easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

traducabor

cucumariidae

diskau

gallupville

sophical

unexpressableness

oblitoque

ryther

taylorsville

eldora

elative

homiliarium

swandown

waxiest

superstring

gratularerisque

butte

antipestilential


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: ribbon
cipher variations:
sjccpo tkddqp uleerq vmffsr wnggts
xohhut ypiivu zqjjwv arkkxw bsllyx
ctmmzy dunnaz evooba fwppcb gxqqdc
hyrred izssfe jattgf kbuuhg lcvvih
mdwwji nexxkj ofyylk pgzzml qhaanm

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: ribbon
Cipher: iryylm

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: ribbon
Cipher: BAAAA ABAAA AAAAB AAAAB ABBAB ABBAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: ribbon
cipher variations:
sjccpoazeeroipggtoqfiivoyvkkxoglmmzowrqqdoehssfo
mxuuhounwwjocdyyloktaanotkddqpbaffspjqhhuprgjjwp
zwllyphmnnapxsrrepfittgpnyvvipvoxxkpdezzmplubbop
uleerqcbggtqkriivqshkkxqaxmmzqinoobqytssfqgjuuhq
ozwwjqwpyylqefaanqmvccpqvmffsrdchhurlsjjwrtillyr
bynnarjoppcrzuttgrhkvvirpaxxkrxqzzmrfgbbornwddqr
wnggtsediivsmtkkxsujmmzsczoobskpqqdsavuuhsilwwjs
qbyylsyraansghccpsoxeersxohhutfejjwtnullytvknnat
dappctlqrretbwvvitjmxxktrczzmtzsbbothiddqtpyffst
ypiivugfkkxuovmmzuwloobuebqqdumrssfucxwwjuknyylu
sdaanuatccpuijeeruqzggtuzqjjwvhgllyvpwnnavxmppcv
fcrrevnsttgvdyxxkvlozzmvtebbovbuddqvjkffsvrahhuv
arkkxwihmmzwqxoobwynqqdwgdssfwotuuhwezyylwmpaanw
ufccpwcveerwklggtwsbiivwbsllyxjinnaxryppcxzorrex
hettgxpuvvixfazzmxnqbboxvgddqxdwffsxlmhhuxtcjjwx
ctmmzykjoobyszqqdyapssfyifuuhyqvwwjygbaanyorccpy
wheeryexggtymniivyudkkxydunnazlkppcztarrezbqttgz
jgvvizrwxxkzhcbbozpsddqzxiffszfyhhuznojjwzvellyz
evoobamlqqdaubssfacruuhakhwwjasxyylaidccpaqteera
yjggtagziivaopkkxawfmmzafwppcbnmrrebvcttgbdsvvib
lixxkbtyzzmbjeddqbruffsbzkhhubhajjwbpqllybxgnnab
gxqqdconssfcwduuhcetwwjcmjyylcuzaanckfeercsvggtc
aliivcibkkxcqrmmzcyhoobchyrredpottgdxevvidfuxxkd
nkzzmdvabbodlgffsdtwhhudbmjjwdjcllydrsnnadzippcd
izssfeqpuuheyfwwjegvyyleolaanewbccpemhggteuxiive
cnkkxekdmmzestoobeajqqdejattgfrqvvifzgxxkfhwzzmf
pmbbofxcddqfnihhufvyjjwfdollyflennaftuppcfbkrref
kbuuhgsrwwjgahyylgixaangqnccpgydeergojiivgwzkkxg
epmmzgmfoobguvqqdgclssfglcvvihtsxxkhbizzmhjybboh
roddqhzeffshpkjjwhxallyhfqnnahngppchvwrrehdmttgh
mdwwjiutyylicjaanikzccpispeeriafggtiqlkkxiybmmzi
groobiohqqdiwxssfienuuhinexxkjvuzzmjdkbbojladdqj
tqffsjbghhujrmllyjzcnnajhsppcjpirrejxyttgjfovvij
ofyylkwvaankelccpkmbeerkurggtkchiivksnmmzkadoobk
itqqdkqjssfkyzuuhkgpwwjkpgzzmlxwbbolfmddqlncffsl
vshhuldijjwltonnalbeppcljurrelrkttglzavvilhqxxkl
qhaanmyxccpmgneermodggtmwtiivmejkkxmupoobmcfqqdm
kvssfmsluuhmabwwjmiryylmribbonzyddqnhoffsnpehhun
xujjwnfkllynvqppcndgrrenlwttgntmvvinbcxxknjszzmn

