easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

uncommented

azinge

cocainist

gibbeted

botsford

profascist

plinio

dunkie

edvige

shosta

cotemporaneous

gelatinouscube

haegele

maidenly

subdirectors

peremptaeque

intreated

lamprocystis


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: rmiller
cipher variations:
snjmmfs toknngt uploohu vqmppiv wrnqqjw
xsorrkx ytpssly zuqttmz avruuna bwsvvob
cxtwwpc dyuxxqd ezvyyre fawzzsf gbxaatg
hcybbuh idzccvi jeaddwj kfbeexk lgcffyl
mhdggzm niehhan ojfiibo pkgjjcp qlhkkdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: rmiller
Cipher: inroovi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: rmiller
Cipher: BAAAA ABABB ABAAA ABABA ABABA AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: rmiller
cipher variations:
snjmmfsalziinaijpeeviqhfaadqyfvwwlygdlsstgwzrkkjwexhggre
mvxcczmutnyyhucrduupckptqqxktoknngtbmajjobjkqffwjrigbber
zgwxxmzhemttuhxasllkxfyihhsfnwyddanvuozzivdsevvqdlqurryl
uploohucnbkkpcklrggxksjhccfsahxyynaifnuuviybtmmlygzjiitg
oxzeebowvpaajwetfwwremrvsszmvqmppivdocllqdlmshhyltkiddgt
biyzzobjgovvwjzcunnmzhakjjuhpyaffcpxwqbbkxfugxxsfnswttan
wrnqqjwepdmmremntiizmuljeehucjzaapckhpwwxkadvoonaiblkkvi
qzbggdqyxrcclygvhyytgotxuuboxsorrkxfqennsfnoujjanvmkffiv
dkabbqdliqxxylbewppobjcmllwjrachherzysddmzhwizzuhpuyvvcp
ytpsslygrfootgopvkkbownlggjwelbccremjryyzmcfxqqpckdnmmxk
sbdiifsazteenaixjaaviqvzwwdqzuqttmzhsgppuhpqwllcpxomhhkx
fmcddsfnkszzandgyrrqdleonnyltcejjgtbauffobjykbbwjrwaxxer
avruunaithqqviqrxmmdqypniilygndeetgoltaaboehzssremfpoozm
udfkkhucbvggpckzlccxksxbyyfsbwsvvobjuirrwjrsynnerzqojjmz
hoeffuhpmubbcpfiattsfngqppanvegllivdcwhhqdlamddyltyczzgt
cxtwwpckvjssxkstzoofsarpkknaipfggviqnvccdqgjbuutgohrqqbo
wfhmmjwedxiirembneezmuzdaahudyuxxqdlwkttyltuappgtbsqllob
jqghhwjrowdderhkcvvuhpisrrcpxginnkxfeyjjsfncoffanvaebbiv
ezvyyremxluuzmuvbqqhuctrmmpckrhiixkspxeefsildwwviqjtssdq
yhjoolygfzkktgodpggbowbfccjwfawzzsfnymvvanvwcrrivdusnnqd
lsijjyltqyffgtjmexxwjrkutterzikppmzhgalluhpeqhhcpxcgddkx
gbxaatgoznwwbowxdssjwevtooremtjkkzmurzgghuknfyyxkslvuufs
ajlqqnaihbmmviqfriidqydheelyhcybbuhpaoxxcpxyettkxfwuppsf
nukllanvsahhivlogzzyltmwvvgtbkmrrobjicnnwjrgsjjerzeiffmz
idzccviqbpyydqyzfuulygxvqqtgovlmmbowtbiijwmphaazmunxwwhu
clnsspckjdooxkshtkkfsafjggnajeaddwjrcqzzerzagvvmzhywrruh
pwmnncpxucjjkxnqibbanvoyxxivdmottqdlkeppyltiullgtbgkhhob
kfbeexksdraafsabhwwnaizxssviqxnoodqyvdkklyorjccbowpzyyjw
enpuuremlfqqzmujvmmhuchliipclgcffyltesbbgtbcixxobjayttwj
ryopperzwellmzpskddcpxqazzkxfoqvvsfnmgrranvkwnnivdimjjqd
mhdggzmuftcchucdjyypckbzuuxkszpqqfsaxfmmnaqtleedqyrbaaly
gprwwtgonhssbowlxoojwejnkkreniehhanvguddivdekzzqdlcavvyl
taqrrgtbygnnobrumfferzscbbmzhqsxxuhpoittcpxmyppkxfkollsf
ojfiibowhveejweflaaremdbwwzmubrsshuczhoopcsvnggfsatdccna
irtyyviqpjuudqynzqqlyglpmmtgpkgjjcpxiwffkxfgmbbsfnecxxan
vcsttivdaippqdtwohhgtbueddobjsuzzwjrqkvverzoarrmzhmqnnuh
qlhkkdqyjxgglyghncctgofdyybowdtuujwebjqqreuxpiihucvfeepc
ktvaaxksrlwwfsapbssnainroovirmillerzkyhhmzhiodduhpgezzcp
xeuvvkxfckrrsfvyqjjivdwgffqdluwbbyltsmxxgtbqcttobjosppwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: rmiller
Cipher: ezvyyre

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: rmiller
Cipher: 24234213135124

Extended Methods:
Method #1

Plaintext: rmiller
method variations:
wroqqkwbwtvvpbgbyaaugmgdffzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r m i l l e r 
2 2 4 1 1 5 2 
4 3 2 3 3 1 4 
They are then read out in rows:
22411524323314
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: rmiller
Cipher: gdvrhnq

Read more ...
Method #3

Plaintext: rmiller
method variations:
isbcxfi sbcxfii bcxfiis
cxfiisb xfiisbc fiisbcx
iisbcxf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: rmiller

