easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

passovers

agedness

jackknife

nondiabetic

adoptative

inveniaverasque

precipe

microsphaera

swartzendruber

plagiarisms

sverige

agatis

stabilities

candescently

winkingly

heard

transteverine

leningrader


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: revocaremque
cipher variations:
sfwpdbsfnrvf tgxqectgoswg uhyrfduhptxh vizsgeviquyi wjathfwjrvzj
xkbuigxkswak ylcvjhyltxbl zmdwkizmuycm anexljanvzdn bofymkbowaeo
cpgznlcpxbfp dqhaomdqycgq eribpnerzdhr fsjcqofsaeis gtkdrpgtbfjt
hulesqhucgku ivmftrivdhlv jwngusjweimw kxohvtkxfjnx lypiwulygkoy
mzqjxvmzhlpz narkywnaimqa obslzxobjnrb pctmaypckosc qdunbzqdlptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: revocaremque
Cipher: ivelxzivnjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: revocaremque
Cipher: BAAAA AABAA BBBAB ABBAB AAABA AAAAA BAAAA AABAA ABABB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: revocaremque
cipher variations:
sfwpdbsfnrvfanmrhbanlxjnivctlbivjdxvqdsvpbqdhjldylixtbylfpzlgtyzxbgtdvntwjedfbwjzhpjerufjberxndr
mzkhnbmzvtrzuhajrbuhtzfhcpqlvbcprftpkxgnzbkxplhxtgxqectgoswgbonsicbomykojwdumcjwkeywretwqcreikme
zmjyuczmgqamhuzaychuewouxkfegcxkaiqkfsvgkcfsyoesnaliocnawusavibkscviuagidqrmwcdqsguqlyhoaclyqmiy
uhyrfduhptxhcpotjdcpnzlpkxevndkxlfzxsfuxrdsfjlnfankzvdanhrbnivabzdivfxpvylgfhdylbjrlgtwhldgtzpft
obmjpdobxvtbwjcltdwjvbhjersnxderthvrmzipbdmzrnjzvizsgeviquyidqpukedqoamqlyfwoelymgaytgvysetgkmog
bolaweboiscojwbcaejwgyqwzmhgiezmcksmhuximehuaqgupcnkqepcywucxkdmuexkwcikfstoyefsuiwsnajqcenasoka
wjathfwjrvzjerqvlferpbnrmzgxpfmznhbzuhwztfuhlnphcpmbxfcpjtdpkxcdbfkxhzrxanihjfandltnivyjnfivbrhv
qdolrfqdzxvdylenvfylxdjlgtupzfgtvjxtobkrdfobtplbxkbuigxkswakfsrwmgfsqcosnahyqgnaoicavixaugvimoqi
dqncygdqkueqlydecglyiasybojikgboemuojwzkogjwcsiwrepmsgreaywezmfowgzmyekmhuvqaghuwkyupclsegpcuqmc
ylcvjhyltxblgtsxnhgtrdptobizrhobpjdbwjybvhwjnprjerodzherlvfrmzefdhmzjbtzcpkjlhcpfnvpkxalphkxdtjx
sfqnthsfbzxfangpxhanzflnivwrbhivxlzvqdmtfhqdvrndzmdwkizmuycmhutyoihusequpcjasipcqkecxkzcwixkoqsk
fspeaifsmwgsnafgeinakcuadqlkmidqgowqlybmqilyeukytgrouitgcaygbohqyiboagmojwxscijwymawrenugirewsoe
anexljanvzdnivuzpjivtfrvqdkbtjqdrlfdyladxjylprtlgtqfbjgtnxhtobghfjobldvbermlnjerhpxrmzcnrjmzfvlz
uhspvjuhdbzhcpirzjcpbhnpkxytdjkxznbxsfovhjsfxtpfbofymkbowaeojwvaqkjwugswrelcukresmgezmbeykzmqsum
hurgckhuoyiupchigkpcmewcfsnmokfsiqysnadosknagwmavitqwkviecaidqjsakdqcioqlyzueklyaocytgpwiktgyuqg
cpgznlcpxbfpkxwbrlkxvhtxsfmdvlsftnhfancfzlanrtvnivshdlivpzjvqdijhlqdnfxdgtonplgtjrztobeptlobhxnb
wjurxlwjfdbjerktblerdjprmzavflmzbpdzuhqxjluhzvrhdqhaomdqycgqlyxcsmlywiuytgnewmtguoigbodgambosuwo
jwtiemjwqakwrejkimreogyehupoqmhuksaupcfqumpciyocxkvsymxkgeckfslucmfsekqsnabwgmnacqeavirykmviawsi
eribpnerzdhrmzydtnmzxjvzuhofxnuhvpjhcpehbncptvxpkxujfnkxrblxsfkljnsfphzfivqprnivltbvqdgrvnqdjzpd
ylwtznylhfdlgtmvdngtflrtobcxhnobdrfbwjszlnwjbxtjfsjcqofsaeisnazeuonaykwavipgyoviwqkidqficodquwyq
lyvkgolyscmytglmkotgqiagjwrqsojwmucwrehsworekaqezmxuaozmigemhunweohugmsupcdyiopcesgcxktamoxkcyuk
gtkdrpgtbfjtobafvpobzlxbwjqhzpwjxrljergjdpervxzrmzwlhpmztdnzuhmnlpuhrjbhkxsrtpkxnvdxsfitxpsflbrf
anyvbpanjhfnivoxfpivhntvqdezjpqdfthdylubnpyldzvlhulesqhucgkupcbgwqpcamycxkriaqxkysmkfshkeqfswyas
naxmiqnaueoavinomqviskcilytsuqlyoweytgjuyqtgmcsgbozwcqbokigojwpygqjwiouwrefakqreguiezmvcoqzmeawm
ivmftrivdhlvqdchxrqdbnzdylsjbrylztnlgtilfrgtxzbtobynjrobvfpbwjopnrwjtldjmzutvrmzpxfzuhkvzruhndth
cpaxdrcpljhpkxqzhrkxjpvxsfgblrsfhvjfanwdpranfbxnjwngusjweimwrediysrecoaezmtkcszmauomhujmgshuyacu
pczokspcwgqcxkpqosxkumeknavuwsnaqygavilwasvioeuidqbyesdqmkiqlyraislykqwytghcmstgiwkgboxeqsbogcyo
kxohvtkxfjnxsfejztsfdpbfanuldtanbvpnivknhtivzbdvqdapltqdxhrdylqrptylvnflobwvxtobrzhbwjmxbtwjpfvj
erczfternljrmzsbjtmzlrxzuhidntuhjxlhcpyfrtcphdzplypiwulygkoytgfkautgeqcgbovmeubocwqojwloiujwacew
rebqmureyisezmrsquzmwogmpcxwyupcsaicxknycuxkqgwkfsdagufsomksnatckunamsyavijeouvikymidqzgsudqieaq
mzqjxvmzhlpzuhglbvuhfrdhcpwnfvcpdxrpkxmpjvkxbdfxsfcrnvsfzjtfanstrvanxphnqdyxzvqdtbjdylozdvylrhxl
gtebhvgtpnltobudlvobntzbwjkfpvwjlznjerahtverjfbrnarkywnaimqavihmcwvigseidqxogwdqeysqlynqkwlycegy
tgdsowtgakugbotuswboyqiorezyawreuckezmpaewzmsiymhufciwhuqomupcvemwpcouacxklgqwxkmaokfsbiuwfskgcs
obslzxobjnrbwjindxwjhtfjeryphxerfztrmzorlxmzdfhzuhetpxuhblvhcpuvtxcpzrjpsfazbxsfvdlfanqbfxantjzn
ivgdjxivrpnvqdwfnxqdpvbdylmhrxylnbplgtcjvxgtlhdtpctmaypckoscxkjoeyxkiugkfszqiyfsgausnapsmynaegia
vifuqyvicmwidqvwuydqaskqtgbacytgwemgborcgyboukaojwhekyjwsqowrexgoyreqwcezmnisyzmocqmhudkwyhumieu
qdunbzqdlptdylkpfzyljvhlgtarjzgthbvtobqtnzobfhjbwjgvrzwjdnxjerwxvzerbtlruhcbdzuhxfnhcpsdhzcpvlbp
kxiflzkxtrpxsfyhpzsfrxdfanojtzanpdrnivelxzivnjfvrevocaremquezmlqgazmkwimhubskahuicwupcruoapcgikc
xkhwsaxkeoykfsxywafscumsvidceaviygoidqteiadqwmcqlyjgmalyusqytgziqatgsyegbopkuaboqesojwfmyajwokgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: revocaremque
Cipher: eribpnerzdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: revocaremque
Cipher: 245115433111245123145451

