsleile rolvsleiel
rolvslelie rolvslelei rolvsleeli rolvsleeil rolvslleie rolvslleei rolvslliee rolvslliee rolvslleie rolvslleei rolvsleeli
rolvsleeil rolvslelei rolvslelie rolvsleile rolvsleiel rolvslilee rolvslilee rolvsliele rolvslieel rolvslieel rolvsliele
rolvslliee rolvslliee rolvslleie rolvslleei rolvslleei rolvslleie rolvslelie rolvslelei rolvsleile rolvsleiel rolvsleeil
rolvsleeli rolvslelei rolvslelie rolvsleeli rolvsleeil rolvsleiel rolvsleile rolvseille rolvseilel rolvseille rolvseilel
rolvseiell rolvseiell rolvselile rolvseliel rolvsellie rolvsellei rolvseleli rolvseleil rolvsellie rolvsellei rolvselile
rolvseliel rolvseleil rolvseleli rolvseelli rolvseelil rolvseelli rolvseelil rolvseeill rolvseeill rolvesille rolvesilel
rolvesille rolvesilel rolvesiell rolvesiell rolveslile rolvesliel rolvesllie rolvesllei rolvesleli rolvesleil rolvesllie
rolvesllei rolveslile rolvesliel rolvesleil rolvesleli rolveselli rolveselil rolveselli rolveselil rolveseill rolveseill
rolveislle rolveislel rolveislle rolveislel rolveisell rolveisell rolveilsle rolveilsel rolveillse rolveilles rolveilels
rolveilesl rolveillse rolveilles rolveilsle rolveilsel rolveilesl rolveilels rolveiells rolveielsl rolveiells rolveielsl
rolveiesll rolveiesll rolvelisle rolvelisel rolvelilse rolveliles rolveliels rolveliesl rolvelsile rolvelsiel rolvelslie
rolvelslei rolvelseli rolvelseil rolvellsie rolvellsei rolvellise rolvellies rolvelleis rolvellesi rolvelesli rolvelesil
rolvelelsi rolvelelis rolveleils rolveleisl rolvelilse rolveliles rolvelisle rolvelisel rolveliesl rolveliels rolvellise
rolvellies rolvellsie rolvellsei rolvellesi rolvelleis rolvelslie rolvelslei rolvelsile rolvelsiel rolvelseil rolvelseli
rolvelelsi rolvelelis rolvelesli rolvelesil rolveleisl rolveleils rolveeills rolveeilsl rolveeills rolveeilsl rolveeisll
rolveeisll rolveelils rolveelisl rolveellis rolveellsi rolveelsli rolveelsil rolveellis rolveellsi rolveelils rolveelisl
rolveelsil rolveelsli rolveeslli rolveeslil rolveeslli rolveeslil rolveesill rolveesill rolvieslle rolvieslel rolvieslle
rolvieslel rolviesell rolviesell rolvielsle rolvielsel rolviellse rolvielles rolvielels rolvielesl rolviellse rolvielles
rolvielsle rolvielsel rolvielesl rolvielels rolvieells rolvieelsl rolvieells rolvieelsl rolvieesll rolvieesll rolviselle
rolviselel rolviselle rolviselel rolviseell rolviseell rolvislele rolvisleel rolvisllee rolvisllee rolvislele rolvisleel
rolvisllee rolvisllee rolvislele rolvisleel rolvisleel rolvislele rolviselle rolviselel rolviselle rolviselel rolviseell
rolviseell rolvilsele rolvilseel rolvilslee rolvilslee rolvilsele rolvilseel rolvilesle rolvilesel rolvilelse rolvileles
rolvileels rolvileesl rolvillese rolvillees rolvillsee rolvillsee rolvillese rolvillees rolvileels rolvileesl rolvileles
rolvilelse rolvilesle rolvilesel rolvilslee rolvilslee rolvilsele rolvilseel rolvilseel rolvilsele rolvillsee rolvillsee
rolvillese rolvillees rolvillees rolvillese rolvilelse rolvileles rolvilesle rolvilesel rolvileesl rolvileels rolvileles
rolvilelse rolvileels rolvileesl rolvilesel rolvilesle rolvieslle rolvieslel rolvieslle rolvieslel rolviesell rolviesell
rolvielsle rolvielsel rolviellse rolvielles rolvielels rolvielesl rolviellse rolvielles rolvielsle rolvielsel rolvielesl
rolvielels rolvieells rolvieelsl rolvieells rolvieelsl rolvieesll rolvieesll rolvleisle rolvleisel rolvleilse rolvleiles
rolvleiels rolvleiesl rolvlesile rolvlesiel rolvleslie rolvleslei rolvleseli rolvleseil rolvlelsie rolvlelsei rolvlelise
rolvlelies rolvleleis rolvlelesi rolvleesli rolvleesil rolvleelsi rolvleelis rolvleeils rolvleeisl rolvliesle rolvliesel
rolvlielse rolvlieles rolvlieels rolvlieesl rolvlisele rolvliseel rolvlislee rolvlislee rolvlisele rolvliseel rolvlilsee
rolvlilsee rolvlilese rolvlilees rolvlilees rolvlilese rolvliesle rolvliesel rolvlielse rolvlieles rolvlieels rolvlieesl
rolvlsiele rolvlsieel rolvlsilee rolvlsilee rolvlsiele rolvlsieel rolvlseile rolvlseiel rolvlselie rolvlselei rolvlseeli
rolvlseeil rolvlsleie rolvlsleei rolvlsliee rolvlsliee rolvlsleie rolvlsleei rolvlseeli rolvlseeil rolvlselei rolvlselie
rolvlseile rolvlseiel rolvllisee rolvllisee rolvlliese rolvlliees rolvlliees rolvlliese rolvllsiee rolvllsiee rolvllseie
rolvllseei rolvllseei rolvllseie rolvllesie rolvllesei rolvlleise rolvlleies rolvlleeis rolvlleesi rolvllesei rolvllesie
rolvlleesi rolvlleeis rolvlleies rolvlleise rolvleisle rolvleisel rolvleilse rolvleiles rolvleiels rolvleiesl rolvlesile
rolvlesiel rolvleslie rolvleslei rolvleseli rolvleseil rolvlelsie rolvlelsei rolvlelise rolvlelies rolvleleis rolvlelesi
rolvleesli rolvleesil rolvleelsi rolvleelis rolvleeils rolvleeisl rolvleilse rolvleiles rolvleisle rolvleisel rolvleiesl
rolvleiels rolvlelise rolvlelies rolvlelsie rolvlelsei rolvlelesi rolvleleis rolvleslie rolvleslei rolvlesile rolvlesiel