all 5040 cipher variations:
rmiller rmillre rmilelr rmilerl rmilrel rmilrle rmiller rmillre rmilelr rmilerl rmilrel
rmilrle rmiellr rmielrl rmiellr rmielrl rmierll rmierll rmirlel rmirlle rmirell rmirell
rmirlel rmirlle rmliler rmlilre rmlielr rmlierl rmlirel rmlirle rmllier rmllire rmlleir
rmlleri rmllrei rmllrie rmlelir rmlelri rmleilr rmleirl rmleril rmlerli rmlrlei rmlrlie
rmlreli rmlreil rmlriel rmlrile rmllier rmllire rmlleir rmlleri rmllrei rmllrie rmliler
rmlilre rmlielr rmlierl rmlirel rmlirle rmleilr rmleirl rmlelir rmlelri rmlerli rmleril
rmlriel rmlrile rmlreil rmlreli rmlrlei rmlrlie rmellir rmellri rmelilr rmelirl rmelril
rmelrli rmellir rmellri rmelilr rmelirl rmelril rmelrli rmeillr rmeilrl rmeillr rmeilrl
rmeirll rmeirll rmerlil rmerlli rmerill rmerill rmerlil rmerlli rmrllei rmrllie rmrleli
rmrleil rmrliel rmrlile rmrllei rmrllie rmrleli rmrleil rmrliel rmrlile rmrelli rmrelil
rmrelli rmrelil rmreill rmreill rmrilel rmrille rmriell rmriell rmrilel rmrille rimller
rimllre rimlelr rimlerl rimlrel rimlrle rimller rimllre rimlelr rimlerl rimlrel rimlrle
rimellr rimelrl rimellr rimelrl rimerll rimerll rimrlel rimrlle rimrell rimrell rimrlel
rimrlle rilmler rilmlre rilmelr rilmerl rilmrel rilmrle rillmer rillmre rillemr rillerm
rillrem rillrme rilelmr rilelrm rilemlr rilemrl rilerml rilerlm rilrlem rilrlme rilrelm
rilreml rilrmel rilrmle rillmer rillmre rillemr rillerm rillrem rillrme rilmler rilmlre
rilmelr rilmerl rilmrel rilmrle rilemlr rilemrl rilelmr rilelrm rilerlm rilerml rilrmel
rilrmle rilreml rilrelm rilrlem rilrlme riellmr riellrm rielmlr rielmrl rielrml rielrlm
riellmr riellrm rielmlr rielmrl rielrml rielrlm riemllr riemlrl riemllr riemlrl riemrll
riemrll rierlml rierllm riermll riermll rierlml rierllm rirllem rirllme rirlelm rirleml
rirlmel rirlmle rirllem rirllme rirlelm rirleml rirlmel rirlmle rirellm rirelml rirellm
rirelml riremll riremll rirmlel rirmlle rirmell rirmell rirmlel rirmlle rlimler rlimlre
rlimelr rlimerl rlimrel rlimrle rlilmer rlilmre rlilemr rlilerm rlilrem rlilrme rlielmr
rlielrm rliemlr rliemrl rlierml rlierlm rlirlem rlirlme rlirelm rlireml rlirmel rlirmle
rlmiler rlmilre rlmielr rlmierl rlmirel rlmirle rlmlier rlmlire rlmleir rlmleri rlmlrei
rlmlrie rlmelir rlmelri rlmeilr rlmeirl rlmeril rlmerli rlmrlei rlmrlie rlmreli rlmreil
rlmriel rlmrile rllmier rllmire rllmeir rllmeri rllmrei rllmrie rllimer rllimre rlliemr
rllierm rllirem rllirme rlleimr rlleirm rllemir rllemri rllermi rllerim rllriem rllrime
rllreim rllremi rllrmei rllrmie rlemlir rlemlri rlemilr rlemirl rlemril rlemrli rlelmir
rlelmri rlelimr rlelirm rlelrim rlelrmi rleilmr rleilrm rleimlr rleimrl rleirml rleirlm
rlerlim rlerlmi rlerilm rleriml rlermil rlermli rlrmlei rlrmlie rlrmeli rlrmeil rlrmiel
rlrmile rlrlmei rlrlmie rlrlemi rlrleim rlrliem rlrlime rlrelmi rlrelim rlremli rlremil
rlreiml rlreilm rlrilem rlrilme rlrielm rlrieml rlrimel rlrimle rlilmer rlilmre rlilemr
rlilerm rlilrem rlilrme rlimler rlimlre rlimelr rlimerl rlimrel rlimrle rliemlr rliemrl
rlielmr rlielrm rlierlm rlierml rlirmel rlirmle rlireml rlirelm rlirlem rlirlme rllimer
rllimre rlliemr rllierm rllirem rllirme rllmier rllmire rllmeir rllmeri rllmrei rllmrie
rllemir rllemri rlleimr rlleirm rllerim rllermi rllrmei rllrmie rllremi rllreim rllriem
rllrime rlmlier rlmlire rlmleir rlmleri rlmlrei rlmlrie rlmiler rlmilre rlmielr rlmierl
rlmirel rlmirle rlmeilr rlmeirl rlmelir rlmelri rlmerli rlmeril rlmriel rlmrile rlmreil
rlmreli rlmrlei rlmrlie rlelmir rlelmri rlelimr rlelirm rlelrim rlelrmi rlemlir rlemlri
rlemilr rlemirl rlemril rlemrli rleimlr rleimrl rleilmr rleilrm rleirlm rleirml rlermil
rlermli rleriml rlerilm rlerlim rlerlmi rlrlmei rlrlmie rlrlemi rlrleim rlrliem rlrlime
rlrmlei rlrmlie rlrmeli rlrmeil rlrmiel rlrmile rlremli rlremil rlrelmi rlrelim rlreilm
rlreiml rlrimel rlrimle rlrieml rlrielm rlrilem rlrilme reillmr reillrm reilmlr reilmrl
reilrml reilrlm reillmr reillrm reilmlr reilmrl reilrml reilrlm reimllr reimlrl reimllr
reimlrl reimrll reimrll reirlml reirllm reirmll reirmll reirlml reirllm relilmr relilrm
relimlr relimrl relirml relirlm rellimr rellirm rellmir rellmri rellrmi rellrim relmlir
relmlri relmilr relmirl relmril relmrli relrlmi relrlim relrmli relrmil relriml relrilm
rellimr rellirm rellmir rellmri rellrmi rellrim relilmr relilrm relimlr relimrl relirml
relirlm relmilr relmirl relmlir relmlri relmrli relmril relriml relrilm relrmil relrmli
relrlmi relrlim remllir remllri remlilr remlirl remlril remlrli remllir remllri remlilr
remlirl remlril remlrli remillr remilrl remillr remilrl remirll remirll remrlil remrlli
remrill remrill remrlil remrlli rerllmi rerllim rerlmli rerlmil rerliml rerlilm rerllmi
rerllim rerlmli rerlmil rerliml rerlilm rermlli rermlil rermlli rermlil rermill rermill
rerilml rerillm rerimll rerimll rerilml rerillm rrillem rrillme rrilelm rrileml rrilmel
rrilmle rrillem rrillme rrilelm rrileml rrilmel rrilmle rriellm rrielml rriellm rrielml
rriemll rriemll rrimlel rrimlle rrimell rrimell rrimlel rrimlle rrlilem rrlilme rrlielm
rrlieml rrlimel rrlimle rrlliem rrllime rrlleim rrllemi rrllmei rrllmie rrlelim rrlelmi
rrleilm rrleiml rrlemil rrlemli rrlmlei rrlmlie rrlmeli rrlmeil rrlmiel rrlmile rrlliem
rrllime rrlleim rrllemi rrllmei rrllmie rrlilem rrlilme rrlielm rrlieml rrlimel rrlimle
rrleilm rrleiml rrlelim rrlelmi rrlemli rrlemil rrlmiel rrlmile rrlmeil rrlmeli rrlmlei
rrlmlie rrellim rrellmi rrelilm rreliml rrelmil rrelmli rrellim rrellmi rrelilm rreliml
rrelmil rrelmli rreillm rreilml rreillm rreilml rreimll rreimll rremlil rremlli rremill
rremill rremlil rremlli rrmllei rrmllie rrmleli rrmleil rrmliel rrmlile rrmllei rrmllie
rrmleli rrmleil rrmliel rrmlile rrmelli rrmelil rrmelli rrmelil rrmeill rrmeill rrmilel