Extended Methods:
Method #1

Plaintext: revocaremque
method variations:
wkathfwkrvzkbpfynlbpwaepguldsqgubfkumzqixvmzglpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r e v o c a r e m q u e 
2 5 1 4 3 1 2 5 2 1 5 5 
4 1 5 3 1 1 4 1 3 4 4 1 
They are then read out in rows:
251431252155415311413441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: revocaremque
Cipher: wqcwbzdpadsd

Read more ...
Method #3

Plaintext: revocaremque
method variations:
yaunafyfcyyf aunafyfcyyfy unafyfcyyfya
nafyfcyyfyau afyfcyyfyaun fyfcyyfyauna
yfcyyfyaunaf fcyyfyaunafy cyyfyaunafyf
yyfyaunafyfc yfyaunafyfcy fyaunafyfcyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: revocaremque

first 5040 cipher variations(475687488 total)
revocaremque revocaremqeu revocaremuqe revocaremueq revocaremeuq revocaremequ revocareqmue revocareqmeu revocarequme
revocarequem revocareqeum revocareqemu revocareuqme revocareuqem revocareumqe revocareumeq revocareuemq revocareueqm
revocareequm revocareeqmu revocareeuqm revocareeumq revocareemuq revocareemqu revocarmeque revocarmeqeu revocarmeuqe
revocarmeueq revocarmeeuq revocarmeequ revocarmqeue revocarmqeeu revocarmquee revocarmquee revocarmqeue revocarmqeeu
revocarmuqee revocarmuqee revocarmueqe revocarmueeq revocarmueeq revocarmueqe revocarmeque revocarmeqeu revocarmeuqe
revocarmeueq revocarmeeuq revocarmeequ revocarqmeue revocarqmeeu revocarqmuee revocarqmuee revocarqmeue revocarqmeeu
revocarqemue revocarqemeu revocarqeume revocarqeuem revocarqeeum revocarqeemu revocarqueme revocarqueem revocarqumee
revocarqumee revocarqueme revocarqueem revocarqeeum revocarqeemu revocarqeuem revocarqeume revocarqemue revocarqemeu
revocarumqee revocarumqee revocarumeqe revocarumeeq revocarumeeq revocarumeqe revocaruqmee revocaruqmee revocaruqeme
revocaruqeem revocaruqeem revocaruqeme revocarueqme revocarueqem revocaruemqe revocaruemeq revocarueemq revocarueeqm
revocarueqem revocarueqme revocarueeqm revocarueemq revocaruemeq revocaruemqe revocaremque revocaremqeu revocaremuqe
revocaremueq revocaremeuq revocaremequ revocareqmue revocareqmeu revocarequme revocarequem revocareqeum revocareqemu
revocareuqme revocareuqem revocareumqe revocareumeq revocareuemq revocareueqm revocareequm revocareeqmu revocareeuqm
revocareeumq revocareemuq revocareemqu revocaermque revocaermqeu revocaermuqe revocaermueq revocaermeuq revocaermequ
revocaerqmue revocaerqmeu revocaerqume revocaerquem revocaerqeum revocaerqemu revocaeruqme revocaeruqem revocaerumqe
revocaerumeq revocaeruemq revocaerueqm revocaerequm revocaereqmu revocaereuqm revocaereumq revocaeremuq revocaeremqu
revocaemrque revocaemrqeu revocaemruqe revocaemrueq revocaemreuq revocaemrequ revocaemqrue revocaemqreu revocaemqure
revocaemquer revocaemqeur revocaemqeru revocaemuqre revocaemuqer revocaemurqe revocaemureq revocaemuerq revocaemueqr
revocaemequr revocaemeqru revocaemeuqr revocaemeurq revocaemeruq revocaemerqu revocaeqmrue revocaeqmreu revocaeqmure
revocaeqmuer revocaeqmeur revocaeqmeru revocaeqrmue revocaeqrmeu revocaeqrume revocaeqruem revocaeqreum revocaeqremu
revocaequrme revocaequrem revocaequmre revocaequmer revocaequemr revocaequerm revocaeqerum revocaeqermu revocaeqeurm
revocaeqeumr revocaeqemur revocaeqemru revocaeumqre revocaeumqer revocaeumrqe revocaeumreq revocaeumerq revocaeumeqr
revocaeuqmre revocaeuqmer revocaeuqrme revocaeuqrem revocaeuqerm revocaeuqemr revocaeurqme revocaeurqem revocaeurmqe
revocaeurmeq revocaeuremq revocaeureqm revocaeueqrm revocaeueqmr revocaeuerqm revocaeuermq revocaeuemrq revocaeuemqr
revocaeemqur revocaeemqru revocaeemuqr revocaeemurq revocaeemruq revocaeemrqu revocaeeqmur revocaeeqmru revocaeequmr
revocaeequrm revocaeeqrum revocaeeqrmu revocaeeuqmr revocaeeuqrm revocaeeumqr revocaeeumrq revocaeeurmq revocaeeurqm
revocaeerqum revocaeerqmu revocaeeruqm revocaeerumq revocaeermuq revocaeermqu revocamerque revocamerqeu revocameruqe
revocamerueq revocamereuq revocamerequ revocameqrue revocameqreu revocamequre revocamequer revocameqeur revocameqeru
revocameuqre revocameuqer revocameurqe revocameureq revocameuerq revocameueqr revocameequr revocameeqru revocameeuqr
revocameeurq revocameeruq revocameerqu revocamreque revocamreqeu revocamreuqe revocamreueq revocamreeuq revocamreequ
revocamrqeue revocamrqeeu revocamrquee revocamrquee revocamrqeue revocamrqeeu revocamruqee revocamruqee revocamrueqe
revocamrueeq revocamrueeq revocamrueqe revocamreque revocamreqeu revocamreuqe revocamreueq revocamreeuq revocamreequ
revocamqreue revocamqreeu revocamqruee revocamqruee revocamqreue revocamqreeu revocamqerue revocamqereu revocamqeure
revocamqeuer revocamqeeur revocamqeeru revocamquere revocamqueer revocamquree revocamquree revocamquere revocamqueer
revocamqeeur revocamqeeru revocamqeuer revocamqeure revocamqerue revocamqereu revocamurqee revocamurqee revocamureqe
revocamureeq revocamureeq revocamureqe revocamuqree revocamuqree revocamuqere revocamuqeer revocamuqeer revocamuqere
revocamueqre revocamueqer revocamuerqe revocamuereq revocamueerq revocamueeqr revocamueqer revocamueqre revocamueeqr
revocamueerq revocamuereq revocamuerqe revocamerque revocamerqeu revocameruqe revocamerueq revocamereuq revocamerequ
revocameqrue revocameqreu revocamequre revocamequer revocameqeur revocameqeru revocameuqre revocameuqer revocameurqe
revocameureq revocameuerq revocameueqr revocameequr revocameeqru revocameeuqr revocameeurq revocameeruq revocameerqu
revocaqemrue revocaqemreu revocaqemure revocaqemuer revocaqemeur revocaqemeru revocaqermue revocaqermeu revocaqerume
revocaqeruem revocaqereum revocaqeremu revocaqeurme revocaqeurem revocaqeumre revocaqeumer revocaqeuemr revocaqeuerm