rolvleseil rolvleseli rolvleelsi rolvleelis rolvleesli rolvleesil rolvleeisl rolvleeils rolvlielse rolvlieles rolvliesle
rolvliesel rolvlieesl rolvlieels rolvlilese rolvlilees rolvlilsee rolvlilsee rolvlilese rolvlilees rolvlislee rolvlislee
rolvlisele rolvliseel rolvliseel rolvlisele rolvlielse rolvlieles rolvliesle rolvliesel rolvlieesl rolvlieels rolvlliese
rolvlliees rolvllisee rolvllisee rolvlliese rolvlliees rolvlleise rolvlleies rolvllesie rolvllesei rolvlleesi rolvlleeis
rolvllseie rolvllseei rolvllsiee rolvllsiee rolvllseie rolvllseei rolvlleesi rolvlleeis rolvllesei rolvllesie rolvlleise
rolvlleies rolvlsilee rolvlsilee rolvlsiele rolvlsieel rolvlsieel rolvlsiele rolvlsliee rolvlsliee rolvlsleie rolvlsleei
rolvlsleei rolvlsleie rolvlselie rolvlselei rolvlseile rolvlseiel rolvlseeil rolvlseeli rolvlselei rolvlselie rolvlseeli
rolvlseeil rolvlseiel rolvlseile rolvleilse rolvleiles rolvleisle rolvleisel rolvleiesl rolvleiels rolvlelise rolvlelies
rolvlelsie rolvlelsei rolvlelesi rolvleleis rolvleslie rolvleslei rolvlesile rolvlesiel rolvleseil rolvleseli rolvleelsi
rolvleelis rolvleesli rolvleesil rolvleeisl rolvleeils rolveeills rolveeilsl rolveeills rolveeilsl rolveeisll rolveeisll
rolveelils rolveelisl rolveellis rolveellsi rolveelsli rolveelsil rolveellis rolveellsi rolveelils rolveelisl rolveelsil
rolveelsli rolveeslli rolveeslil rolveeslli rolveeslil rolveesill rolveesill rolveiells rolveielsl rolveiells rolveielsl
rolveiesll rolveiesll rolveilels rolveilesl rolveilles rolveillse rolveilsle rolveilsel rolveilles rolveillse rolveilels
rolveilesl rolveilsel rolveilsle rolveislle rolveislel rolveislle rolveislel rolveisell rolveisell rolveliels rolveliesl
rolveliles rolvelilse rolvelisle rolvelisel rolveleils rolveleisl rolvelelis rolvelelsi rolvelesli rolvelesil rolvelleis
rolvellesi rolvellies rolvellise rolvellsie rolvellsei rolvelseli rolvelseil rolvelslei rolvelslie rolvelsile rolvelsiel
rolveliles rolvelilse rolveliels rolveliesl rolvelisel rolvelisle rolvellies rolvellise rolvelleis rolvellesi rolvellsei
rolvellsie rolvelelis rolvelelsi rolveleils rolveleisl rolvelesil rolvelesli rolvelslei rolvelslie rolvelseli rolvelseil
rolvelsiel rolvelsile rolvesille rolvesilel rolvesille rolvesilel rolvesiell rolvesiell rolveslile rolvesliel rolvesllie
rolvesllei rolvesleli rolvesleil rolvesllie rolvesllei rolveslile rolvesliel rolvesleil rolvesleli rolveselli rolveselil
rolveselli rolveselil rolveseill rolveseill rolisvelle rolisvelel rolisvelle rolisvelel rolisveell rolisveell rolisvlele
rolisvleel rolisvllee rolisvllee rolisvlele rolisvleel rolisvllee rolisvllee rolisvlele rolisvleel rolisvleel rolisvlele
rolisvelle rolisvelel rolisvelle rolisvelel rolisveell rolisveell rolisevlle rolisevlel rolisevlle rolisevlel rolisevell
rolisevell roliselvle roliselvel rolisellve rolisellev roliselelv roliselevl rolisellve rolisellev roliselvle roliselvel
roliselevl roliselelv roliseellv roliseelvl roliseellv roliseelvl roliseevll roliseevll rolislevle rolislevel rolislelve
rolislelev rolisleelv rolisleevl rolislvele rolislveel rolislvlee rolislvlee rolislvele rolislveel rolisllvee rolisllvee
rolislleve rolislleev rolislleev rolislleve rolislevle rolislevel rolislelve rolislelev rolisleelv rolisleevl rolislelve
rolislelev rolislevle rolislevel rolisleevl rolisleelv rolislleve rolislleev rolisllvee rolisllvee rolislleve rolislleev
rolislvlee rolislvlee rolislvele rolislveel rolislveel rolislvele rolislelve rolislelev rolislevle rolislevel rolisleevl
rolisleelv roliseellv roliseelvl roliseellv roliseelvl roliseevll roliseevll roliselelv roliselevl rolisellev rolisellve
roliselvle roliselvel rolisellev rolisellve roliselelv roliselevl roliselvel roliselvle rolisevlle rolisevlel rolisevlle
rolisevlel rolisevell rolisevell rolivselle rolivselel rolivselle rolivselel rolivseell rolivseell rolivslele rolivsleel
rolivsllee rolivsllee rolivslele rolivsleel rolivsllee rolivsllee rolivslele rolivsleel rolivsleel rolivslele rolivselle
rolivselel rolivselle rolivselel rolivseell rolivseell roliveslle roliveslel roliveslle roliveslel rolivesell rolivesell
rolivelsle rolivelsel rolivellse rolivelles rolivelels rolivelesl rolivellse rolivelles rolivelsle rolivelsel rolivelesl
rolivelels roliveells roliveelsl roliveells roliveelsl roliveesll roliveesll rolivlesle rolivlesel rolivlelse rolivleles
rolivleels rolivleesl rolivlsele rolivlseel rolivlslee rolivlslee rolivlsele rolivlseel rolivllsee rolivllsee rolivllese
rolivllees rolivllees rolivllese rolivlesle rolivlesel rolivlelse rolivleles rolivleels rolivleesl rolivlelse rolivleles
rolivlesle rolivlesel rolivleesl rolivleels rolivllese rolivllees rolivllsee rolivllsee rolivllese rolivllees rolivlslee
rolivlslee rolivlsele rolivlseel rolivlseel rolivlsele rolivlelse rolivleles rolivlesle rolivlesel rolivleesl rolivleels
roliveells roliveelsl roliveells roliveelsl roliveesll roliveesll rolivelels rolivelesl rolivelles rolivellse rolivelsle