rrmille rrmiell rrmiell rrmilel rrmille mriller mrillre mrilelr mrilerl mrilrel mrilrle
mriller mrillre mrilelr mrilerl mrilrel mrilrle mriellr mrielrl mriellr mrielrl mrierll
mrierll mrirlel mrirlle mrirell mrirell mrirlel mrirlle mrliler mrlilre mrlielr mrlierl
mrlirel mrlirle mrllier mrllire mrlleir mrlleri mrllrei mrllrie mrlelir mrlelri mrleilr
mrleirl mrleril mrlerli mrlrlei mrlrlie mrlreli mrlreil mrlriel mrlrile mrllier mrllire
mrlleir mrlleri mrllrei mrllrie mrliler mrlilre mrlielr mrlierl mrlirel mrlirle mrleilr
mrleirl mrlelir mrlelri mrlerli mrleril mrlriel mrlrile mrlreil mrlreli mrlrlei mrlrlie
mrellir mrellri mrelilr mrelirl mrelril mrelrli mrellir mrellri mrelilr mrelirl mrelril
mrelrli mreillr mreilrl mreillr mreilrl mreirll mreirll mrerlil mrerlli mrerill mrerill
mrerlil mrerlli mrrllei mrrllie mrrleli mrrleil mrrliel mrrlile mrrllei mrrllie mrrleli
mrrleil mrrliel mrrlile mrrelli mrrelil mrrelli mrrelil mrreill mrreill mrrilel mrrille
mrriell mrriell mrrilel mrrille mirller mirllre mirlelr mirlerl mirlrel mirlrle mirller
mirllre mirlelr mirlerl mirlrel mirlrle mirellr mirelrl mirellr mirelrl mirerll mirerll
mirrlel mirrlle mirrell mirrell mirrlel mirrlle milrler milrlre milrelr milrerl milrrel
milrrle millrer millrre millerr millerr millrer millrre milelrr milelrr milerlr milerrl
milerrl milerlr milrler milrlre milrelr milrerl milrrel milrrle millrer millrre millerr
millerr millrer millrre milrler milrlre milrelr milrerl milrrel milrrle milerlr milerrl
milelrr milelrr milerlr milerrl milrrel milrrle milrerl milrelr milrler milrlre miellrr
miellrr mielrlr mielrrl mielrrl mielrlr miellrr miellrr mielrlr mielrrl mielrrl mielrlr
mierllr mierlrl mierllr mierlrl mierrll mierrll mierlrl mierllr mierrll mierrll mierlrl
mierllr mirller mirllre mirlelr mirlerl mirlrel mirlrle mirller mirllre mirlelr mirlerl
mirlrel mirlrle mirellr mirelrl mirellr mirelrl mirerll mirerll mirrlel mirrlle mirrell
mirrell mirrlel mirrlle mlirler mlirlre mlirelr mlirerl mlirrel mlirrle mlilrer mlilrre
mlilerr mlilerr mlilrer mlilrre mlielrr mlielrr mlierlr mlierrl mlierrl mlierlr mlirler
mlirlre mlirelr mlirerl mlirrel mlirrle mlriler mlrilre mlrielr mlrierl mlrirel mlrirle
mlrlier mlrlire mlrleir mlrleri mlrlrei mlrlrie mlrelir mlrelri mlreilr mlreirl mlreril
mlrerli mlrrlei mlrrlie mlrreli mlrreil mlrriel mlrrile mllrier mllrire mllreir mllreri
mllrrei mllrrie mllirer mllirre mllierr mllierr mllirer mllirre mlleirr mlleirr mllerir
mllerri mllerri mllerir mllrier mllrire mllreir mllreri mllrrei mllrrie mlerlir mlerlri
mlerilr mlerirl mlerril mlerrli mlelrir mlelrri mlelirr mlelirr mlelrir mlelrri mleilrr
mleilrr mleirlr mleirrl mleirrl mleirlr mlerlir mlerlri mlerilr mlerirl mlerril mlerrli
mlrrlei mlrrlie mlrreli mlrreil mlrriel mlrrile mlrlrei mlrlrie mlrleri mlrleir mlrlier
mlrlire mlrelri mlrelir mlrerli mlreril mlreirl mlreilr mlriler mlrilre mlrielr mlrierl
mlrirel mlrirle mlilrer mlilrre mlilerr mlilerr mlilrer mlilrre mlirler mlirlre mlirelr
mlirerl mlirrel mlirrle mlierlr mlierrl mlielrr mlielrr mlierlr mlierrl mlirrel mlirrle
mlirerl mlirelr mlirler mlirlre mllirer mllirre mllierr mllierr mllirer mllirre mllrier
mllrire mllreir mllreri mllrrei mllrrie mllerir mllerri mlleirr mlleirr mllerir mllerri
mllrrei mllrrie mllreri mllreir mllrier mllrire mlrlier mlrlire mlrleir mlrleri mlrlrei
mlrlrie mlriler mlrilre mlrielr mlrierl mlrirel mlrirle mlreilr mlreirl mlrelir mlrelri
mlrerli mlreril mlrriel mlrrile mlrreil mlrreli mlrrlei mlrrlie mlelrir mlelrri mlelirr
mlelirr mlelrir mlelrri mlerlir mlerlri mlerilr mlerirl mlerril mlerrli mleirlr mleirrl
mleilrr mleilrr mleirlr mleirrl mlerril mlerrli mlerirl mlerilr mlerlir mlerlri mlrlrei
mlrlrie mlrleri mlrleir mlrlier mlrlire mlrrlei mlrrlie mlrreli mlrreil mlrriel mlrrile
mlrerli mlreril mlrelri mlrelir mlreilr mlreirl mlrirel mlrirle mlrierl mlrielr mlriler
mlrilre meillrr meillrr meilrlr meilrrl meilrrl meilrlr meillrr meillrr meilrlr meilrrl
meilrrl meilrlr meirllr meirlrl meirllr meirlrl meirrll meirrll meirlrl meirllr meirrll
meirrll meirlrl meirllr melilrr melilrr melirlr melirrl melirrl melirlr mellirr mellirr
mellrir mellrri mellrri mellrir melrlir melrlri melrilr melrirl melrril melrrli melrlri
melrlir melrrli melrril melrirl melrilr mellirr mellirr mellrir mellrri mellrri mellrir
melilrr melilrr melirlr melirrl melirrl melirlr melrilr melrirl melrlir melrlri melrrli
melrril melrirl melrilr melrril melrrli melrlri melrlir merllir merllri merlilr merlirl
merlril merlrli merllir merllri merlilr merlirl merlril merlrli merillr merilrl merillr
merilrl merirll merirll merrlil merrlli merrill merrill merrlil merrlli merllri merllir
merlrli merlril merlirl merlilr merllri merllir merlrli merlril merlirl merlilr merrlli
merrlil merrlli merrlil merrill merrill merilrl merillr merirll merirll merilrl merillr
mriller mrillre mrilelr mrilerl mrilrel mrilrle mriller mrillre mrilelr mrilerl mrilrel
mrilrle mriellr mrielrl mriellr mrielrl mrierll mrierll mrirlel mrirlle mrirell mrirell
mrirlel mrirlle mrliler mrlilre mrlielr mrlierl mrlirel mrlirle mrllier mrllire mrlleir
mrlleri mrllrei mrllrie mrlelir mrlelri mrleilr mrleirl mrleril mrlerli mrlrlei mrlrlie
mrlreli mrlreil mrlriel mrlrile mrllier mrllire mrlleir mrlleri mrllrei mrllrie mrliler
mrlilre mrlielr mrlierl mrlirel mrlirle mrleilr mrleirl mrlelir mrlelri mrlerli mrleril
mrlriel mrlrile mrlreil mrlreli mrlrlei mrlrlie mrellir mrellri mrelilr mrelirl mrelril
mrelrli mrellir mrellri mrelilr mrelirl mrelril mrelrli mreillr mreilrl mreillr mreilrl
mreirll mreirll mrerlil mrerlli mrerill mrerill mrerlil mrerlli mrrllei mrrllie mrrleli
mrrleil mrrliel mrrlile mrrllei mrrllie mrrleli mrrleil mrrliel mrrlile mrrelli mrrelil
mrrelli mrrelil mrreill mrreill mrrilel mrrille mrriell mrriell mrrilel mrrille imrller