revocaqeerum revocaqeermu revocaqeeurm revocaqeeumr revocaqeemur revocaqeemru revocaqmerue revocaqmereu revocaqmeure
revocaqmeuer revocaqmeeur revocaqmeeru revocaqmreue revocaqmreeu revocaqmruee revocaqmruee revocaqmreue revocaqmreeu
revocaqmuree revocaqmuree revocaqmuere revocaqmueer revocaqmueer revocaqmuere revocaqmerue revocaqmereu revocaqmeure
revocaqmeuer revocaqmeeur revocaqmeeru revocaqrmeue revocaqrmeeu revocaqrmuee revocaqrmuee revocaqrmeue revocaqrmeeu
revocaqremue revocaqremeu revocaqreume revocaqreuem revocaqreeum revocaqreemu revocaqrueme revocaqrueem revocaqrumee
revocaqrumee revocaqrueme revocaqrueem revocaqreeum revocaqreemu revocaqreuem revocaqreume revocaqremue revocaqremeu
revocaqumree revocaqumree revocaqumere revocaqumeer revocaqumeer revocaqumere revocaqurmee revocaqurmee revocaqureme
revocaqureem revocaqureem revocaqureme revocaquerme revocaquerem revocaquemre revocaquemer revocaqueemr revocaqueerm
revocaquerem revocaquerme revocaqueerm revocaqueemr revocaquemer revocaquemre revocaqemrue revocaqemreu revocaqemure
revocaqemuer revocaqemeur revocaqemeru revocaqermue revocaqermeu revocaqerume revocaqeruem revocaqereum revocaqeremu
revocaqeurme revocaqeurem revocaqeumre revocaqeumer revocaqeuemr revocaqeuerm revocaqeerum revocaqeermu revocaqeeurm
revocaqeeumr revocaqeemur revocaqeemru revocauemqre revocauemqer revocauemrqe revocauemreq revocauemerq revocauemeqr
revocaueqmre revocaueqmer revocaueqrme revocaueqrem revocaueqerm revocaueqemr revocauerqme revocauerqem revocauermqe
revocauermeq revocaueremq revocauereqm revocaueeqrm revocaueeqmr revocaueerqm revocaueermq revocaueemrq revocaueemqr
revocaumeqre revocaumeqer revocaumerqe revocaumereq revocaumeerq revocaumeeqr revocaumqere revocaumqeer revocaumqree
revocaumqree revocaumqere revocaumqeer revocaumrqee revocaumrqee revocaumreqe revocaumreeq revocaumreeq revocaumreqe
revocaumeqre revocaumeqer revocaumerqe revocaumereq revocaumeerq revocaumeeqr revocauqmere revocauqmeer revocauqmree
revocauqmree revocauqmere revocauqmeer revocauqemre revocauqemer revocauqerme revocauqerem revocauqeerm revocauqeemr
revocauqreme revocauqreem revocauqrmee revocauqrmee revocauqreme revocauqreem revocauqeerm revocauqeemr revocauqerem
revocauqerme revocauqemre revocauqemer revocaurmqee revocaurmqee revocaurmeqe revocaurmeeq revocaurmeeq revocaurmeqe
revocaurqmee revocaurqmee revocaurqeme revocaurqeem revocaurqeem revocaurqeme revocaureqme revocaureqem revocauremqe
revocauremeq revocaureemq revocaureeqm revocaureqem revocaureqme revocaureeqm revocaureemq revocauremeq revocauremqe
revocauemqre revocauemqer revocauemrqe revocauemreq revocauemerq revocauemeqr revocaueqmre revocaueqmer revocaueqrme
revocaueqrem revocaueqerm revocaueqemr revocauerqme revocauerqem revocauermqe revocauermeq revocaueremq revocauereqm
revocaueeqrm revocaueeqmr revocaueerqm revocaueermq revocaueemrq revocaueemqr revocaeemqur revocaeemqru revocaeemuqr
revocaeemurq revocaeemruq revocaeemrqu revocaeeqmur revocaeeqmru revocaeequmr revocaeequrm revocaeeqrum revocaeeqrmu
revocaeeuqmr revocaeeuqrm revocaeeumqr revocaeeumrq revocaeeurmq revocaeeurqm revocaeerqum revocaeerqmu revocaeeruqm
revocaeerumq revocaeermuq revocaeermqu revocaemequr revocaemeqru revocaemeuqr revocaemeurq revocaemeruq revocaemerqu
revocaemqeur revocaemqeru revocaemquer revocaemqure revocaemqrue revocaemqreu revocaemuqer revocaemuqre revocaemueqr
revocaemuerq revocaemureq revocaemurqe revocaemrque revocaemrqeu revocaemruqe revocaemrueq revocaemreuq revocaemrequ
revocaeqmeur revocaeqmeru revocaeqmuer revocaeqmure revocaeqmrue revocaeqmreu revocaeqemur revocaeqemru revocaeqeumr
revocaeqeurm revocaeqerum revocaeqermu revocaequemr revocaequerm revocaequmer revocaequmre revocaequrme revocaequrem
revocaeqreum revocaeqremu revocaeqruem revocaeqrume revocaeqrmue revocaeqrmeu revocaeumqer revocaeumqre revocaeumeqr
revocaeumerq revocaeumreq revocaeumrqe revocaeuqmer revocaeuqmre revocaeuqemr revocaeuqerm revocaeuqrem revocaeuqrme
revocaeueqmr revocaeueqrm revocaeuemqr revocaeuemrq revocaeuermq revocaeuerqm revocaeurqem revocaeurqme revocaeureqm
revocaeuremq revocaeurmeq revocaeurmqe revocaermque revocaermqeu revocaermuqe revocaermueq revocaermeuq revocaermequ
revocaerqmue revocaerqmeu revocaerqume revocaerquem revocaerqeum revocaerqemu revocaeruqme revocaeruqem revocaerumqe
revocaerumeq revocaeruemq revocaerueqm revocaerequm revocaereqmu revocaereuqm revocaereumq revocaeremuq revocaeremqu
revocraemque revocraemqeu revocraemuqe revocraemueq revocraemeuq revocraemequ revocraeqmue revocraeqmeu revocraequme
revocraequem revocraeqeum revocraeqemu revocraeuqme revocraeuqem revocraeumqe revocraeumeq revocraeuemq revocraeueqm
revocraeequm revocraeeqmu revocraeeuqm revocraeeumq revocraeemuq revocraeemqu revocrameque revocrameqeu revocrameuqe
revocrameueq revocrameeuq revocrameequ revocramqeue revocramqeeu revocramquee revocramquee revocramqeue revocramqeeu
revocramuqee revocramuqee revocramueqe revocramueeq revocramueeq revocramueqe revocrameque revocrameqeu revocrameuqe
revocrameueq revocrameeuq revocrameequ revocraqmeue revocraqmeeu revocraqmuee revocraqmuee revocraqmeue revocraqmeeu
revocraqemue revocraqemeu revocraqeume revocraqeuem revocraqeeum revocraqeemu revocraqueme revocraqueem revocraqumee
revocraqumee revocraqueme revocraqueem revocraqeeum revocraqeemu revocraqeuem revocraqeume revocraqemue revocraqemeu
revocraumqee revocraumqee revocraumeqe revocraumeeq revocraumeeq revocraumeqe revocrauqmee revocrauqmee revocrauqeme
revocrauqeem revocrauqeem revocrauqeme revocraueqme revocraueqem revocrauemqe revocrauemeq revocraueemq revocraueeqm
revocraueqem revocraueqme revocraueeqm revocraueemq revocrauemeq revocrauemqe revocraemque revocraemqeu revocraemuqe