rolivelsel rolivelles rolivellse rolivelels rolivelesl rolivelsel rolivelsle roliveslle roliveslel roliveslle roliveslel
rolivesell rolivesell rolievslle rolievslel rolievslle rolievslel rolievsell rolievsell rolievlsle rolievlsel rolievllse
rolievlles rolievlels rolievlesl rolievllse rolievlles rolievlsle rolievlsel rolievlesl rolievlels rolievells rolievelsl
rolievells rolievelsl rolievesll rolievesll roliesvlle roliesvlel roliesvlle roliesvlel roliesvell roliesvell rolieslvle
rolieslvel roliesllve roliesllev rolieslelv rolieslevl roliesllve roliesllev rolieslvle rolieslvel rolieslevl rolieslelv
roliesellv rolieselvl roliesellv rolieselvl roliesevll roliesevll rolielsvle rolielsvel rolielslve rolielslev rolielselv
rolielsevl rolielvsle rolielvsel rolielvlse rolielvles rolielvels rolielvesl roliellvse roliellves roliellsve roliellsev
roliellesv roliellevs rolielevls rolielevsl rolielelvs rolielelsv rolieleslv rolielesvl rolielslve rolielslev rolielsvle
rolielsvel rolielsevl rolielselv roliellsve roliellsev roliellvse roliellves roliellevs roliellesv rolielvlse rolielvles
rolielvsle rolielvsel rolielvesl rolielvels rolielelvs rolielelsv rolielevls rolielevsl rolielesvl rolieleslv rolieesllv
rolieeslvl rolieesllv rolieeslvl rolieesvll rolieesvll rolieelslv rolieelsvl rolieellsv rolieellvs rolieelvls rolieelvsl
rolieellsv rolieellvs rolieelslv rolieelsvl rolieelvsl rolieelvls rolieevlls rolieevlsl rolieevlls rolieevlsl rolieevsll
rolieevsll rolilvesle rolilvesel rolilvelse rolilveles rolilveels rolilveesl rolilvsele rolilvseel rolilvslee rolilvslee
rolilvsele rolilvseel rolilvlsee rolilvlsee rolilvlese rolilvlees rolilvlees rolilvlese rolilvesle rolilvesel rolilvelse
rolilveles rolilveels rolilveesl rolilevsle rolilevsel rolilevlse rolilevles rolilevels rolilevesl rolilesvle rolilesvel
rolileslve rolileslev rolileselv rolilesevl rolilelsve rolilelsev rolilelvse rolilelves rolilelevs rolilelesv rolileeslv
rolileesvl rolileelsv rolileelvs rolileevls rolileevsl rolilsevle rolilsevel rolilselve rolilselev rolilseelv rolilseevl
rolilsvele rolilsveel rolilsvlee rolilsvlee rolilsvele rolilsveel rolilslvee rolilslvee rolilsleve rolilsleev rolilsleev
rolilsleve rolilsevle rolilsevel rolilselve rolilselev rolilseelv rolilseevl rolillesve rolillesev rolillevse rolilleves
rolilleevs rolilleesv rolillseve rolillseev rolillsvee rolillsvee rolillseve rolillseev rolillvsee rolillvsee rolillvese
rolillvees rolillvees rolillvese rolillesve rolillesev rolillevse rolilleves rolilleevs rolilleesv rolileeslv rolileesvl
rolileelsv rolileelvs rolileevls rolileevsl rolileselv rolilesevl rolileslev rolileslve rolilesvle rolilesvel rolilelsev
rolilelsve rolilelesv rolilelevs rolilelves rolilelvse rolilevsle rolilevsel rolilevlse rolilevles rolilevels rolilevesl
rolilvelse rolilveles rolilvesle rolilvesel rolilveesl rolilveels rolilvlese rolilvlees rolilvlsee rolilvlsee rolilvlese
rolilvlees rolilvslee rolilvslee rolilvsele rolilvseel rolilvseel rolilvsele rolilvelse rolilveles rolilvesle rolilvesel
rolilveesl rolilveels rolilevlse rolilevles rolilevsle rolilevsel rolilevesl rolilevels rolilelvse rolilelves rolilelsve
rolilelsev rolilelesv rolilelevs rolileslve rolileslev rolilesvle rolilesvel rolilesevl rolileselv rolileelsv rolileelvs
rolileeslv rolileesvl rolileevsl rolileevls rolillevse rolilleves rolillesve rolillesev rolilleesv rolilleevs rolillvese
rolillvees rolillvsee rolillvsee rolillvese rolillvees rolillsvee rolillsvee rolillseve rolillseev rolillseev rolillseve
rolillevse rolilleves rolillesve rolillesev rolilleesv rolilleevs rolilselve rolilselev rolilsevle rolilsevel rolilseevl
rolilseelv rolilsleve rolilsleev rolilslvee rolilslvee rolilsleve rolilsleev rolilsvlee rolilsvlee rolilsvele rolilsveel
rolilsveel rolilsvele rolilselve rolilselev rolilsevle rolilsevel rolilseevl rolilseelv rolileelsv rolileelvs rolileeslv
rolileesvl rolileevsl rolileevls rolilelesv rolilelevs rolilelsev rolilelsve rolilelvse rolilelves rolileslev rolileslve
rolileselv rolilesevl rolilesvel rolilesvle rolilevlse rolilevles rolilevsle rolilevsel rolilevesl rolilevels rolievells
rolievelsl rolievells rolievelsl rolievesll rolievesll rolievlels rolievlesl rolievlles rolievllse rolievlsle rolievlsel
rolievlles rolievllse rolievlels rolievlesl rolievlsel rolievlsle rolievslle rolievslel rolievslle rolievslel rolievsell
rolievsell rolieevlls rolieevlsl rolieevlls rolieevlsl rolieevsll rolieevsll rolieelvls rolieelvsl rolieellvs rolieellsv
rolieelslv rolieelsvl rolieellvs rolieellsv rolieelvls rolieelvsl rolieelsvl rolieelslv rolieesllv rolieeslvl rolieesllv
rolieeslvl rolieesvll rolieesvll rolielevls rolielevsl rolielelvs rolielelsv rolieleslv rolielesvl rolielvels rolielvesl
rolielvles rolielvlse rolielvsle rolielvsel roliellves roliellvse roliellevs roliellesv roliellsev roliellsve rolielsvle