imrllre imrlelr imrlerl imrlrel imrlrle imrller imrllre imrlelr imrlerl imrlrel imrlrle
imrellr imrelrl imrellr imrelrl imrerll imrerll imrrlel imrrlle imrrell imrrell imrrlel
imrrlle imlrler imlrlre imlrelr imlrerl imlrrel imlrrle imllrer imllrre imllerr imllerr
imllrer imllrre imlelrr imlelrr imlerlr imlerrl imlerrl imlerlr imlrler imlrlre imlrelr
imlrerl imlrrel imlrrle imllrer imllrre imllerr imllerr imllrer imllrre imlrler imlrlre
imlrelr imlrerl imlrrel imlrrle imlerlr imlerrl imlelrr imlelrr imlerlr imlerrl imlrrel
imlrrle imlrerl imlrelr imlrler imlrlre imellrr imellrr imelrlr imelrrl imelrrl imelrlr
imellrr imellrr imelrlr imelrrl imelrrl imelrlr imerllr imerlrl imerllr imerlrl imerrll
imerrll imerlrl imerllr imerrll imerrll imerlrl imerllr imrller imrllre imrlelr imrlerl
imrlrel imrlrle imrller imrllre imrlelr imrlerl imrlrel imrlrle imrellr imrelrl imrellr
imrelrl imrerll imrerll imrrlel imrrlle imrrell imrrell imrrlel imrrlle irmller irmllre
irmlelr irmlerl irmlrel irmlrle irmller irmllre irmlelr irmlerl irmlrel irmlrle irmellr
irmelrl irmellr irmelrl irmerll irmerll irmrlel irmrlle irmrell irmrell irmrlel irmrlle
irlmler irlmlre irlmelr irlmerl irlmrel irlmrle irllmer irllmre irllemr irllerm irllrem
irllrme irlelmr irlelrm irlemlr irlemrl irlerml irlerlm irlrlem irlrlme irlrelm irlreml
irlrmel irlrmle irllmer irllmre irllemr irllerm irllrem irllrme irlmler irlmlre irlmelr
irlmerl irlmrel irlmrle irlemlr irlemrl irlelmr irlelrm irlerlm irlerml irlrmel irlrmle
irlreml irlrelm irlrlem irlrlme irellmr irellrm irelmlr irelmrl irelrml irelrlm irellmr
irellrm irelmlr irelmrl irelrml irelrlm iremllr iremlrl iremllr iremlrl iremrll iremrll
irerlml irerllm irermll irermll irerlml irerllm irrllem irrllme irrlelm irrleml irrlmel
irrlmle irrllem irrllme irrlelm irrleml irrlmel irrlmle irrellm irrelml irrellm irrelml
irremll irremll irrmlel irrmlle irrmell irrmell irrmlel irrmlle ilrmler ilrmlre ilrmelr
ilrmerl ilrmrel ilrmrle ilrlmer ilrlmre ilrlemr ilrlerm ilrlrem ilrlrme ilrelmr ilrelrm
ilremlr ilremrl ilrerml ilrerlm ilrrlem ilrrlme ilrrelm ilrreml ilrrmel ilrrmle ilmrler
ilmrlre ilmrelr ilmrerl ilmrrel ilmrrle ilmlrer ilmlrre ilmlerr ilmlerr ilmlrer ilmlrre
ilmelrr ilmelrr ilmerlr ilmerrl ilmerrl ilmerlr ilmrler ilmrlre ilmrelr ilmrerl ilmrrel
ilmrrle illmrer illmrre illmerr illmerr illmrer illmrre illrmer illrmre illremr illrerm
illrrem illrrme illermr illerrm illemrr illemrr illermr illerrm illrrem illrrme illrerm
illremr illrmer illrmre ilemlrr ilemlrr ilemrlr ilemrrl ilemrrl ilemrlr ilelmrr ilelmrr
ilelrmr ilelrrm ilelrrm ilelrmr ilerlmr ilerlrm ilermlr ilermrl ilerrml ilerrlm ilerlrm
ilerlmr ilerrlm ilerrml ilermrl ilermlr ilrmler ilrmlre ilrmelr ilrmerl ilrmrel ilrmrle
ilrlmer ilrlmre ilrlemr ilrlerm ilrlrem ilrlrme ilrelmr ilrelrm ilremlr ilremrl ilrerml
ilrerlm ilrrlem ilrrlme ilrrelm ilrreml ilrrmel ilrrmle ilrlmer ilrlmre ilrlemr ilrlerm
ilrlrem ilrlrme ilrmler ilrmlre ilrmelr ilrmerl ilrmrel ilrmrle ilremlr ilremrl ilrelmr
ilrelrm ilrerlm ilrerml ilrrmel ilrrmle ilrreml ilrrelm ilrrlem ilrrlme illrmer illrmre
illremr illrerm illrrem illrrme illmrer illmrre illmerr illmerr illmrer illmrre illemrr
illemrr illermr illerrm illerrm illermr illrmer illrmre illremr illrerm illrrem illrrme
ilmlrer ilmlrre ilmlerr ilmlerr ilmlrer ilmlrre ilmrler ilmrlre ilmrelr ilmrerl ilmrrel
ilmrrle ilmerlr ilmerrl ilmelrr ilmelrr ilmerlr ilmerrl ilmrrel ilmrrle ilmrerl ilmrelr
ilmrler ilmrlre ilelmrr ilelmrr ilelrmr ilelrrm ilelrrm ilelrmr ilemlrr ilemlrr ilemrlr
ilemrrl ilemrrl ilemrlr ilermlr ilermrl ilerlmr ilerlrm ilerrlm ilerrml ilermrl ilermlr
ilerrml ilerrlm ilerlrm ilerlmr ilrlmer ilrlmre ilrlemr ilrlerm ilrlrem ilrlrme ilrmler
ilrmlre ilrmelr ilrmerl ilrmrel ilrmrle ilremlr ilremrl ilrelmr ilrelrm ilrerlm ilrerml
ilrrmel ilrrmle ilrreml ilrrelm ilrrlem ilrrlme ierllmr ierllrm ierlmlr ierlmrl ierlrml
ierlrlm ierllmr ierllrm ierlmlr ierlmrl ierlrml ierlrlm iermllr iermlrl iermllr iermlrl
iermrll iermrll ierrlml ierrllm ierrmll ierrmll ierrlml ierrllm ielrlmr ielrlrm ielrmlr
ielrmrl ielrrml ielrrlm iellrmr iellrrm iellmrr iellmrr iellrmr iellrrm ielmlrr ielmlrr
ielmrlr ielmrrl ielmrrl ielmrlr ielrlmr ielrlrm ielrmlr ielrmrl ielrrml ielrrlm iellrmr
iellrrm iellmrr iellmrr iellrmr iellrrm ielrlmr ielrlrm ielrmlr ielrmrl ielrrml ielrrlm
ielmrlr ielmrrl ielmlrr ielmlrr ielmrlr ielmrrl ielrrml ielrrlm ielrmrl ielrmlr ielrlmr
ielrlrm iemllrr iemllrr iemlrlr iemlrrl iemlrrl iemlrlr iemllrr iemllrr iemlrlr iemlrrl
iemlrrl iemlrlr iemrllr iemrlrl iemrllr iemrlrl iemrrll iemrrll iemrlrl iemrllr iemrrll
iemrrll iemrlrl iemrllr ierllmr ierllrm ierlmlr ierlmrl ierlrml ierlrlm ierllmr ierllrm
ierlmlr ierlmrl ierlrml ierlrlm iermllr iermlrl iermllr iermlrl iermrll iermrll ierrlml
ierrllm ierrmll ierrmll ierrlml ierrllm irrllem irrllme irrlelm irrleml irrlmel irrlmle
irrllem irrllme irrlelm irrleml irrlmel irrlmle irrellm irrelml irrellm irrelml irremll
irremll irrmlel irrmlle irrmell irrmell irrmlel irrmlle irlrlem irlrlme irlrelm irlreml
irlrmel irlrmle irllrem irllrme irllerm irllemr irllmer irllmre irlelrm irlelmr irlerlm
irlerml irlemrl irlemlr irlmler irlmlre irlmelr irlmerl irlmrel irlmrle irllrem irllrme
irllerm irllemr irllmer irllmre irlrlem irlrlme irlrelm irlreml irlrmel irlrmle irlerlm
irlerml irlelrm irlelmr irlemlr irlemrl irlmrel irlmrle irlmerl irlmelr irlmler irlmlre
irellrm irellmr irelrlm irelrml irelmrl irelmlr irellrm irellmr irelrlm irelrml irelmrl
irelmlr irerllm irerlml irerllm irerlml irermll irermll iremlrl iremllr iremrll iremrll
iremlrl iremllr irmller irmllre irmlelr irmlerl irmlrel irmlrle irmller irmllre irmlelr
irmlerl irmlrel irmlrle irmellr irmelrl irmellr irmelrl irmerll irmerll irmrlel irmrlle