revocraemueq revocraemeuq revocraemequ revocraeqmue revocraeqmeu revocraequme revocraequem revocraeqeum revocraeqemu
revocraeuqme revocraeuqem revocraeumqe revocraeumeq revocraeuemq revocraeueqm revocraeequm revocraeeqmu revocraeeuqm
revocraeeumq revocraeemuq revocraeemqu revocreamque revocreamqeu revocreamuqe revocreamueq revocreameuq revocreamequ
revocreaqmue revocreaqmeu revocreaqume revocreaquem revocreaqeum revocreaqemu revocreauqme revocreauqem revocreaumqe
revocreaumeq revocreauemq revocreaueqm revocreaequm revocreaeqmu revocreaeuqm revocreaeumq revocreaemuq revocreaemqu
revocremaque revocremaqeu revocremauqe revocremaueq revocremaeuq revocremaequ revocremqaue revocremqaeu revocremquae
revocremquea revocremqeua revocremqeau revocremuqae revocremuqea revocremuaqe revocremuaeq revocremueaq revocremueqa
revocremequa revocremeqau revocremeuqa revocremeuaq revocremeauq revocremeaqu revocreqmaue revocreqmaeu revocreqmuae
revocreqmuea revocreqmeua revocreqmeau revocreqamue revocreqameu revocreqaume revocreqauem revocreqaeum revocreqaemu
revocrequame revocrequaem revocrequmae revocrequmea revocrequema revocrequeam revocreqeaum revocreqeamu revocreqeuam
revocreqeuma revocreqemua revocreqemau revocreumqae revocreumqea revocreumaqe revocreumaeq revocreumeaq revocreumeqa
revocreuqmae revocreuqmea revocreuqame revocreuqaem revocreuqeam revocreuqema revocreuaqme revocreuaqem revocreuamqe
revocreuameq revocreuaemq revocreuaeqm revocreueqam revocreueqma revocreueaqm revocreueamq revocreuemaq revocreuemqa
revocreemqua revocreemqau revocreemuqa revocreemuaq revocreemauq revocreemaqu revocreeqmua revocreeqmau revocreequma
revocreequam revocreeqaum revocreeqamu revocreeuqma revocreeuqam revocreeumqa revocreeumaq revocreeuamq revocreeuaqm
revocreeaqum revocreeaqmu revocreeauqm revocreeaumq revocreeamuq revocreeamqu revocrmeaque revocrmeaqeu revocrmeauqe
revocrmeaueq revocrmeaeuq revocrmeaequ revocrmeqaue revocrmeqaeu revocrmequae revocrmequea revocrmeqeua revocrmeqeau
revocrmeuqae revocrmeuqea revocrmeuaqe revocrmeuaeq revocrmeueaq revocrmeueqa revocrmeequa revocrmeeqau revocrmeeuqa
revocrmeeuaq revocrmeeauq revocrmeeaqu revocrmaeque revocrmaeqeu revocrmaeuqe revocrmaeueq revocrmaeeuq revocrmaeequ
revocrmaqeue revocrmaqeeu revocrmaquee revocrmaquee revocrmaqeue revocrmaqeeu revocrmauqee revocrmauqee revocrmaueqe
revocrmaueeq revocrmaueeq revocrmaueqe revocrmaeque revocrmaeqeu revocrmaeuqe revocrmaeueq revocrmaeeuq revocrmaeequ
revocrmqaeue revocrmqaeeu revocrmqauee revocrmqauee revocrmqaeue revocrmqaeeu revocrmqeaue revocrmqeaeu revocrmqeuae
revocrmqeuea revocrmqeeua revocrmqeeau revocrmqueae revocrmqueea revocrmquaee revocrmquaee revocrmqueae revocrmqueea
revocrmqeeua revocrmqeeau revocrmqeuea revocrmqeuae revocrmqeaue revocrmqeaeu revocrmuaqee revocrmuaqee revocrmuaeqe
revocrmuaeeq revocrmuaeeq revocrmuaeqe revocrmuqaee revocrmuqaee revocrmuqeae revocrmuqeea revocrmuqeea revocrmuqeae
revocrmueqae revocrmueqea revocrmueaqe revocrmueaeq revocrmueeaq revocrmueeqa revocrmueqea revocrmueqae revocrmueeqa
revocrmueeaq revocrmueaeq revocrmueaqe revocrmeaque revocrmeaqeu revocrmeauqe revocrmeaueq revocrmeaeuq revocrmeaequ
revocrmeqaue revocrmeqaeu revocrmequae revocrmequea revocrmeqeua revocrmeqeau revocrmeuqae revocrmeuqea revocrmeuaqe
revocrmeuaeq revocrmeueaq revocrmeueqa revocrmeequa revocrmeeqau revocrmeeuqa revocrmeeuaq revocrmeeauq revocrmeeaqu
revocrqemaue revocrqemaeu revocrqemuae revocrqemuea revocrqemeua revocrqemeau revocrqeamue revocrqeameu revocrqeaume
revocrqeauem revocrqeaeum revocrqeaemu revocrqeuame revocrqeuaem revocrqeumae revocrqeumea revocrqeuema revocrqeueam
revocrqeeaum revocrqeeamu revocrqeeuam revocrqeeuma revocrqeemua revocrqeemau revocrqmeaue revocrqmeaeu revocrqmeuae
revocrqmeuea revocrqmeeua revocrqmeeau revocrqmaeue revocrqmaeeu revocrqmauee revocrqmauee revocrqmaeue revocrqmaeeu
revocrqmuaee revocrqmuaee revocrqmueae revocrqmueea revocrqmueea revocrqmueae revocrqmeaue revocrqmeaeu revocrqmeuae
revocrqmeuea revocrqmeeua revocrqmeeau revocrqameue revocrqameeu revocrqamuee revocrqamuee revocrqameue revocrqameeu
revocrqaemue revocrqaemeu revocrqaeume revocrqaeuem revocrqaeeum revocrqaeemu revocrqaueme revocrqaueem revocrqaumee
revocrqaumee revocrqaueme revocrqaueem revocrqaeeum revocrqaeemu revocrqaeuem revocrqaeume revocrqaemue revocrqaemeu
revocrqumaee revocrqumaee revocrqumeae revocrqumeea revocrqumeea revocrqumeae revocrquamee revocrquamee revocrquaeme
revocrquaeem revocrquaeem revocrquaeme revocrqueame revocrqueaem revocrquemae revocrquemea revocrqueema revocrqueeam
revocrqueaem revocrqueame revocrqueeam revocrqueema revocrquemea revocrquemae revocrqemaue revocrqemaeu revocrqemuae
revocrqemuea revocrqemeua revocrqemeau revocrqeamue revocrqeameu revocrqeaume revocrqeauem revocrqeaeum revocrqeaemu
revocrqeuame revocrqeuaem revocrqeumae revocrqeumea revocrqeuema revocrqeueam revocrqeeaum revocrqeeamu revocrqeeuam
revocrqeeuma revocrqeemua revocrqeemau revocruemqae revocruemqea revocruemaqe revocruemaeq revocruemeaq revocruemeqa
revocrueqmae revocrueqmea revocrueqame revocrueqaem revocrueqeam revocrueqema revocrueaqme revocrueaqem revocrueamqe
revocrueameq revocrueaemq revocrueaeqm revocrueeqam revocrueeqma revocrueeaqm revocrueeamq revocrueemaq revocrueemqa
revocrumeqae revocrumeqea revocrumeaqe revocrumeaeq revocrumeeaq revocrumeeqa revocrumqeae revocrumqeea revocrumqaee
revocrumqaee revocrumqeae revocrumqeea revocrumaqee revocrumaqee revocrumaeqe revocrumaeeq revocrumaeeq revocrumaeqe
revocrumeqae revocrumeqea revocrumeaqe revocrumeaeq revocrumeeaq revocrumeeqa revocruqmeae revocruqmeea revocruqmaee