rolielsvel rolielslve rolielslev rolielselv rolielsevl rolielelvs rolielelsv rolielevls rolielevsl rolielesvl rolieleslv
roliellevs roliellesv roliellves roliellvse roliellsve roliellsev rolielvles rolielvlse rolielvels rolielvesl rolielvsel
rolielvsle rolielslve rolielslev rolielsvle rolielsvel rolielsevl rolielselv roliesellv rolieselvl roliesellv rolieselvl
roliesevll roliesevll rolieslelv rolieslevl roliesllev roliesllve rolieslvle rolieslvel roliesllev roliesllve rolieslelv
rolieslevl rolieslvel rolieslvle roliesvlle roliesvlel roliesvlle roliesvlel roliesvell roliesvell rollsviele rollsvieel
rollsvilee rollsvilee rollsviele rollsvieel rollsveile rollsveiel rollsvelie rollsvelei rollsveeli rollsveeil rollsvleie
rollsvleei rollsvliee rollsvliee rollsvleie rollsvleei rollsveeli rollsveeil rollsvelei rollsvelie rollsveile rollsveiel
rollsivele rollsiveel rollsivlee rollsivlee rollsivele rollsiveel rollsievle rollsievel rollsielve rollsielev rollsieelv
rollsieevl rollsileve rollsileev rollsilvee rollsilvee rollsileve rollsileev rollsieelv rollsieevl rollsielev rollsielve
rollsievle rollsievel rollseivle rollseivel rollseilve rollseilev rollseielv rollseievl rollsevile rollseviel rollsevlie
rollsevlei rollseveli rollseveil rollselvie rollselvei rollselive rollseliev rollseleiv rollselevi rollseevli rollseevil
rollseelvi rollseeliv rollseeilv rollseeivl rollslieve rollslieev rollslivee rollslivee rollslieve rollslieev rollsleive
rollsleiev rollslevie rollslevei rollsleevi rollsleeiv rollslveie rollslveei rollslviee rollslviee rollslveie rollslveei
rollsleevi rollsleeiv rollslevei rollslevie rollsleive rollsleiev rollseielv rollseievl rollseilev rollseilve rollseivle
rollseivel rollseeilv rollseeivl rollseeliv rollseelvi rollseevli rollseevil rollseleiv rollselevi rollseliev rollselive
rollselvie rollselvei rollseveli rollseveil rollsevlei rollsevlie rollsevile rollseviel rollvsiele rollvsieel rollvsilee
rollvsilee rollvsiele rollvsieel rollvseile rollvseiel rollvselie rollvselei rollvseeli rollvseeil rollvsleie rollvsleei
rollvsliee rollvsliee rollvsleie rollvsleei rollvseeli rollvseeil rollvselei rollvselie rollvseile rollvseiel rollvisele
rollviseel rollvislee rollvislee rollvisele rollviseel rollviesle rollviesel rollvielse rollvieles rollvieels rollvieesl
rollvilese rollvilees rollvilsee rollvilsee rollvilese rollvilees rollvieels rollvieesl rollvieles rollvielse rollviesle
rollviesel rollveisle rollveisel rollveilse rollveiles rollveiels rollveiesl rollvesile rollvesiel rollveslie rollveslei
rollveseli rollveseil rollvelsie rollvelsei rollvelise rollvelies rollveleis rollvelesi rollveesli rollveesil rollveelsi
rollveelis rollveeils rollveeisl rollvliese rollvliees rollvlisee rollvlisee rollvliese rollvliees rollvleise rollvleies
rollvlesie rollvlesei rollvleesi rollvleeis rollvlseie rollvlseei rollvlsiee rollvlsiee rollvlseie rollvlseei rollvleesi
rollvleeis rollvlesei rollvlesie rollvleise rollvleies rollveiels rollveiesl rollveiles rollveilse rollveisle rollveisel
rollveeils rollveeisl rollveelis rollveelsi rollveesli rollveesil rollveleis rollvelesi rollvelies rollvelise rollvelsie
rollvelsei rollveseli rollveseil rollveslei rollveslie rollvesile rollvesiel rollivsele rollivseel rollivslee rollivslee
rollivsele rollivseel rollivesle rollivesel rollivelse rolliveles rolliveels rolliveesl rollivlese rollivlees rollivlsee
rollivlsee rollivlese rollivlees rolliveels rolliveesl rolliveles rollivelse rollivesle rollivesel rollisvele rollisveel
rollisvlee rollisvlee rollisvele rollisveel rollisevle rollisevel rolliselve rolliselev rolliseelv rolliseevl rollisleve
rollisleev rollislvee rollislvee rollisleve rollisleev rolliseelv rolliseevl rolliselev rolliselve rollisevle rollisevel
rolliesvle rolliesvel rollieslve rollieslev rollieselv rolliesevl rollievsle rollievsel rollievlse rollievles rollievels
rollievesl rollielvse rollielves rollielsve rollielsev rollielesv rollielevs rollieevls rollieevsl rollieelvs rollieelsv
rollieeslv rollieesvl rollilseve rollilseev rollilsvee rollilsvee rollilseve rollilseev rollilesve rollilesev rollilevse
rollileves rollileevs rollileesv rollilvese rollilvees rollilvsee rollilvsee rollilvese rollilvees rollileevs rollileesv
rollileves rollilevse rollilesve rollilesev rollieselv rolliesevl rollieslev rollieslve rolliesvle rolliesvel rollieeslv
rollieesvl rollieelsv rollieelvs rollieevls rollieevsl rollielesv rollielevs rollielsev rollielsve rollielvse rollielves
rollievels rollievesl rollievles rollievlse rollievsle rollievsel rollevisle rollevisel rollevilse rolleviles rolleviels
rolleviesl rollevsile rollevsiel rollevslie rollevslei rollevseli rollevseil rollevlsie rollevlsei rollevlise rollevlies
rollevleis rollevlesi rollevesli rollevesil rollevelsi rollevelis rolleveils rolleveisl rolleivsle rolleivsel rolleivlse