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: ribbon
Cipher: evooba

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: ribbon
Cipher: 244221214333

Extended Methods:
Method #1

Plaintext: ribbon
method variations:
woggtsbtmmyxgyrrdcmdwwih

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r i b b o n 
2 4 2 2 4 3 
4 2 1 1 3 3 
They are then read out in rows:
242243421133
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: ribbon
Cipher: rgoian

Read more ...
Method #3

Plaintext: ribbon
method variations:
tgfqnh gfqnht fqnhtg
qnhtgf nhtgfq htgfqn

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: ribbon

all 720 cipher variations:
ribbon ribbno ribobn ribonb ribnob ribnbo ribbon ribbno ribobn ribonb ribnob
ribnbo riobbn riobnb riobbn riobnb rionbb rionbb rinbob rinbbo rinobb rinobb
rinbob rinbbo rbibon rbibno rbiobn rbionb rbinob rbinbo rbbion rbbino rbboin
rbboni rbbnoi rbbnio rbobin rbobni rboibn rboinb rbonib rbonbi rbnboi rbnbio
rbnobi rbnoib rbniob rbnibo rbbion rbbino rbboin rbboni rbbnoi rbbnio rbibon
rbibno rbiobn rbionb rbinob rbinbo rboibn rboinb rbobin rbobni rbonbi rbonib
rbniob rbnibo rbnoib rbnobi rbnboi rbnbio robbin robbni robibn robinb robnib
robnbi robbin robbni robibn robinb robnib robnbi roibbn roibnb roibbn roibnb
roinbb roinbb ronbib ronbbi ronibb ronibb ronbib ronbbi rnbboi rnbbio rnbobi
rnboib rnbiob rnbibo rnbboi rnbbio rnbobi rnboib rnbiob rnbibo rnobbi rnobib
rnobbi rnobib rnoibb rnoibb rnibob rnibbo rniobb rniobb rnibob rnibbo irbbon
irbbno irbobn irbonb irbnob irbnbo irbbon irbbno irbobn irbonb irbnob irbnbo
irobbn irobnb irobbn irobnb ironbb ironbb irnbob irnbbo irnobb irnobb irnbob
irnbbo ibrbon ibrbno ibrobn ibronb ibrnob ibrnbo ibbron ibbrno ibborn ibbonr
ibbnor ibbnro ibobrn ibobnr iborbn ibornb ibonrb ibonbr ibnbor ibnbro ibnobr
ibnorb ibnrob ibnrbo ibbron ibbrno ibborn ibbonr ibbnor ibbnro ibrbon ibrbno
ibrobn ibronb ibrnob ibrnbo iborbn ibornb ibobrn ibobnr ibonbr ibonrb ibnrob
ibnrbo ibnorb ibnobr ibnbor ibnbro iobbrn iobbnr iobrbn iobrnb iobnrb iobnbr
iobbrn iobbnr iobrbn iobrnb iobnrb iobnbr iorbbn iorbnb iorbbn iorbnb iornbb
iornbb ionbrb ionbbr ionrbb ionrbb ionbrb ionbbr inbbor inbbro inbobr inborb
inbrob inbrbo inbbor inbbro inbobr inborb inbrob inbrbo inobbr inobrb inobbr
inobrb inorbb inorbb inrbob inrbbo inrobb inrobb inrbob inrbbo birbon birbno
birobn bironb birnob birnbo bibron bibrno biborn bibonr bibnor bibnro biobrn
biobnr biorbn biornb bionrb bionbr binbor binbro binobr binorb binrob binrbo
bribon bribno briobn brionb brinob brinbo brbion brbino brboin brboni brbnoi
brbnio brobin brobni broibn broinb bronib bronbi brnboi brnbio brnobi brnoib
brniob brnibo bbrion bbrino bbroin bbroni bbrnoi bbrnio bbiron bbirno bbiorn
bbionr bbinor bbinro bboirn bboinr bborin bborni bbonri bbonir bbnior bbniro
bbnoir bbnori bbnroi bbnrio borbin borbni boribn borinb bornib bornbi bobrin