revocruqmaee revocruqmeae revocruqmeea revocruqemae revocruqemea revocruqeame revocruqeaem revocruqeeam revocruqeema
revocruqaeme revocruqaeem revocruqamee revocruqamee revocruqaeme revocruqaeem revocruqeeam revocruqeema revocruqeaem
revocruqeame revocruqemae revocruqemea revocruamqee revocruamqee revocruameqe revocruameeq revocruameeq revocruameqe
revocruaqmee revocruaqmee revocruaqeme revocruaqeem revocruaqeem revocruaqeme revocruaeqme revocruaeqem revocruaemqe
revocruaemeq revocruaeemq revocruaeeqm revocruaeqem revocruaeqme revocruaeeqm revocruaeemq revocruaemeq revocruaemqe
revocruemqae revocruemqea revocruemaqe revocruemaeq revocruemeaq revocruemeqa revocrueqmae revocrueqmea revocrueqame
revocrueqaem revocrueqeam revocrueqema revocrueaqme revocrueaqem revocrueamqe revocrueameq revocrueaemq revocrueaeqm
revocrueeqam revocrueeqma revocrueeaqm revocrueeamq revocrueemaq revocrueemqa revocreemqua revocreemqau revocreemuqa
revocreemuaq revocreemauq revocreemaqu revocreeqmua revocreeqmau revocreequma revocreequam revocreeqaum revocreeqamu
revocreeuqma revocreeuqam revocreeumqa revocreeumaq revocreeuamq revocreeuaqm revocreeaqum revocreeaqmu revocreeauqm
revocreeaumq revocreeamuq revocreeamqu revocremequa revocremeqau revocremeuqa revocremeuaq revocremeauq revocremeaqu
revocremqeua revocremqeau revocremquea revocremquae revocremqaue revocremqaeu revocremuqea revocremuqae revocremueqa
revocremueaq revocremuaeq revocremuaqe revocremaque revocremaqeu revocremauqe revocremaueq revocremaeuq revocremaequ
revocreqmeua revocreqmeau revocreqmuea revocreqmuae revocreqmaue revocreqmaeu revocreqemua revocreqemau revocreqeuma
revocreqeuam revocreqeaum revocreqeamu revocrequema revocrequeam revocrequmea revocrequmae revocrequame revocrequaem
revocreqaeum revocreqaemu revocreqauem revocreqaume revocreqamue revocreqameu revocreumqea revocreumqae revocreumeqa
revocreumeaq revocreumaeq revocreumaqe revocreuqmea revocreuqmae revocreuqema revocreuqeam revocreuqaem revocreuqame
revocreueqma revocreueqam revocreuemqa revocreuemaq revocreueamq revocreueaqm revocreuaqem revocreuaqme revocreuaeqm
revocreuaemq revocreuameq revocreuamqe revocreamque revocreamqeu revocreamuqe revocreamueq revocreameuq revocreamequ
revocreaqmue revocreaqmeu revocreaqume revocreaquem revocreaqeum revocreaqemu revocreauqme revocreauqem revocreaumqe
revocreaumeq revocreauemq revocreaueqm revocreaequm revocreaeqmu revocreaeuqm revocreaeumq revocreaemuq revocreaemqu
revoceramque revoceramqeu revoceramuqe revoceramueq revocerameuq revoceramequ revoceraqmue revoceraqmeu revoceraqume
revoceraquem revoceraqeum revoceraqemu revocerauqme revocerauqem revoceraumqe revoceraumeq revocerauemq revoceraueqm
revoceraequm revoceraeqmu revoceraeuqm revoceraeumq revoceraemuq revoceraemqu revocermaque revocermaqeu revocermauqe
revocermaueq revocermaeuq revocermaequ revocermqaue revocermqaeu revocermquae revocermquea revocermqeua revocermqeau
revocermuqae revocermuqea revocermuaqe revocermuaeq revocermueaq revocermueqa revocermequa revocermeqau revocermeuqa
revocermeuaq revocermeauq revocermeaqu revocerqmaue revocerqmaeu revocerqmuae revocerqmuea revocerqmeua revocerqmeau
revocerqamue revocerqameu revocerqaume revocerqauem revocerqaeum revocerqaemu revocerquame revocerquaem revocerqumae
revocerqumea revocerquema revocerqueam revocerqeaum revocerqeamu revocerqeuam revocerqeuma revocerqemua revocerqemau
revocerumqae revocerumqea revocerumaqe revocerumaeq revocerumeaq revocerumeqa revoceruqmae revoceruqmea revoceruqame
revoceruqaem revoceruqeam revoceruqema revoceruaqme revoceruaqem revoceruamqe revoceruameq revoceruaemq revoceruaeqm
revocerueqam revocerueqma revocerueaqm revocerueamq revoceruemaq revoceruemqa revoceremqua revoceremqau revoceremuqa
revoceremuaq revoceremauq revoceremaqu revocereqmua revocereqmau revocerequma revocerequam revocereqaum revocereqamu
revocereuqma revocereuqam revocereumqa revocereumaq revocereuamq revocereuaqm revocereaqum revocereaqmu revocereauqm
revocereaumq revocereamuq revocereamqu revocearmque revocearmqeu revocearmuqe revocearmueq revocearmeuq revocearmequ
revocearqmue revocearqmeu revocearqume revocearquem revocearqeum revocearqemu revocearuqme revocearuqem revocearumqe
revocearumeq revocearuemq revocearueqm revocearequm revoceareqmu revoceareuqm revoceareumq revocearemuq revocearemqu
revoceamrque revoceamrqeu revoceamruqe revoceamrueq revoceamreuq revoceamrequ revoceamqrue revoceamqreu revoceamqure
revoceamquer revoceamqeur revoceamqeru revoceamuqre revoceamuqer revoceamurqe revoceamureq revoceamuerq revoceamueqr
revoceamequr revoceameqru revoceameuqr revoceameurq revoceameruq revoceamerqu revoceaqmrue revoceaqmreu revoceaqmure
revoceaqmuer revoceaqmeur revoceaqmeru revoceaqrmue revoceaqrmeu revoceaqrume revoceaqruem revoceaqreum revoceaqremu
revoceaqurme revoceaqurem revoceaqumre revoceaqumer revoceaquemr revoceaquerm revoceaqerum revoceaqermu revoceaqeurm
revoceaqeumr revoceaqemur revoceaqemru revoceaumqre revoceaumqer revoceaumrqe revoceaumreq revoceaumerq revoceaumeqr
revoceauqmre revoceauqmer revoceauqrme revoceauqrem revoceauqerm revoceauqemr revoceaurqme revoceaurqem revoceaurmqe
revoceaurmeq revoceauremq revoceaureqm revoceaueqrm revoceaueqmr revoceauerqm revoceauermq revoceauemrq revoceauemqr
revoceaemqur revoceaemqru revoceaemuqr revoceaemurq revoceaemruq revoceaemrqu revoceaeqmur revoceaeqmru revoceaequmr
revoceaequrm revoceaeqrum revoceaeqrmu revoceaeuqmr revoceaeuqrm revoceaeumqr revoceaeumrq revoceaeurmq revoceaeurqm
revoceaerqum revoceaerqmu revoceaeruqm revoceaerumq revoceaermuq revoceaermqu revocemarque revocemarqeu revocemaruqe
revocemarueq revocemareuq revocemarequ revocemaqrue revocemaqreu revocemaqure revocemaquer revocemaqeur revocemaqeru