rolleivles rolleivels rolleivesl rolleisvle rolleisvel rolleislve rolleislev rolleiselv rolleisevl rolleilsve rolleilsev
rolleilvse rolleilves rolleilevs rolleilesv rolleieslv rolleiesvl rolleielsv rolleielvs rolleievls rolleievsl rollesivle
rollesivel rollesilve rollesilev rollesielv rollesievl rollesvile rollesviel rollesvlie rollesvlei rollesveli rollesveil
rolleslvie rolleslvei rolleslive rollesliev rollesleiv rolleslevi rollesevli rollesevil rolleselvi rolleseliv rolleseilv
rolleseivl rollelisve rollelisev rollelivse rollelives rollelievs rolleliesv rollelsive rollelsiev rollelsvie rollelsvei
rollelsevi rollelseiv rollelvsie rollelvsei rollelvise rollelvies rollelveis rollelvesi rollelesvi rollelesiv rollelevsi
rollelevis rolleleivs rolleleisv rolleeislv rolleeisvl rolleeilsv rolleeilvs rolleeivls rolleeivsl rolleesilv rolleesivl
rolleesliv rolleeslvi rolleesvli rolleesvil rolleelsiv rolleelsvi rolleelisv rolleelivs rolleelvis rolleelvsi rolleevsli
rolleevsil rolleevlsi rolleevlis rolleevils rolleevisl rolllviese rolllviees rolllvisee rolllvisee rolllviese rolllviees
rolllveise rolllveies rolllvesie rolllvesei rolllveesi rolllveeis rolllvseie rolllvseei rolllvsiee rolllvsiee rolllvseie
rolllvseei rolllveesi rolllveeis rolllvesei rolllvesie rolllveise rolllveies rolllivese rolllivees rolllivsee rolllivsee
rolllivese rolllivees rolllievse rolllieves rollliesve rollliesev rolllieesv rolllieevs rollliseve rollliseev rolllisvee
rolllisvee rollliseve rollliseev rolllieesv rolllieevs rollliesev rollliesve rolllievse rolllieves rollleivse rollleives
rollleisve rollleisev rollleiesv rollleievs rolllevise rolllevies rolllevsie rolllevsei rolllevesi rollleveis rolllesvie
rolllesvei rolllesive rolllesiev rollleseiv rolllesevi rollleevsi rollleevis rollleesvi rollleesiv rollleeisv rollleeivs
rolllsieve rolllsieev rolllsivee rolllsivee rolllsieve rolllsieev rolllseive rolllseiev rolllsevie rolllsevei rolllseevi
rolllseeiv rolllsveie rolllsveei rolllsviee rolllsviee rolllsveie rolllsveei rolllseevi rolllseeiv rolllsevei rolllsevie
rolllseive rolllseiev rollleiesv rollleievs rollleisev rollleisve rollleivse rollleives rollleeisv rollleeivs rollleesiv
rollleesvi rollleevsi rollleevis rollleseiv rolllesevi rolllesiev rolllesive rolllesvie rolllesvei rolllevesi rollleveis
rolllevsei rolllevsie rolllevise rolllevies rolleviels rolleviesl rolleviles rollevilse rollevisle rollevisel rolleveils
rolleveisl rollevelis rollevelsi rollevesli rollevesil rollevleis rollevlesi rollevlies rollevlise rollevlsie rollevlsei
rollevseli rollevseil rollevslei rollevslie rollevsile rollevsiel rolleivels rolleivesl rolleivles rolleivlse rolleivsle
rolleivsel rolleievls rolleievsl rolleielvs rolleielsv rolleieslv rolleiesvl rolleilevs rolleilesv rolleilves rolleilvse
rolleilsve rolleilsev rolleiselv rolleisevl rolleislev rolleislve rolleisvle rolleisvel rolleeivls rolleeivsl rolleeilvs
rolleeilsv rolleeislv rolleeisvl rolleevils rolleevisl rolleevlis rolleevlsi rolleevsli rolleevsil rolleelvis rolleelvsi
rolleelivs rolleelisv rolleelsiv rolleelsvi rolleesvli rolleesvil rolleeslvi rolleesliv rolleesilv rolleesivl rollelievs
rolleliesv rollelives rollelivse rollelisve rollelisev rolleleivs rolleleisv rollelevis rollelevsi rollelesvi rollelesiv
rollelveis rollelvesi rollelvies rollelvise rollelvsie rollelvsei rollelsevi rollelseiv rollelsvei rollelsvie rollelsive
rollelsiev rollesielv rollesievl rollesilev rollesilve rollesivle rollesivel rolleseilv rolleseivl rolleseliv rolleselvi
rollesevli rollesevil rollesleiv rolleslevi rollesliev rolleslive rolleslvie rolleslvei rollesveli rollesveil rollesvlei
rollesvlie rollesvile rollesviel rollsvilee rollsvilee rollsviele rollsvieel rollsvieel rollsviele rollsvliee rollsvliee
rollsvleie rollsvleei rollsvleei rollsvleie rollsvelie rollsvelei rollsveile rollsveiel rollsveeil rollsveeli rollsvelei
rollsvelie rollsveeli rollsveeil rollsveiel rollsveile rollsivlee rollsivlee rollsivele rollsiveel rollsiveel rollsivele
rollsilvee rollsilvee rollsileve rollsileev rollsileev rollsileve rollsielve rollsielev rollsievle rollsievel rollsieevl
rollsieelv rollsielev rollsielve rollsieelv rollsieevl rollsievel rollsievle rollslivee rollslivee rollslieve rollslieev
rollslieev rollslieve rollslviee rollslviee rollslveie rollslveei rollslveei rollslveie rollslevie rollslevei rollsleive
rollsleiev rollsleeiv rollsleevi rollslevei rollslevie rollsleevi rollsleeiv rollsleiev rollsleive rollseilve rollseilev
rollseivle rollseivel rollseievl rollseielv rollselive rollseliev rollselvie rollselvei rollselevi rollseleiv rollsevlie
rollsevlei rollsevile rollseviel rollseveil rollseveli rollseelvi rollseeliv rollseevli rollseevil rollseeivl rollseeilv
rollseilev rollseilve rollseielv rollseievl rollseivel rollseivle rollseliev rollselive rollseleiv rollselevi rollselvei
rollselvie rollseeliv rollseelvi rollseeilv rollseeivl rollseevil rollseevli rollsevlei rollsevlie rollseveli rollseveil