irmrell irmrell irmrlel irmrlle lmirler lmirlre lmirelr lmirerl lmirrel lmirrle lmilrer
lmilrre lmilerr lmilerr lmilrer lmilrre lmielrr lmielrr lmierlr lmierrl lmierrl lmierlr
lmirler lmirlre lmirelr lmirerl lmirrel lmirrle lmriler lmrilre lmrielr lmrierl lmrirel
lmrirle lmrlier lmrlire lmrleir lmrleri lmrlrei lmrlrie lmrelir lmrelri lmreilr lmreirl
lmreril lmrerli lmrrlei lmrrlie lmrreli lmrreil lmrriel lmrrile lmlrier lmlrire lmlreir
lmlreri lmlrrei lmlrrie lmlirer lmlirre lmlierr lmlierr lmlirer lmlirre lmleirr lmleirr
lmlerir lmlerri lmlerri lmlerir lmlrier lmlrire lmlreir lmlreri lmlrrei lmlrrie lmerlir
lmerlri lmerilr lmerirl lmerril lmerrli lmelrir lmelrri lmelirr lmelirr lmelrir lmelrri
lmeilrr lmeilrr lmeirlr lmeirrl lmeirrl lmeirlr lmerlir lmerlri lmerilr lmerirl lmerril
lmerrli lmrrlei lmrrlie lmrreli lmrreil lmrriel lmrrile lmrlrei lmrlrie lmrleri lmrleir
lmrlier lmrlire lmrelri lmrelir lmrerli lmreril lmreirl lmreilr lmriler lmrilre lmrielr
lmrierl lmrirel lmrirle limrler limrlre limrelr limrerl limrrel limrrle limlrer limlrre
limlerr limlerr limlrer limlrre limelrr limelrr limerlr limerrl limerrl limerlr limrler
limrlre limrelr limrerl limrrel limrrle lirmler lirmlre lirmelr lirmerl lirmrel lirmrle
lirlmer lirlmre lirlemr lirlerm lirlrem lirlrme lirelmr lirelrm liremlr liremrl lirerml
lirerlm lirrlem lirrlme lirrelm lirreml lirrmel lirrmle lilrmer lilrmre lilremr lilrerm
lilrrem lilrrme lilmrer lilmrre lilmerr lilmerr lilmrer lilmrre lilemrr lilemrr lilermr
lilerrm lilerrm lilermr lilrmer lilrmre lilremr lilrerm lilrrem lilrrme lierlmr lierlrm
liermlr liermrl lierrml lierrlm lielrmr lielrrm lielmrr lielmrr lielrmr lielrrm liemlrr
liemlrr liemrlr liemrrl liemrrl liemrlr lierlmr lierlrm liermlr liermrl lierrml lierrlm
lirrlem lirrlme lirrelm lirreml lirrmel lirrmle lirlrem lirlrme lirlerm lirlemr lirlmer
lirlmre lirelrm lirelmr lirerlm lirerml liremrl liremlr lirmler lirmlre lirmelr lirmerl
lirmrel lirmrle lrimler lrimlre lrimelr lrimerl lrimrel lrimrle lrilmer lrilmre lrilemr
lrilerm lrilrem lrilrme lrielmr lrielrm lriemlr lriemrl lrierml lrierlm lrirlem lrirlme
lrirelm lrireml lrirmel lrirmle lrmiler lrmilre lrmielr lrmierl lrmirel lrmirle lrmlier
lrmlire lrmleir lrmleri lrmlrei lrmlrie lrmelir lrmelri lrmeilr lrmeirl lrmeril lrmerli
lrmrlei lrmrlie lrmreli lrmreil lrmriel lrmrile lrlmier lrlmire lrlmeir lrlmeri lrlmrei
lrlmrie lrlimer lrlimre lrliemr lrlierm lrlirem lrlirme lrleimr lrleirm lrlemir lrlemri
lrlermi lrlerim lrlriem lrlrime lrlreim lrlremi lrlrmei lrlrmie lremlir lremlri lremilr
lremirl lremril lremrli lrelmir lrelmri lrelimr lrelirm lrelrim lrelrmi lreilmr lreilrm
lreimlr lreimrl lreirml lreirlm lrerlim lrerlmi lrerilm lreriml lrermil lrermli lrrmlei
lrrmlie lrrmeli lrrmeil lrrmiel lrrmile lrrlmei lrrlmie lrrlemi lrrleim lrrliem lrrlime
lrrelmi lrrelim lrremli lrremil lrreiml lrreilm lrrilem lrrilme lrrielm lrrieml lrrimel
lrrimle llirmer llirmre lliremr llirerm llirrem llirrme llimrer llimrre llimerr llimerr
llimrer llimrre lliemrr lliemrr lliermr llierrm llierrm lliermr llirmer llirmre lliremr
llirerm llirrem llirrme llrimer llrimre llriemr llrierm llrirem llrirme llrmier llrmire
llrmeir llrmeri llrmrei llrmrie llremir llremri llreimr llreirm llrerim llrermi llrrmei
llrrmie llrremi llrreim llrriem llrrime llmrier llmrire llmreir llmreri llmrrei llmrrie
llmirer llmirre llmierr llmierr llmirer llmirre llmeirr llmeirr llmerir llmerri llmerri
llmerir llmrier llmrire llmreir llmreri llmrrei llmrrie llermir llermri llerimr llerirm
llerrim llerrmi llemrir llemrri llemirr llemirr llemrir llemrri lleimrr lleimrr lleirmr
lleirrm lleirrm lleirmr llermir llermri llerimr llerirm llerrim llerrmi llrrmei llrrmie
llrremi llrreim llrriem llrrime llrmrei llrmrie llrmeri llrmeir llrmier llrmire llremri
llremir llrermi llrerim llreirm llreimr llrimer llrimre llriemr llrierm llrirem llrirme
leirlmr leirlrm leirmlr leirmrl leirrml leirrlm leilrmr leilrrm leilmrr leilmrr leilrmr
leilrrm leimlrr leimlrr leimrlr leimrrl leimrrl leimrlr leirlmr leirlrm leirmlr leirmrl
leirrml leirrlm lerilmr lerilrm lerimlr lerimrl lerirml lerirlm lerlimr lerlirm lerlmir
lerlmri lerlrmi lerlrim lermlir lermlri lermilr lermirl lermril lermrli lerrlmi lerrlim
lerrmli lerrmil lerriml lerrilm lelrimr lelrirm lelrmir lelrmri lelrrmi lelrrim lelirmr
lelirrm lelimrr lelimrr lelirmr lelirrm lelmirr lelmirr lelmrir lelmrri lelmrri lelmrir
lelrimr lelrirm lelrmir lelrmri lelrrmi lelrrim lemrlir lemrlri lemrilr lemrirl lemrril
lemrrli lemlrir lemlrri lemlirr lemlirr lemlrir lemlrri lemilrr lemilrr lemirlr lemirrl
lemirrl lemirlr lemrlir lemrlri lemrilr lemrirl lemrril lemrrli lerrlmi lerrlim lerrmli
lerrmil lerriml lerrilm lerlrmi lerlrim lerlmri lerlmir lerlimr lerlirm lermlri lermlir
lermrli lermril lermirl lermilr lerilmr lerilrm lerimlr lerimrl lerirml lerirlm lrirlem
lrirlme lrirelm lrireml lrirmel lrirmle lrilrem lrilrme lrilerm lrilemr lrilmer lrilmre
lrielrm lrielmr lrierlm lrierml lriemrl lriemlr lrimler lrimlre lrimelr lrimerl lrimrel
lrimrle lrrilem lrrilme lrrielm lrrieml lrrimel lrrimle lrrliem lrrlime lrrleim lrrlemi
lrrlmei lrrlmie lrrelim lrrelmi lrreilm lrreiml lrremil lrremli lrrmlei lrrmlie lrrmeli
lrrmeil lrrmiel lrrmile lrlriem lrlrime lrlreim lrlremi lrlrmei lrlrmie lrlirem lrlirme
lrlierm lrliemr lrlimer lrlimre lrleirm lrleimr lrlerim lrlermi lrlemri lrlemir lrlmier
lrlmire lrlmeir lrlmeri lrlmrei lrlmrie lrerlim lrerlmi lrerilm lreriml lrermil lrermli
lrelrim lrelrmi lrelirm lrelimr lrelmir lrelmri lreilrm lreilmr lreirlm lreirml lreimrl
lreimlr lremlir lremlri lremilr lremirl lremril lremrli lrmrlei lrmrlie lrmreli lrmreil
lrmriel lrmrile lrmlrei lrmlrie lrmleri lrmleir lrmlier lrmlire lrmelri lrmelir lrmerli
lrmeril lrmeirl lrmeilr lrmiler lrmilre lrmielr lrmierl lrmirel lrmirle lmilrer lmilrre