revocemauqre revocemauqer revocemaurqe revocemaureq revocemauerq revocemaueqr revocemaequr revocemaeqru revocemaeuqr
revocemaeurq revocemaeruq revocemaerqu revocemraque revocemraqeu revocemrauqe revocemraueq revocemraeuq revocemraequ
revocemrqaue revocemrqaeu revocemrquae revocemrquea revocemrqeua revocemrqeau revocemruqae revocemruqea revocemruaqe
revocemruaeq revocemrueaq revocemrueqa revocemrequa revocemreqau revocemreuqa revocemreuaq revocemreauq revocemreaqu
revocemqraue revocemqraeu revocemqruae revocemqruea revocemqreua revocemqreau revocemqarue revocemqareu revocemqaure
revocemqauer revocemqaeur revocemqaeru revocemquare revocemquaer revocemqurae revocemqurea revocemquera revocemquear
revocemqeaur revocemqearu revocemqeuar revocemqeura revocemqerua revocemqerau revocemurqae revocemurqea revocemuraqe
revocemuraeq revocemureaq revocemureqa revocemuqrae revocemuqrea revocemuqare revocemuqaer revocemuqear revocemuqera
revocemuaqre revocemuaqer revocemuarqe revocemuareq revocemuaerq revocemuaeqr revocemueqar revocemueqra revocemueaqr
revocemuearq revocemueraq revocemuerqa revocemerqua revocemerqau revocemeruqa revocemeruaq revocemerauq revocemeraqu
revocemeqrua revocemeqrau revocemequra revocemequar revocemeqaur revocemeqaru revocemeuqra revocemeuqar revocemeurqa
revocemeuraq revocemeuarq revocemeuaqr revocemeaqur revocemeaqru revocemeauqr revocemeaurq revocemearuq revocemearqu
revoceqamrue revoceqamreu revoceqamure revoceqamuer revoceqameur revoceqameru revoceqarmue revoceqarmeu revoceqarume
revoceqaruem revoceqareum revoceqaremu revoceqaurme revoceqaurem revoceqaumre revoceqaumer revoceqauemr revoceqauerm
revoceqaerum revoceqaermu revoceqaeurm revoceqaeumr revoceqaemur revoceqaemru revoceqmarue revoceqmareu revoceqmaure
revoceqmauer revoceqmaeur revoceqmaeru revoceqmraue revoceqmraeu revoceqmruae revoceqmruea revoceqmreua revoceqmreau
revoceqmurae revoceqmurea revoceqmuare revoceqmuaer revoceqmuear revoceqmuera revoceqmerua revoceqmerau revoceqmeura
revoceqmeuar revoceqmeaur revoceqmearu revoceqrmaue revoceqrmaeu revoceqrmuae revoceqrmuea revoceqrmeua revoceqrmeau
revoceqramue revoceqrameu revoceqraume revoceqrauem revoceqraeum revoceqraemu revoceqruame revoceqruaem revoceqrumae
revoceqrumea revoceqruema revoceqrueam revoceqreaum revoceqreamu revoceqreuam revoceqreuma revoceqremua revoceqremau
revocequmrae revocequmrea revocequmare revocequmaer revocequmear revocequmera revocequrmae revocequrmea revocequrame
revocequraem revocequream revocequrema revocequarme revocequarem revocequamre revocequamer revocequaemr revocequaerm
revocequeram revocequerma revocequearm revocequeamr revocequemar revocequemra revoceqemrua revoceqemrau revoceqemura
revoceqemuar revoceqemaur revoceqemaru revoceqermua revoceqermau revoceqeruma revoceqeruam revoceqeraum revoceqeramu
revoceqeurma revoceqeuram revoceqeumra revoceqeumar revoceqeuamr revoceqeuarm revoceqearum revoceqearmu revoceqeaurm
revoceqeaumr revoceqeamur revoceqeamru revoceuamqre revoceuamqer revoceuamrqe revoceuamreq revoceuamerq revoceuameqr
revoceuaqmre revoceuaqmer revoceuaqrme revoceuaqrem revoceuaqerm revoceuaqemr revoceuarqme revoceuarqem revoceuarmqe
revoceuarmeq revoceuaremq revoceuareqm revoceuaeqrm revoceuaeqmr revoceuaerqm revoceuaermq revoceuaemrq revoceuaemqr
revoceumaqre revoceumaqer revoceumarqe revoceumareq revoceumaerq revoceumaeqr revoceumqare revoceumqaer revoceumqrae
revoceumqrea revoceumqera revoceumqear revoceumrqae revoceumrqea revoceumraqe revoceumraeq revoceumreaq revoceumreqa
revoceumeqra revoceumeqar revoceumerqa revoceumeraq revoceumearq revoceumeaqr revoceuqmare revoceuqmaer revoceuqmrae
revoceuqmrea revoceuqmera revoceuqmear revoceuqamre revoceuqamer revoceuqarme revoceuqarem revoceuqaerm revoceuqaemr
revoceuqrame revoceuqraem revoceuqrmae revoceuqrmea revoceuqrema revoceuqream revoceuqearm revoceuqeamr revoceuqeram
revoceuqerma revoceuqemra revoceuqemar revoceurmqae revoceurmqea revoceurmaqe revoceurmaeq revoceurmeaq revoceurmeqa
revoceurqmae revoceurqmea revoceurqame revoceurqaem revoceurqeam revoceurqema revoceuraqme revoceuraqem revoceuramqe
revoceurameq revoceuraemq revoceuraeqm revoceureqam revoceureqma revoceureaqm revoceureamq revoceuremaq revoceuremqa
revoceuemqra revoceuemqar revoceuemrqa revoceuemraq revoceuemarq revoceuemaqr revoceueqmra revoceueqmar revoceueqrma
revoceueqram revoceueqarm revoceueqamr revoceuerqma revoceuerqam revoceuermqa revoceuermaq revoceueramq revoceueraqm
revoceueaqrm revoceueaqmr revoceuearqm revoceuearmq revoceueamrq revoceueamqr revoceeamqur revoceeamqru revoceeamuqr
revoceeamurq revoceeamruq revoceeamrqu revoceeaqmur revoceeaqmru revoceeaqumr revoceeaqurm revoceeaqrum revoceeaqrmu
revoceeauqmr revoceeauqrm revoceeaumqr revoceeaumrq revoceeaurmq revoceeaurqm revoceearqum revoceearqmu revoceearuqm
revoceearumq revoceearmuq revoceearmqu revoceemaqur revoceemaqru revoceemauqr revoceemaurq revoceemaruq revoceemarqu
revoceemqaur revoceemqaru revoceemquar revoceemqura revoceemqrua revoceemqrau revoceemuqar revoceemuqra revoceemuaqr
revoceemuarq revoceemuraq revoceemurqa revoceemrqua revoceemrqau revoceemruqa revoceemruaq revoceemrauq revoceemraqu
revoceeqmaur revoceeqmaru revoceeqmuar revoceeqmura revoceeqmrua revoceeqmrau revoceeqamur revoceeqamru revoceeqaumr
revoceeqaurm revoceeqarum revoceeqarmu revoceequamr revoceequarm revoceequmar revoceequmra revoceequrma revoceequram
revoceeqraum revoceeqramu revoceeqruam revoceeqruma revoceeqrmua revoceeqrmau revoceeumqar revoceeumqra revoceeumaqr
revoceeumarq revoceeumraq revoceeumrqa revoceeuqmar revoceeuqmra revoceeuqamr revoceeuqarm revoceeuqram revoceeuqrma