rollseviel rollsevile rollvsilee rollvsilee rollvsiele rollvsieel rollvsieel rollvsiele rollvsliee rollvsliee rollvsleie
rollvsleei rollvsleei rollvsleie rollvselie rollvselei rollvseile rollvseiel rollvseeil rollvseeli rollvselei rollvselie
rollvseeli rollvseeil rollvseiel rollvseile rollvislee rollvislee rollvisele rollviseel rollviseel rollvisele rollvilsee
rollvilsee rollvilese rollvilees rollvilees rollvilese rollvielse rollvieles rollviesle rollviesel rollvieesl rollvieels
rollvieles rollvielse rollvieels rollvieesl rollviesel rollviesle rollvlisee rollvlisee rollvliese rollvliees rollvliees
rollvliese rollvlsiee rollvlsiee rollvlseie rollvlseei rollvlseei rollvlseie rollvlesie rollvlesei rollvleise rollvleies
rollvleeis rollvleesi rollvlesei rollvlesie rollvleesi rollvleeis rollvleies rollvleise rollveilse rollveiles rollveisle
rollveisel rollveiesl rollveiels rollvelise rollvelies rollvelsie rollvelsei rollvelesi rollveleis rollveslie rollveslei
rollvesile rollvesiel rollveseil rollveseli rollveelsi rollveelis rollveesli rollveesil rollveeisl rollveeils rollveiles
rollveilse rollveiels rollveiesl rollveisel rollveisle rollvelies rollvelise rollveleis rollvelesi rollvelsei rollvelsie
rollveelis rollveelsi rollveeils rollveeisl rollveesil rollveesli rollveslei rollveslie rollveseli rollveseil rollvesiel
rollvesile rollivslee rollivslee rollivsele rollivseel rollivseel rollivsele rollivlsee rollivlsee rollivlese rollivlees
rollivlees rollivlese rollivelse rolliveles rollivesle rollivesel rolliveesl rolliveels rolliveles rollivelse rolliveels
rolliveesl rollivesel rollivesle rollisvlee rollisvlee rollisvele rollisveel rollisveel rollisvele rollislvee rollislvee
rollisleve rollisleev rollisleev rollisleve rolliselve rolliselev rollisevle rollisevel rolliseevl rolliseelv rolliselev
rolliselve rolliseelv rolliseevl rollisevel rollisevle rollilsvee rollilsvee rollilseve rollilseev rollilseev rollilseve
rollilvsee rollilvsee rollilvese rollilvees rollilvees rollilvese rollilevse rollileves rollilesve rollilesev rollileesv
rollileevs rollileves rollilevse rollileevs rollileesv rollilesev rollilesve rollieslve rollieslev rolliesvle rolliesvel
rolliesevl rollieselv rollielsve rollielsev rollielvse rollielves rollielevs rollielesv rollievlse rollievles rollievsle
rollievsel rollievesl rollievels rollieelvs rollieelsv rollieevls rollieevsl rollieesvl rollieeslv rollieslev rollieslve
rollieselv rolliesevl rolliesvel rolliesvle rollielsev rollielsve rollielesv rollielevs rollielves rollielvse rollieelsv
rollieelvs rollieeslv rollieesvl rollieevsl rollieevls rollievles rollievlse rollievels rollievesl rollievsel rollievsle
rolllvisee rolllvisee rolllviese rolllviees rolllviees rolllviese rolllvsiee rolllvsiee rolllvseie rolllvseei rolllvseei
rolllvseie rolllvesie rolllvesei rolllveise rolllveies rolllveeis rolllveesi rolllvesei rolllvesie rolllveesi rolllveeis
rolllveies rolllveise rolllivsee rolllivsee rolllivese rolllivees rolllivees rolllivese rolllisvee rolllisvee rollliseve
rollliseev rollliseev rollliseve rollliesve rollliesev rolllievse rolllieves rolllieevs rolllieesv rollliesev rollliesve
rolllieesv rolllieevs rolllieves rolllievse rolllsivee rolllsivee rolllsieve rolllsieev rolllsieev rolllsieve rolllsviee
rolllsviee rolllsveie rolllsveei rolllsveei rolllsveie rolllsevie rolllsevei rolllseive rolllseiev rolllseeiv rolllseevi
rolllsevei rolllsevie rolllseevi rolllseeiv rolllseiev rolllseive rollleisve rollleisev rollleivse rollleives rollleievs
rollleiesv rolllesive rolllesiev rolllesvie rolllesvei rolllesevi rollleseiv rolllevsie rolllevsei rolllevise rolllevies
rollleveis rolllevesi rollleesvi rollleesiv rollleevsi rollleevis rollleeivs rollleeisv rollleisev rollleisve rollleiesv
rollleievs rollleives rollleivse rolllesiev rolllesive rollleseiv rolllesevi rolllesvei rolllesvie rollleesiv rollleesvi
rollleeisv rollleeivs rollleevis rollleevsi rolllevsei rolllevsie rolllevesi rollleveis rolllevies rolllevise rollevilse
rolleviles rollevisle rollevisel rolleviesl rolleviels rollevlise rollevlies rollevlsie rollevlsei rollevlesi rollevleis
rollevslie rollevslei rollevsile rollevsiel rollevseil rollevseli rollevelsi rollevelis rollevesli rollevesil rolleveisl
rolleveils rolleivlse rolleivles rolleivsle rolleivsel rolleivesl rolleivels rolleilvse rolleilves rolleilsve rolleilsev
rolleilesv rolleilevs rolleislve rolleislev rolleisvle rolleisvel rolleisevl rolleiselv rolleielsv rolleielvs rolleieslv
rolleiesvl rolleievsl rolleievls rollelivse rollelives rollelisve rollelisev rolleliesv rollelievs rollelvise rollelvies
rollelvsie rollelvsei rollelvesi rollelveis rollelsvie rollelsvei rollelsive rollelsiev rollelseiv rollelsevi rollelevsi
rollelevis rollelesvi rollelesiv rolleleisv rolleleivs rollesilve rollesilev rollesivle rollesivel rollesievl rollesielv