lmilerr lmilerr lmilrer lmilrre lmirler lmirlre lmirelr lmirerl lmirrel lmirrle lmierlr
lmierrl lmielrr lmielrr lmierlr lmierrl lmirrel lmirrle lmirerl lmirelr lmirler lmirlre
lmlirer lmlirre lmlierr lmlierr lmlirer lmlirre lmlrier lmlrire lmlreir lmlreri lmlrrei
lmlrrie lmlerir lmlerri lmleirr lmleirr lmlerir lmlerri lmlrrei lmlrrie lmlreri lmlreir
lmlrier lmlrire lmrlier lmrlire lmrleir lmrleri lmrlrei lmrlrie lmriler lmrilre lmrielr
lmrierl lmrirel lmrirle lmreilr lmreirl lmrelir lmrelri lmrerli lmreril lmrriel lmrrile
lmrreil lmrreli lmrrlei lmrrlie lmelrir lmelrri lmelirr lmelirr lmelrir lmelrri lmerlir
lmerlri lmerilr lmerirl lmerril lmerrli lmeirlr lmeirrl lmeilrr lmeilrr lmeirlr lmeirrl
lmerril lmerrli lmerirl lmerilr lmerlir lmerlri lmrlrei lmrlrie lmrleri lmrleir lmrlier
lmrlire lmrrlei lmrrlie lmrreli lmrreil lmrriel lmrrile lmrerli lmreril lmrelri lmrelir
lmreilr lmreirl lmrirel lmrirle lmrierl lmrielr lmriler lmrilre limlrer limlrre limlerr
limlerr limlrer limlrre limrler limrlre limrelr limrerl limrrel limrrle limerlr limerrl
limelrr limelrr limerlr limerrl limrrel limrrle limrerl limrelr limrler limrlre lilmrer
lilmrre lilmerr lilmerr lilmrer lilmrre lilrmer lilrmre lilremr lilrerm lilrrem lilrrme
lilermr lilerrm lilemrr lilemrr lilermr lilerrm lilrrem lilrrme lilrerm lilremr lilrmer
lilrmre lirlmer lirlmre lirlemr lirlerm lirlrem lirlrme lirmler lirmlre lirmelr lirmerl
lirmrel lirmrle liremlr liremrl lirelmr lirelrm lirerlm lirerml lirrmel lirrmle lirreml
lirrelm lirrlem lirrlme lielrmr lielrrm lielmrr lielmrr lielrmr lielrrm lierlmr lierlrm
liermlr liermrl lierrml lierrlm liemrlr liemrrl liemlrr liemlrr liemrlr liemrrl lierrml
lierrlm liermrl liermlr lierlmr lierlrm lirlrem lirlrme lirlerm lirlemr lirlmer lirlmre
lirrlem lirrlme lirrelm lirreml lirrmel lirrmle lirerlm lirerml lirelrm lirelmr liremlr
liremrl lirmrel lirmrle lirmerl lirmelr lirmler lirmlre llimrer llimrre llimerr llimerr
llimrer llimrre llirmer llirmre lliremr llirerm llirrem llirrme lliermr llierrm lliemrr
lliemrr lliermr llierrm llirrem llirrme llirerm lliremr llirmer llirmre llmirer llmirre
llmierr llmierr llmirer llmirre llmrier llmrire llmreir llmreri llmrrei llmrrie llmerir
llmerri llmeirr llmeirr llmerir llmerri llmrrei llmrrie llmreri llmreir llmrier llmrire
llrmier llrmire llrmeir llrmeri llrmrei llrmrie llrimer llrimre llriemr llrierm llrirem
llrirme llreimr llreirm llremir llremri llrermi llrerim llrriem llrrime llrreim llrremi
llrrmei llrrmie llemrir llemrri llemirr llemirr llemrir llemrri llermir llermri llerimr
llerirm llerrim llerrmi lleirmr lleirrm lleimrr lleimrr lleirmr lleirrm llerrim llerrmi
llerirm llerimr llermir llermri llrmrei llrmrie llrmeri llrmeir llrmier llrmire llrrmei
llrrmie llrremi llrreim llrriem llrrime llrermi llrerim llremri llremir llreimr llreirm
llrirem llrirme llrierm llriemr llrimer llrimre lrilmer lrilmre lrilemr lrilerm lrilrem
lrilrme lrimler lrimlre lrimelr lrimerl lrimrel lrimrle lriemlr lriemrl lrielmr lrielrm
lrierlm lrierml lrirmel lrirmle lrireml lrirelm lrirlem lrirlme lrlimer lrlimre lrliemr
lrlierm lrlirem lrlirme lrlmier lrlmire lrlmeir lrlmeri lrlmrei lrlmrie lrlemir lrlemri
lrleimr lrleirm lrlerim lrlermi lrlrmei lrlrmie lrlremi lrlreim lrlriem lrlrime lrmlier
lrmlire lrmleir lrmleri lrmlrei lrmlrie lrmiler lrmilre lrmielr lrmierl lrmirel lrmirle
lrmeilr lrmeirl lrmelir lrmelri lrmerli lrmeril lrmriel lrmrile lrmreil lrmreli lrmrlei
lrmrlie lrelmir lrelmri lrelimr lrelirm lrelrim lrelrmi lremlir lremlri lremilr lremirl
lremril lremrli lreimlr lreimrl lreilmr lreilrm lreirlm lreirml lrermil lrermli lreriml
lrerilm lrerlim lrerlmi lrrlmei lrrlmie lrrlemi lrrleim lrrliem lrrlime lrrmlei lrrmlie
lrrmeli lrrmeil lrrmiel lrrmile lrremli lrremil lrrelmi lrrelim lrreilm lrreiml lrrimel
lrrimle lrrieml lrrielm lrrilem lrrilme leilrmr leilrrm leilmrr leilmrr leilrmr leilrrm
leirlmr leirlrm leirmlr leirmrl leirrml leirrlm leimrlr leimrrl leimlrr leimlrr leimrlr
leimrrl leirrml leirrlm leirmrl leirmlr leirlmr leirlrm lelirmr lelirrm lelimrr lelimrr
lelirmr lelirrm lelrimr lelrirm lelrmir lelrmri lelrrmi lelrrim lelmrir lelmrri lelmirr
lelmirr lelmrir lelmrri lelrrmi lelrrim lelrmri lelrmir lelrimr lelrirm lerlimr lerlirm
lerlmir lerlmri lerlrmi lerlrim lerilmr lerilrm lerimlr lerimrl lerirml lerirlm lermilr
lermirl lermlir lermlri lermrli lermril lerriml lerrilm lerrmil lerrmli lerrlmi lerrlim
lemlrir lemlrri lemlirr lemlirr lemlrir lemlrri lemrlir lemrlri lemrilr lemrirl lemrril
lemrrli lemirlr lemirrl lemilrr lemilrr lemirlr lemirrl lemrril lemrrli lemrirl lemrilr
lemrlir lemrlri lerlrmi lerlrim lerlmri lerlmir lerlimr lerlirm lerrlmi lerrlim lerrmli
lerrmil lerriml lerrilm lermrli lermril lermlri lermlir lermilr lermirl lerirml lerirlm
lerimrl lerimlr lerilmr lerilrm lrilrem lrilrme lrilerm lrilemr lrilmer lrilmre lrirlem
lrirlme lrirelm lrireml lrirmel lrirmle lrierlm lrierml lrielrm lrielmr lriemlr lriemrl
lrimrel lrimrle lrimerl lrimelr lrimler lrimlre lrlirem lrlirme lrlierm lrliemr lrlimer
lrlimre lrlriem lrlrime lrlreim lrlremi lrlrmei lrlrmie lrlerim lrlermi lrleirm lrleimr
lrlemir lrlemri lrlmrei lrlmrie lrlmeri lrlmeir lrlmier lrlmire lrrliem lrrlime lrrleim
lrrlemi lrrlmei lrrlmie lrrilem lrrilme lrrielm lrrieml lrrimel lrrimle lrreilm lrreiml
lrrelim lrrelmi lrremli lrremil lrrmiel lrrmile lrrmeil lrrmeli lrrmlei lrrmlie lrelrim
lrelrmi lrelirm lrelimr lrelmir lrelmri lrerlim lrerlmi lrerilm lreriml lrermil lrermli
lreirlm lreirml lreilrm lreilmr lreimlr lreimrl lremril lremrli lremirl lremilr lremlir
lremlri lrmlrei lrmlrie lrmleri lrmleir lrmlier lrmlire lrmrlei lrmrlie lrmreli lrmreil
lrmriel lrmrile lrmerli lrmeril lrmelri lrmelir lrmeilr lrmeirl lrmirel lrmirle lrmierl
lrmielr lrmiler lrmilre emillrr emillrr emilrlr emilrrl emilrrl emilrlr emillrr emillrr