revoceeuaqmr revoceeuaqrm revoceeuamqr revoceeuamrq revoceeuarmq revoceeuarqm revoceeurqam revoceeurqma revoceeuraqm
revoceeuramq revoceeurmaq revoceeurmqa revoceermqua revoceermqau revoceermuqa revoceermuaq revoceermauq revoceermaqu
revoceerqmua revoceerqmau revoceerquma revoceerquam revoceerqaum revoceerqamu revoceeruqma revoceeruqam revoceerumqa
revoceerumaq revoceeruamq revoceeruaqm revoceeraqum revoceeraqmu revoceerauqm revoceeraumq revoceeramuq revoceeramqu
revocmreaque revocmreaqeu revocmreauqe revocmreaueq revocmreaeuq revocmreaequ revocmreqaue revocmreqaeu revocmrequae
revocmrequea revocmreqeua revocmreqeau revocmreuqae revocmreuqea revocmreuaqe revocmreuaeq revocmreueaq revocmreueqa
revocmreequa revocmreeqau revocmreeuqa revocmreeuaq revocmreeauq revocmreeaqu revocmraeque revocmraeqeu revocmraeuqe
revocmraeueq revocmraeeuq revocmraeequ revocmraqeue revocmraqeeu revocmraquee revocmraquee revocmraqeue revocmraqeeu
revocmrauqee revocmrauqee revocmraueqe revocmraueeq revocmraueeq revocmraueqe revocmraeque revocmraeqeu revocmraeuqe
revocmraeueq revocmraeeuq revocmraeequ revocmrqaeue revocmrqaeeu revocmrqauee revocmrqauee revocmrqaeue revocmrqaeeu
revocmrqeaue revocmrqeaeu revocmrqeuae revocmrqeuea revocmrqeeua revocmrqeeau revocmrqueae revocmrqueea revocmrquaee
revocmrquaee revocmrqueae revocmrqueea revocmrqeeua revocmrqeeau revocmrqeuea revocmrqeuae revocmrqeaue revocmrqeaeu
revocmruaqee revocmruaqee revocmruaeqe revocmruaeeq revocmruaeeq revocmruaeqe revocmruqaee revocmruqaee revocmruqeae
revocmruqeea revocmruqeea revocmruqeae revocmrueqae revocmrueqea revocmrueaqe revocmrueaeq revocmrueeaq revocmrueeqa
revocmrueqea revocmrueqae revocmrueeqa revocmrueeaq revocmrueaeq revocmrueaqe revocmreaque revocmreaqeu revocmreauqe
revocmreaueq revocmreaeuq revocmreaequ revocmreqaue revocmreqaeu revocmrequae revocmrequea revocmreqeua revocmreqeau
revocmreuqae revocmreuqea revocmreuaqe revocmreuaeq revocmreueaq revocmreueqa revocmreequa revocmreeqau revocmreeuqa
revocmreeuaq revocmreeauq revocmreeaqu revocmeraque revocmeraqeu revocmerauqe revocmeraueq revocmeraeuq revocmeraequ
revocmerqaue revocmerqaeu revocmerquae revocmerquea revocmerqeua revocmerqeau revocmeruqae revocmeruqea revocmeruaqe
revocmeruaeq revocmerueaq revocmerueqa revocmerequa revocmereqau revocmereuqa revocmereuaq revocmereauq revocmereaqu
revocmearque revocmearqeu revocmearuqe revocmearueq revocmeareuq revocmearequ revocmeaqrue revocmeaqreu revocmeaqure
revocmeaquer revocmeaqeur revocmeaqeru revocmeauqre revocmeauqer revocmeaurqe revocmeaureq revocmeauerq revocmeaueqr
revocmeaequr revocmeaeqru revocmeaeuqr revocmeaeurq revocmeaeruq revocmeaerqu revocmeqarue revocmeqareu revocmeqaure
revocmeqauer revocmeqaeur revocmeqaeru revocmeqraue revocmeqraeu revocmeqruae revocmeqruea revocmeqreua revocmeqreau
revocmequrae revocmequrea revocmequare revocmequaer revocmequear revocmequera revocmeqerua revocmeqerau revocmeqeura
revocmeqeuar revocmeqeaur revocmeqearu revocmeuaqre revocmeuaqer revocmeuarqe revocmeuareq revocmeuaerq revocmeuaeqr
revocmeuqare revocmeuqaer revocmeuqrae revocmeuqrea revocmeuqera revocmeuqear revocmeurqae revocmeurqea revocmeuraqe
revocmeuraeq revocmeureaq revocmeureqa revocmeueqra revocmeueqar revocmeuerqa revocmeueraq revocmeuearq revocmeueaqr
revocmeeaqur revocmeeaqru revocmeeauqr revocmeeaurq revocmeearuq revocmeearqu revocmeeqaur revocmeeqaru revocmeequar
revocmeequra revocmeeqrua revocmeeqrau revocmeeuqar revocmeeuqra revocmeeuaqr revocmeeuarq revocmeeuraq revocmeeurqa
revocmeerqua revocmeerqau revocmeeruqa revocmeeruaq revocmeerauq revocmeeraqu revocmaerque revocmaerqeu revocmaeruqe
revocmaerueq revocmaereuq revocmaerequ revocmaeqrue revocmaeqreu revocmaequre revocmaequer revocmaeqeur revocmaeqeru
revocmaeuqre revocmaeuqer revocmaeurqe revocmaeureq revocmaeuerq revocmaeueqr revocmaeequr revocmaeeqru revocmaeeuqr
revocmaeeurq revocmaeeruq revocmaeerqu revocmareque revocmareqeu revocmareuqe revocmareueq revocmareeuq revocmareequ
revocmarqeue revocmarqeeu revocmarquee revocmarquee revocmarqeue revocmarqeeu revocmaruqee revocmaruqee revocmarueqe
revocmarueeq revocmarueeq revocmarueqe revocmareque revocmareqeu revocmareuqe revocmareueq revocmareeuq revocmareequ
revocmaqreue revocmaqreeu revocmaqruee revocmaqruee revocmaqreue revocmaqreeu revocmaqerue revocmaqereu revocmaqeure
revocmaqeuer revocmaqeeur revocmaqeeru revocmaquere revocmaqueer revocmaquree revocmaquree revocmaquere revocmaqueer
revocmaqeeur revocmaqeeru revocmaqeuer revocmaqeure revocmaqerue revocmaqereu revocmaurqee revocmaurqee revocmaureqe
revocmaureeq revocmaureeq revocmaureqe revocmauqree revocmauqree revocmauqere revocmauqeer revocmauqeer revocmauqere
revocmaueqre revocmaueqer revocmauerqe revocmauereq revocmaueerq revocmaueeqr revocmaueqer revocmaueqre revocmaueeqr
revocmaueerq revocmauereq revocmauerqe revocmaerque revocmaerqeu revocmaeruqe revocmaerueq revocmaereuq revocmaerequ
revocmaeqrue revocmaeqreu revocmaequre revocmaequer revocmaeqeur revocmaeqeru revocmaeuqre revocmaeuqer revocmaeurqe
revocmaeureq revocmaeuerq revocmaeueqr revocmaeequr revocmaeeqru revocmaeeuqr revocmaeeurq revocmaeeruq revocmaeerqu
revocmqearue revocmqeareu revocmqeaure revocmqeauer revocmqeaeur revocmqeaeru revocmqeraue revocmqeraeu revocmqeruae
revocmqeruea revocmqereua revocmqereau revocmqeurae revocmqeurea revocmqeuare revocmqeuaer revocmqeuear revocmqeuera
revocmqeerua revocmqeerau revocmqeeura revocmqeeuar revocmqeeaur revocmqeearu revocmqaerue revocmqaereu revocmqaeure
revocmqaeuer revocmqaeeur revocmqaeeru revocmqareue revocmqareeu revocmqaruee revocmqaruee revocmqareue revocmqareeu
revocmqauree revocmqauree revocmqauere revocmqaueer revocmqaueer revocmqauere revocmqaerue revocmqaereu revocmqaeure