rolleslive rollesliev rolleslvie rolleslvei rolleslevi rollesleiv rollesvlie rollesvlei rollesvile rollesviel rollesveil
rollesveli rolleselvi rolleseliv rollesevli rollesevil rolleseivl rolleseilv rolleeilsv rolleeilvs rolleeislv rolleeisvl
rolleeivsl rolleeivls rolleelisv rolleelivs rolleelsiv rolleelsvi rolleelvsi rolleelvis rolleesliv rolleeslvi rolleesilv
rolleesivl rolleesvil rolleesvli rolleevlsi rolleevlis rolleevsli rolleevsil rolleevisl rolleevils rolleviles rollevilse
rolleviels rolleviesl rollevisel rollevisle rollevlies rollevlise rollevleis rollevlesi rollevlsei rollevlsie rollevelis
rollevelsi rolleveils rolleveisl rollevesil rollevesli rollevslei rollevslie rollevseli rollevseil rollevsiel rollevsile
rolleivles rolleivlse rolleivels rolleivesl rolleivsel rolleivsle rolleilves rolleilvse rolleilevs rolleilesv rolleilsev
rolleilsve rolleielvs rolleielsv rolleievls rolleievsl rolleiesvl rolleieslv rolleislev rolleislve rolleiselv rolleisevl
rolleisvel rolleisvle rollelives rollelivse rollelievs rolleliesv rollelisev rollelisve rollelvies rollelvise rollelveis
rollelvesi rollelvsei rollelvsie rollelevis rollelevsi rolleleivs rolleleisv rollelesiv rollelesvi rollelsvei rollelsvie
rollelsevi rollelseiv rollelsiev rollelsive rolleeilvs rolleeilsv rolleeivls rolleeivsl rolleeisvl rolleeislv rolleelivs
rolleelisv rolleelvis rolleelvsi rolleelsvi rolleelsiv rolleevlis rolleevlsi rolleevils rolleevisl rolleevsil rolleevsli
rolleeslvi rolleesliv rolleesvli rolleesvil rolleesivl rolleesilv rollesilev rollesilve rollesielv rollesievl rollesivel
rollesivle rollesliev rolleslive rollesleiv rolleslevi rolleslvei rolleslvie rolleseliv rolleselvi rolleseilv rolleseivl
rollesevil rollesevli rollesvlei rollesvlie rollesveli rollesveil rollesviel rollesvile rolesville rolesvilel rolesville
rolesvilel rolesviell rolesviell rolesvlile rolesvliel rolesvllie rolesvllei rolesvleli rolesvleil rolesvllie rolesvllei
rolesvlile rolesvliel rolesvleil rolesvleli rolesvelli rolesvelil rolesvelli rolesvelil rolesveill rolesveill rolesivlle
rolesivlel rolesivlle rolesivlel rolesivell rolesivell rolesilvle rolesilvel rolesillve rolesillev rolesilelv rolesilevl
rolesillve rolesillev rolesilvle rolesilvel rolesilevl rolesilelv rolesiellv rolesielvl rolesiellv rolesielvl rolesievll
rolesievll roleslivle roleslivel roleslilve roleslilev roleslielv roleslievl roleslvile roleslviel roleslvlie roleslvlei
roleslveli roleslveil rolesllvie rolesllvei rolesllive roleslliev roleslleiv rolesllevi roleslevli roleslevil roleslelvi
rolesleliv rolesleilv rolesleivl roleslilve roleslilev roleslivle roleslivel roleslievl roleslielv rolesllive roleslliev
rolesllvie rolesllvei rolesllevi roleslleiv roleslvlie roleslvlei roleslvile roleslviel roleslveil roleslveli roleslelvi
rolesleliv roleslevli roleslevil rolesleivl rolesleilv roleseillv roleseilvl roleseillv roleseilvl roleseivll roleseivll
roleselilv roleselivl roleselliv rolesellvi roleselvli roleselvil roleselliv rolesellvi roleselilv roleselivl roleselvil
roleselvli rolesevlli rolesevlil rolesevlli rolesevlil rolesevill rolesevill rolevsille rolevsilel rolevsille rolevsilel
rolevsiell rolevsiell rolevslile rolevsliel rolevsllie rolevsllei rolevsleli rolevsleil rolevsllie rolevsllei rolevslile
rolevsliel rolevsleil rolevsleli rolevselli rolevselil rolevselli rolevselil rolevseill rolevseill rolevislle rolevislel
rolevislle rolevislel rolevisell rolevisell rolevilsle rolevilsel rolevillse rolevilles rolevilels rolevilesl rolevillse
rolevilles rolevilsle rolevilsel rolevilesl rolevilels roleviells rolevielsl roleviells rolevielsl roleviesll roleviesll
rolevlisle rolevlisel rolevlilse rolevliles rolevliels rolevliesl rolevlsile rolevlsiel rolevlslie rolevlslei rolevlseli
rolevlseil rolevllsie rolevllsei rolevllise rolevllies rolevlleis rolevllesi rolevlesli rolevlesil rolevlelsi rolevlelis
rolevleils rolevleisl rolevlilse rolevliles rolevlisle rolevlisel rolevliesl rolevliels rolevllise rolevllies rolevllsie
rolevllsei rolevllesi rolevlleis rolevlslie rolevlslei rolevlsile rolevlsiel rolevlseil rolevlseli rolevlelsi rolevlelis
rolevlesli rolevlesil rolevleisl rolevleils roleveills roleveilsl roleveills roleveilsl roleveisll roleveisll rolevelils
rolevelisl rolevellis rolevellsi rolevelsli rolevelsil rolevellis rolevellsi rolevelils rolevelisl rolevelsil rolevelsli
roleveslli roleveslil roleveslli roleveslil rolevesill rolevesill roleivslle roleivslel roleivslle roleivslel roleivsell
roleivsell roleivlsle roleivlsel roleivllse roleivlles roleivlels roleivlesl roleivllse roleivlles roleivlsle roleivlsel
roleivlesl roleivlels roleivells roleivelsl roleivells roleivelsl roleivesll roleivesll roleisvlle roleisvlel roleisvlle
roleisvlel roleisvell roleisvell roleislvle roleislvel roleisllve roleisllev roleislelv roleislevl roleisllve roleisllev