emilrlr emilrrl emilrrl emilrlr emirllr emirlrl emirllr emirlrl emirrll emirrll emirlrl
emirllr emirrll emirrll emirlrl emirllr emlilrr emlilrr emlirlr emlirrl emlirrl emlirlr
emllirr emllirr emllrir emllrri emllrri emllrir emlrlir emlrlri emlrilr emlrirl emlrril
emlrrli emlrlri emlrlir emlrrli emlrril emlrirl emlrilr emllirr emllirr emllrir emllrri
emllrri emllrir emlilrr emlilrr emlirlr emlirrl emlirrl emlirlr emlrilr emlrirl emlrlir
emlrlri emlrrli emlrril emlrirl emlrilr emlrril emlrrli emlrlri emlrlir emrllir emrllri
emrlilr emrlirl emrlril emrlrli emrllir emrllri emrlilr emrlirl emrlril emrlrli emrillr
emrilrl emrillr emrilrl emrirll emrirll emrrlil emrrlli emrrill emrrill emrrlil emrrlli
emrllri emrllir emrlrli emrlril emrlirl emrlilr emrllri emrllir emrlrli emrlril emrlirl
emrlilr emrrlli emrrlil emrrlli emrrlil emrrill emrrill emrilrl emrillr emrirll emrirll
emrilrl emrillr eimllrr eimllrr eimlrlr eimlrrl eimlrrl eimlrlr eimllrr eimllrr eimlrlr
eimlrrl eimlrrl eimlrlr eimrllr eimrlrl eimrllr eimrlrl eimrrll eimrrll eimrlrl eimrllr
eimrrll eimrrll eimrlrl eimrllr eilmlrr eilmlrr eilmrlr eilmrrl eilmrrl eilmrlr eillmrr
eillmrr eillrmr eillrrm eillrrm eillrmr eilrlmr eilrlrm eilrmlr eilrmrl eilrrml eilrrlm
eilrlrm eilrlmr eilrrlm eilrrml eilrmrl eilrmlr eillmrr eillmrr eillrmr eillrrm eillrrm
eillrmr eilmlrr eilmlrr eilmrlr eilmrrl eilmrrl eilmrlr eilrmlr eilrmrl eilrlmr eilrlrm
eilrrlm eilrrml eilrmrl eilrmlr eilrrml eilrrlm eilrlrm eilrlmr eirllmr eirllrm eirlmlr
eirlmrl eirlrml eirlrlm eirllmr eirllrm eirlmlr eirlmrl eirlrml eirlrlm eirmllr eirmlrl
eirmllr eirmlrl eirmrll eirmrll eirrlml eirrllm eirrmll eirrmll eirrlml eirrllm eirllrm
eirllmr eirlrlm eirlrml eirlmrl eirlmlr eirllrm eirllmr eirlrlm eirlrml eirlmrl eirlmlr
eirrllm eirrlml eirrllm eirrlml eirrmll eirrmll eirmlrl eirmllr eirmrll eirmrll eirmlrl
eirmllr elimlrr elimlrr elimrlr elimrrl elimrrl elimrlr elilmrr elilmrr elilrmr elilrrm
elilrrm elilrmr elirlmr elirlrm elirmlr elirmrl elirrml elirrlm elirlrm elirlmr elirrlm
elirrml elirmrl elirmlr elmilrr elmilrr elmirlr elmirrl elmirrl elmirlr elmlirr elmlirr
elmlrir elmlrri elmlrri elmlrir elmrlir elmrlri elmrilr elmrirl elmrril elmrrli elmrlri
elmrlir elmrrli elmrril elmrirl elmrilr ellmirr ellmirr ellmrir ellmrri ellmrri ellmrir
ellimrr ellimrr ellirmr ellirrm ellirrm ellirmr ellrimr ellrirm ellrmir ellrmri ellrrmi
ellrrim ellrirm ellrimr ellrrim ellrrmi ellrmri ellrmir elrmlir elrmlri elrmilr elrmirl
elrmril elrmrli elrlmir elrlmri elrlimr elrlirm elrlrim elrlrmi elrilmr elrilrm elrimlr
elrimrl elrirml elrirlm elrrlim elrrlmi elrrilm elrriml elrrmil elrrmli elrmlri elrmlir
elrmrli elrmril elrmirl elrmilr elrlmri elrlmir elrlrmi elrlrim elrlirm elrlimr elrrlmi
elrrlim elrrmli elrrmil elrriml elrrilm elrilrm elrilmr elrirlm elrirml elrimrl elrimlr
elilmrr elilmrr elilrmr elilrrm elilrrm elilrmr elimlrr elimlrr elimrlr elimrrl elimrrl
elimrlr elirmlr elirmrl elirlmr elirlrm elirrlm elirrml elirmrl elirmlr elirrml elirrlm
elirlrm elirlmr ellimrr ellimrr ellirmr ellirrm ellirrm ellirmr ellmirr ellmirr ellmrir
ellmrri ellmrri ellmrir ellrmir ellrmri ellrimr ellrirm ellrrim ellrrmi ellrmri ellrmir
ellrrmi ellrrim ellrirm ellrimr elmlirr elmlirr elmlrir elmlrri elmlrri elmlrir elmilrr
elmilrr elmirlr elmirrl elmirrl elmirlr elmrilr elmrirl elmrlir elmrlri elmrrli elmrril
elmrirl elmrilr elmrril elmrrli elmrlri elmrlir elrlmir elrlmri elrlimr elrlirm elrlrim
elrlrmi elrmlir elrmlri elrmilr elrmirl elrmril elrmrli elrimlr elrimrl elrilmr elrilrm
elrirlm elrirml elrrmil elrrmli elrriml elrrilm elrrlim elrrlmi elrlmri elrlmir elrlrmi
elrlrim elrlirm elrlimr elrmlri elrmlir elrmrli elrmril elrmirl elrmilr elrrmli elrrmil
elrrlmi elrrlim elrrilm elrriml elrimrl elrimlr elrirml elrirlm elrilrm elrilmr erillmr
erillrm erilmlr erilmrl erilrml erilrlm erillmr erillrm erilmlr erilmrl erilrml erilrlm
erimllr erimlrl erimllr erimlrl erimrll erimrll erirlml erirllm erirmll erirmll erirlml
erirllm erlilmr erlilrm erlimlr erlimrl erlirml erlirlm erllimr erllirm erllmir erllmri
erllrmi erllrim erlmlir erlmlri erlmilr erlmirl erlmril erlmrli erlrlmi erlrlim erlrmli
erlrmil erlriml erlrilm erllimr erllirm erllmir erllmri erllrmi erllrim erlilmr erlilrm
erlimlr erlimrl erlirml erlirlm erlmilr erlmirl erlmlir erlmlri erlmrli erlmril erlriml
erlrilm erlrmil erlrmli erlrlmi erlrlim ermllir ermllri ermlilr ermlirl ermlril ermlrli
ermllir ermllri ermlilr ermlirl ermlril ermlrli ermillr ermilrl ermillr ermilrl ermirll
ermirll ermrlil ermrlli ermrill ermrill ermrlil ermrlli errllmi errllim errlmli errlmil
errliml errlilm errllmi errllim errlmli errlmil errliml errlilm errmlli errmlil errmlli
errmlil errmill errmill errilml errillm errimll errimll errilml errillm erillrm erillmr
erilrlm erilrml erilmrl erilmlr erillrm erillmr erilrlm erilrml erilmrl erilmlr erirllm
erirlml erirllm erirlml erirmll erirmll erimlrl erimllr erimrll erimrll erimlrl erimllr
erlilrm erlilmr erlirlm erlirml erlimrl erlimlr erllirm erllimr erllrim erllrmi erllmri
erllmir erlrlim erlrlmi erlrilm erlriml erlrmil erlrmli erlmlri erlmlir erlmrli erlmril
erlmirl erlmilr erllirm erllimr erllrim erllrmi erllmri erllmir erlilrm erlilmr erlirlm
erlirml erlimrl erlimlr erlrilm erlriml erlrlim erlrlmi erlrmli erlrmil erlmirl erlmilr
erlmril erlmrli erlmlri erlmlir errllim errllmi errlilm errliml errlmil errlmli errllim
errllmi errlilm errliml errlmil errlmli errillm errilml errillm errilml errimll errimll
errmlil errmlli errmill errmill errmlil errmlli ermllri ermllir ermlrli ermlril ermlirl
ermlilr ermllri ermllir ermlrli ermlril ermlirl ermlilr ermrlli ermrlil ermrlli ermrlil
ermrill ermrill ermilrl ermillr ermirll ermirll ermilrl ermillr rmiller rmillre rmilelr