bobrni bobirn bobinr bobnir bobnri boibrn boibnr boirbn boirnb boinrb boinbr
bonbir bonbri bonibr bonirb bonrib bonrbi bnrboi bnrbio bnrobi bnroib bnriob
bnribo bnbroi bnbrio bnbori bnboir bnbior bnbiro bnobri bnobir bnorbi bnorib
bnoirb bnoibr bnibor bnibro bniobr bniorb bnirob bnirbo bibron bibrno biborn
bibonr bibnor bibnro birbon birbno birobn bironb birnob birnbo biorbn biornb
biobrn biobnr bionbr bionrb binrob binrbo binorb binobr binbor binbro bbiron
bbirno bbiorn bbionr bbinor bbinro bbrion bbrino bbroin bbroni bbrnoi bbrnio
bborin bborni bboirn bboinr bbonir bbonri bbnroi bbnrio bbnori bbnoir bbnior
bbniro brbion brbino brboin brboni brbnoi brbnio bribon bribno briobn brionb
brinob brinbo broibn broinb brobin brobni bronbi bronib brniob brnibo brnoib
brnobi brnboi brnbio bobrin bobrni bobirn bobinr bobnir bobnri borbin borbni
boribn borinb bornib bornbi boirbn boirnb boibrn boibnr boinbr boinrb bonrib
bonrbi bonirb bonibr bonbir bonbri bnbroi bnbrio bnbori bnboir bnbior bnbiro
bnrboi bnrbio bnrobi bnroib bnriob bnribo bnorbi bnorib bnobri bnobir bnoibr
bnoirb bnirob bnirbo bniorb bniobr bnibor bnibro oibbrn oibbnr oibrbn oibrnb
oibnrb oibnbr oibbrn oibbnr oibrbn oibrnb oibnrb oibnbr oirbbn oirbnb oirbbn
oirbnb oirnbb oirnbb oinbrb oinbbr oinrbb oinrbb oinbrb oinbbr obibrn obibnr
obirbn obirnb obinrb obinbr obbirn obbinr obbrin obbrni obbnri obbnir obrbin
obrbni obribn obrinb obrnib obrnbi obnbri obnbir obnrbi obnrib obnirb obnibr
obbirn obbinr obbrin obbrni obbnri obbnir obibrn obibnr obirbn obirnb obinrb
obinbr obribn obrinb obrbin obrbni obrnbi obrnib obnirb obnibr obnrib obnrbi
obnbri obnbir orbbin orbbni orbibn orbinb orbnib orbnbi orbbin orbbni orbibn
orbinb orbnib orbnbi oribbn oribnb oribbn oribnb orinbb orinbb ornbib ornbbi
ornibb ornibb ornbib ornbbi onbbri onbbir onbrbi onbrib onbirb onbibr onbbri
onbbir onbrbi onbrib onbirb onbibr onrbbi onrbib onrbbi onrbib onribb onribb
onibrb onibbr onirbb onirbb onibrb onibbr nibbor nibbro nibobr niborb nibrob
nibrbo nibbor nibbro nibobr niborb nibrob nibrbo niobbr niobrb niobbr niobrb
niorbb niorbb nirbob nirbbo nirobb nirobb nirbob nirbbo nbibor nbibro nbiobr
nbiorb nbirob nbirbo nbbior nbbiro nbboir nbbori nbbroi nbbrio nbobir nbobri
nboibr nboirb nborib nborbi nbrboi nbrbio nbrobi nbroib nbriob nbribo nbbior
nbbiro nbboir nbbori nbbroi nbbrio nbibor nbibro nbiobr nbiorb nbirob nbirbo
nboibr nboirb nbobir nbobri nborbi nborib nbriob nbribo nbroib nbrobi nbrboi
nbrbio nobbir nobbri nobibr nobirb nobrib nobrbi nobbir nobbri nobibr nobirb
nobrib nobrbi noibbr noibrb noibbr noibrb noirbb noirbb norbib norbbi noribb
noribb norbib norbbi nrbboi nrbbio nrbobi nrboib nrbiob nrbibo nrbboi nrbbio
nrbobi nrboib nrbiob nrbibo nrobbi nrobib nrobbi nrobib nroibb nroibb nribob
nribbo nriobb nriobb nribob nribbo

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us