roleislvle roleislvel roleislevl roleislelv roleisellv roleiselvl roleisellv roleiselvl roleisevll roleisevll roleilsvle
roleilsvel roleilslve roleilslev roleilselv roleilsevl roleilvsle roleilvsel roleilvlse roleilvles roleilvels roleilvesl
roleillvse roleillves roleillsve roleillsev roleillesv roleillevs roleilevls roleilevsl roleilelvs roleilelsv roleileslv
roleilesvl roleilslve roleilslev roleilsvle roleilsvel roleilsevl roleilselv roleillsve roleillsev roleillvse roleillves
roleillevs roleillesv roleilvlse roleilvles roleilvsle roleilvsel roleilvesl roleilvels roleilelvs roleilelsv roleilevls
roleilevsl roleilesvl roleileslv roleiesllv roleieslvl roleiesllv roleieslvl roleiesvll roleiesvll roleielslv roleielsvl
roleiellsv roleiellvs roleielvls roleielvsl roleiellsv roleiellvs roleielslv roleielsvl roleielvsl roleielvls roleievlls
roleievlsl roleievlls roleievlsl roleievsll roleievsll rolelvisle rolelvisel rolelvilse rolelviles rolelviels rolelviesl
rolelvsile rolelvsiel rolelvslie rolelvslei rolelvseli rolelvseil rolelvlsie rolelvlsei rolelvlise rolelvlies rolelvleis
rolelvlesi rolelvesli rolelvesil rolelvelsi rolelvelis rolelveils rolelveisl rolelivsle rolelivsel rolelivlse rolelivles
rolelivels rolelivesl rolelisvle rolelisvel rolelislve rolelislev roleliselv rolelisevl rolelilsve rolelilsev rolelilvse
rolelilves rolelilevs rolelilesv rolelieslv roleliesvl rolelielsv rolelielvs rolelievls rolelievsl rolelsivle rolelsivel
rolelsilve rolelsilev rolelsielv rolelsievl rolelsvile rolelsviel rolelsvlie rolelsvlei rolelsveli rolelsveil rolelslvie
rolelslvei rolelslive rolelsliev rolelsleiv rolelslevi rolelsevli rolelsevil rolelselvi rolelseliv rolelseilv rolelseivl
rolellisve rolellisev rolellivse rolellives rolellievs rolelliesv rolellsive rolellsiev rolellsvie rolellsvei rolellsevi
rolellseiv rolellvsie rolellvsei rolellvise rolellvies rolellveis rolellvesi rolellesvi rolellesiv rolellevsi rolellevis
rolelleivs rolelleisv roleleislv roleleisvl roleleilsv roleleilvs roleleivls roleleivsl rolelesilv rolelesivl rolelesliv
roleleslvi rolelesvli rolelesvil rolelelsiv rolelelsvi rolelelisv rolelelivs rolelelvis rolelelvsi rolelevsli rolelevsil
rolelevlsi rolelevlis rolelevils rolelevisl rolelvilse rolelviles rolelvisle rolelvisel rolelviesl rolelviels rolelvlise
rolelvlies rolelvlsie rolelvlsei rolelvlesi rolelvleis rolelvslie rolelvslei rolelvsile rolelvsiel rolelvseil rolelvseli
rolelvelsi rolelvelis rolelvesli rolelvesil rolelveisl rolelveils rolelivlse rolelivles rolelivsle rolelivsel rolelivesl
rolelivels rolelilvse rolelilves rolelilsve rolelilsev rolelilesv rolelilevs rolelislve rolelislev rolelisvle rolelisvel
rolelisevl roleliselv rolelielsv rolelielvs rolelieslv roleliesvl rolelievsl rolelievls rolellivse rolellives rolellisve
rolellisev rolelliesv rolellievs rolellvise rolellvies rolellvsie rolellvsei rolellvesi rolellveis rolellsvie rolellsvei
rolellsive rolellsiev rolellseiv rolellsevi rolellevsi rolellevis rolellesvi rolellesiv rolelleisv rolelleivs rolelsilve
rolelsilev rolelsivle rolelsivel rolelsievl rolelsielv rolelslive rolelsliev rolelslvie rolelslvei rolelslevi rolelsleiv
rolelsvlie rolelsvlei rolelsvile rolelsviel rolelsveil rolelsveli rolelselvi rolelseliv rolelsevli rolelsevil rolelseivl
rolelseilv roleleilsv roleleilvs roleleislv roleleisvl roleleivsl roleleivls rolelelisv rolelelivs rolelelsiv rolelelsvi
rolelelvsi rolelelvis rolelesliv roleleslvi rolelesilv rolelesivl rolelesvil rolelesvli rolelevlsi rolelevlis rolelevsli
rolelevsil rolelevisl rolelevils roleevills roleevilsl roleevills roleevilsl roleevisll roleevisll roleevlils roleevlisl
roleevllis roleevllsi roleevlsli roleevlsil roleevllis roleevllsi roleevlils roleevlisl roleevlsil roleevlsli roleevslli
roleevslil roleevslli roleevslil roleevsill roleevsill roleeivlls roleeivlsl roleeivlls roleeivlsl roleeivsll roleeivsll
roleeilvls roleeilvsl roleeillvs roleeillsv roleeilslv roleeilsvl roleeillvs roleeillsv roleeilvls roleeilvsl roleeilsvl
roleeilslv roleeisllv roleeislvl roleeisllv roleeislvl roleeisvll roleeisvll roleelivls roleelivsl roleelilvs roleelilsv
roleelislv roleelisvl roleelvils roleelvisl roleelvlis roleelvlsi roleelvsli roleelvsil roleellvis roleellvsi roleellivs
roleellisv roleellsiv roleellsvi roleelsvli roleelsvil roleelslvi roleelsliv roleelsilv roleelsivl roleelilvs roleelilsv
roleelivls roleelivsl roleelisvl roleelislv roleellivs roleellisv roleellvis roleellvsi roleellsvi roleellsiv roleelvlis
roleelvlsi roleelvils roleelvisl roleelvsil roleelvsli roleelslvi roleelsliv roleelsvli roleelsvil roleelsivl roleelsilv
roleesillv roleesilvl roleesillv roleesilvl roleesivll roleesivll roleeslilv roleeslivl roleeslliv roleesllvi roleeslvli
roleeslvil roleeslliv roleesllvi roleeslilv roleeslivl roleeslvil roleeslvli roleesvlli roleesvlil roleesvlli roleesvlil
roleesvill roleesvill

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us