rmilerl rmilrel rmilrle rmiller rmillre rmilelr rmilerl rmilrel rmilrle rmiellr rmielrl
rmiellr rmielrl rmierll rmierll rmirlel rmirlle rmirell rmirell rmirlel rmirlle rmliler
rmlilre rmlielr rmlierl rmlirel rmlirle rmllier rmllire rmlleir rmlleri rmllrei rmllrie
rmlelir rmlelri rmleilr rmleirl rmleril rmlerli rmlrlei rmlrlie rmlreli rmlreil rmlriel
rmlrile rmllier rmllire rmlleir rmlleri rmllrei rmllrie rmliler rmlilre rmlielr rmlierl
rmlirel rmlirle rmleilr rmleirl rmlelir rmlelri rmlerli rmleril rmlriel rmlrile rmlreil
rmlreli rmlrlei rmlrlie rmellir rmellri rmelilr rmelirl rmelril rmelrli rmellir rmellri
rmelilr rmelirl rmelril rmelrli rmeillr rmeilrl rmeillr rmeilrl rmeirll rmeirll rmerlil
rmerlli rmerill rmerill rmerlil rmerlli rmrllei rmrllie rmrleli rmrleil rmrliel rmrlile
rmrllei rmrllie rmrleli rmrleil rmrliel rmrlile rmrelli rmrelil rmrelli rmrelil rmreill
rmreill rmrilel rmrille rmriell rmriell rmrilel rmrille rimller rimllre rimlelr rimlerl
rimlrel rimlrle rimller rimllre rimlelr rimlerl rimlrel rimlrle rimellr rimelrl rimellr
rimelrl rimerll rimerll rimrlel rimrlle rimrell rimrell rimrlel rimrlle rilmler rilmlre
rilmelr rilmerl rilmrel rilmrle rillmer rillmre rillemr rillerm rillrem rillrme rilelmr
rilelrm rilemlr rilemrl rilerml rilerlm rilrlem rilrlme rilrelm rilreml rilrmel rilrmle
rillmer rillmre rillemr rillerm rillrem rillrme rilmler rilmlre rilmelr rilmerl rilmrel
rilmrle rilemlr rilemrl rilelmr rilelrm rilerlm rilerml rilrmel rilrmle rilreml rilrelm
rilrlem rilrlme riellmr riellrm rielmlr rielmrl rielrml rielrlm riellmr riellrm rielmlr
rielmrl rielrml rielrlm riemllr riemlrl riemllr riemlrl riemrll riemrll rierlml rierllm
riermll riermll rierlml rierllm rirllem rirllme rirlelm rirleml rirlmel rirlmle rirllem
rirllme rirlelm rirleml rirlmel rirlmle rirellm rirelml rirellm rirelml riremll riremll
rirmlel rirmlle rirmell rirmell rirmlel rirmlle rlimler rlimlre rlimelr rlimerl rlimrel
rlimrle rlilmer rlilmre rlilemr rlilerm rlilrem rlilrme rlielmr rlielrm rliemlr rliemrl
rlierml rlierlm rlirlem rlirlme rlirelm rlireml rlirmel rlirmle rlmiler rlmilre rlmielr
rlmierl rlmirel rlmirle rlmlier rlmlire rlmleir rlmleri rlmlrei rlmlrie rlmelir rlmelri
rlmeilr rlmeirl rlmeril rlmerli rlmrlei rlmrlie rlmreli rlmreil rlmriel rlmrile rllmier
rllmire rllmeir rllmeri rllmrei rllmrie rllimer rllimre rlliemr rllierm rllirem rllirme
rlleimr rlleirm rllemir rllemri rllermi rllerim rllriem rllrime rllreim rllremi rllrmei
rllrmie rlemlir rlemlri rlemilr rlemirl rlemril rlemrli rlelmir rlelmri rlelimr rlelirm
rlelrim rlelrmi rleilmr rleilrm rleimlr rleimrl rleirml rleirlm rlerlim rlerlmi rlerilm
rleriml rlermil rlermli rlrmlei rlrmlie rlrmeli rlrmeil rlrmiel rlrmile rlrlmei rlrlmie
rlrlemi rlrleim rlrliem rlrlime rlrelmi rlrelim rlremli rlremil rlreiml rlreilm rlrilem
rlrilme rlrielm rlrieml rlrimel rlrimle rlilmer rlilmre rlilemr rlilerm rlilrem rlilrme
rlimler rlimlre rlimelr rlimerl rlimrel rlimrle rliemlr rliemrl rlielmr rlielrm rlierlm
rlierml rlirmel rlirmle rlireml rlirelm rlirlem rlirlme rllimer rllimre rlliemr rllierm
rllirem rllirme rllmier rllmire rllmeir rllmeri rllmrei rllmrie rllemir rllemri rlleimr
rlleirm rllerim rllermi rllrmei rllrmie rllremi rllreim rllriem rllrime rlmlier rlmlire
rlmleir rlmleri rlmlrei rlmlrie rlmiler rlmilre rlmielr rlmierl rlmirel rlmirle rlmeilr
rlmeirl rlmelir rlmelri rlmerli rlmeril rlmriel rlmrile rlmreil rlmreli rlmrlei rlmrlie
rlelmir rlelmri rlelimr rlelirm rlelrim rlelrmi rlemlir rlemlri rlemilr rlemirl rlemril
rlemrli rleimlr rleimrl rleilmr rleilrm rleirlm rleirml rlermil rlermli rleriml rlerilm
rlerlim rlerlmi rlrlmei rlrlmie rlrlemi rlrleim rlrliem rlrlime rlrmlei rlrmlie rlrmeli
rlrmeil rlrmiel rlrmile rlremli rlremil rlrelmi rlrelim rlreilm rlreiml rlrimel rlrimle
rlrieml rlrielm rlrilem rlrilme reillmr reillrm reilmlr reilmrl reilrml reilrlm reillmr
reillrm reilmlr reilmrl reilrml reilrlm reimllr reimlrl reimllr reimlrl reimrll reimrll
reirlml reirllm reirmll reirmll reirlml reirllm relilmr relilrm relimlr relimrl relirml
relirlm rellimr rellirm rellmir rellmri rellrmi rellrim relmlir relmlri relmilr relmirl
relmril relmrli relrlmi relrlim relrmli relrmil relriml relrilm rellimr rellirm rellmir
rellmri rellrmi rellrim relilmr relilrm relimlr relimrl relirml relirlm relmilr relmirl
relmlir relmlri relmrli relmril relriml relrilm relrmil relrmli relrlmi relrlim remllir
remllri remlilr remlirl remlril remlrli remllir remllri remlilr remlirl remlril remlrli
remillr remilrl remillr remilrl remirll remirll remrlil remrlli remrill remrill remrlil
remrlli rerllmi rerllim rerlmli rerlmil rerliml rerlilm rerllmi rerllim rerlmli rerlmil
rerliml rerlilm rermlli rermlil rermlli rermlil rermill rermill rerilml rerillm rerimll
rerimll rerilml rerillm rrillem rrillme rrilelm rrileml rrilmel rrilmle rrillem rrillme
rrilelm rrileml rrilmel rrilmle rriellm rrielml rriellm rrielml rriemll rriemll rrimlel
rrimlle rrimell rrimell rrimlel rrimlle rrlilem rrlilme rrlielm rrlieml rrlimel rrlimle
rrlliem rrllime rrlleim rrllemi rrllmei rrllmie rrlelim rrlelmi rrleilm rrleiml rrlemil
rrlemli rrlmlei rrlmlie rrlmeli rrlmeil rrlmiel rrlmile rrlliem rrllime rrlleim rrllemi
rrllmei rrllmie rrlilem rrlilme rrlielm rrlieml rrlimel rrlimle rrleilm rrleiml rrlelim
rrlelmi rrlemli rrlemil rrlmiel rrlmile rrlmeil rrlmeli rrlmlei rrlmlie rrellim rrellmi
rrelilm rreliml rrelmil rrelmli rrellim rrellmi rrelilm rreliml rrelmil rrelmli rreillm
rreilml rreillm rreilml rreimll rreimll rremlil rremlli rremill rremill rremlil rremlli
rrmllei rrmllie rrmleli rrmleil rrmliel rrmlile rrmllei rrmllie rrmleli rrmleil rrmliel
rrmlile rrmelli rrmelil rrmelli rrmelil rrmeill rrmeill rrmilel rrmille rrmiell rrmiell
rrmilel rrmille

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us