revocmqaeuer revocmqaeeur revocmqaeeru revocmqraeue revocmqraeeu revocmqrauee revocmqrauee revocmqraeue revocmqraeeu
revocmqreaue revocmqreaeu revocmqreuae revocmqreuea revocmqreeua revocmqreeau revocmqrueae revocmqrueea revocmqruaee
revocmqruaee revocmqrueae revocmqrueea revocmqreeua revocmqreeau revocmqreuea revocmqreuae revocmqreaue revocmqreaeu
revocmquaree revocmquaree revocmquaere revocmquaeer revocmquaeer revocmquaere revocmquraee revocmquraee revocmqureae
revocmqureea revocmqureea revocmqureae revocmquerae revocmquerea revocmqueare revocmqueaer revocmqueear revocmqueera
revocmquerea revocmquerae revocmqueera revocmqueear revocmqueaer revocmqueare revocmqearue revocmqeareu revocmqeaure
revocmqeauer revocmqeaeur revocmqeaeru revocmqeraue revocmqeraeu revocmqeruae revocmqeruea revocmqereua revocmqereau
revocmqeurae revocmqeurea revocmqeuare revocmqeuaer revocmqeuear revocmqeuera revocmqeerua revocmqeerau revocmqeeura
revocmqeeuar revocmqeeaur revocmqeearu revocmueaqre revocmueaqer revocmuearqe revocmueareq revocmueaerq revocmueaeqr
revocmueqare revocmueqaer revocmueqrae revocmueqrea revocmueqera revocmueqear revocmuerqae revocmuerqea revocmueraqe
revocmueraeq revocmuereaq revocmuereqa revocmueeqra revocmueeqar revocmueerqa revocmueeraq revocmueearq revocmueeaqr
revocmuaeqre revocmuaeqer revocmuaerqe revocmuaereq revocmuaeerq revocmuaeeqr revocmuaqere revocmuaqeer revocmuaqree
revocmuaqree revocmuaqere revocmuaqeer revocmuarqee revocmuarqee revocmuareqe revocmuareeq revocmuareeq revocmuareqe
revocmuaeqre revocmuaeqer revocmuaerqe revocmuaereq revocmuaeerq revocmuaeeqr revocmuqaere revocmuqaeer revocmuqaree
revocmuqaree revocmuqaere revocmuqaeer revocmuqeare revocmuqeaer revocmuqerae revocmuqerea revocmuqeera revocmuqeear
revocmuqreae revocmuqreea revocmuqraee revocmuqraee revocmuqreae revocmuqreea revocmuqeera revocmuqeear revocmuqerea
revocmuqerae revocmuqeare revocmuqeaer revocmuraqee revocmuraqee revocmuraeqe revocmuraeeq revocmuraeeq revocmuraeqe
revocmurqaee revocmurqaee revocmurqeae revocmurqeea revocmurqeea revocmurqeae revocmureqae revocmureqea revocmureaqe
revocmureaeq revocmureeaq revocmureeqa revocmureqea revocmureqae revocmureeqa revocmureeaq revocmureaeq revocmureaqe
revocmueaqre revocmueaqer revocmuearqe revocmueareq revocmueaerq revocmueaeqr revocmueqare revocmueqaer revocmueqrae
revocmueqrea revocmueqera revocmueqear revocmuerqae revocmuerqea revocmueraqe revocmueraeq revocmuereaq revocmuereqa
revocmueeqra revocmueeqar revocmueerqa revocmueeraq revocmueearq revocmueeaqr revocmeeaqur revocmeeaqru revocmeeauqr
revocmeeaurq revocmeearuq revocmeearqu revocmeeqaur revocmeeqaru revocmeequar revocmeequra revocmeeqrua revocmeeqrau
revocmeeuqar revocmeeuqra revocmeeuaqr revocmeeuarq revocmeeuraq revocmeeurqa revocmeerqua revocmeerqau revocmeeruqa
revocmeeruaq revocmeerauq revocmeeraqu revocmeaequr revocmeaeqru revocmeaeuqr revocmeaeurq revocmeaeruq revocmeaerqu
revocmeaqeur revocmeaqeru revocmeaquer revocmeaqure revocmeaqrue revocmeaqreu revocmeauqer revocmeauqre revocmeaueqr
revocmeauerq revocmeaureq revocmeaurqe revocmearque revocmearqeu revocmearuqe revocmearueq revocmeareuq revocmearequ
revocmeqaeur revocmeqaeru revocmeqauer revocmeqaure revocmeqarue revocmeqareu revocmeqeaur revocmeqearu revocmeqeuar
revocmeqeura revocmeqerua revocmeqerau revocmequear revocmequera revocmequaer revocmequare revocmequrae revocmequrea
revocmeqreua revocmeqreau revocmeqruea revocmeqruae revocmeqraue revocmeqraeu revocmeuaqer revocmeuaqre revocmeuaeqr
revocmeuaerq revocmeuareq revocmeuarqe revocmeuqaer revocmeuqare revocmeuqear revocmeuqera revocmeuqrea revocmeuqrae
revocmeueqar revocmeueqra revocmeueaqr revocmeuearq revocmeueraq revocmeuerqa revocmeurqea revocmeurqae revocmeureqa
revocmeureaq revocmeuraeq revocmeuraqe revocmeraque revocmeraqeu revocmerauqe revocmeraueq revocmeraeuq revocmeraequ
revocmerqaue revocmerqaeu revocmerquae revocmerquea revocmerqeua revocmerqeau revocmeruqae revocmeruqea revocmeruaqe
revocmeruaeq revocmerueaq revocmerueqa revocmerequa revocmereqau revocmereuqa revocmereuaq revocmereauq revocmereaqu
revocqremaue revocqremaeu revocqremuae revocqremuea revocqremeua revocqremeau revocqreamue revocqreameu revocqreaume
revocqreauem revocqreaeum revocqreaemu revocqreuame revocqreuaem revocqreumae revocqreumea revocqreuema revocqreueam
revocqreeaum revocqreeamu revocqreeuam revocqreeuma revocqreemua revocqreemau revocqrmeaue revocqrmeaeu revocqrmeuae
revocqrmeuea revocqrmeeua revocqrmeeau revocqrmaeue revocqrmaeeu revocqrmauee revocqrmauee revocqrmaeue revocqrmaeeu
revocqrmuaee revocqrmuaee revocqrmueae revocqrmueea revocqrmueea revocqrmueae revocqrmeaue revocqrmeaeu revocqrmeuae
revocqrmeuea revocqrmeeua revocqrmeeau revocqrameue revocqrameeu revocqramuee revocqramuee revocqrameue revocqrameeu
revocqraemue revocqraemeu revocqraeume revocqraeuem revocqraeeum revocqraeemu revocqraueme revocqraueem revocqraumee
revocqraumee revocqraueme revocqraueem revocqraeeum revocqraeemu revocqraeuem revocqraeume revocqraemue revocqraemeu
revocqrumaee revocqrumaee revocqrumeae revocqrumeea revocqrumeea revocqrumeae revocqruamee revocqruamee revocqruaeme
revocqruaeem revocqruaeem revocqruaeme revocqrueame revocqrueaem revocqruemae revocqruemea revocqrueema revocqrueeam
revocqrueaem revocqrueame revocqrueeam revocqrueema revocqruemea revocqruemae revocqremaue revocqremaeu revocqremuae
revocqremuea revocqremeua revocqremeau revocqreamue revocqreameu revocqreaume revocqreauem revocqreaeum revocqreaemu
revocqreuame revocqreuaem revocqreumae revocqreumea revocqreuema revocqreueam revocqreeaum revocqreeamu revocqreeuam
revocqreeuma revocqreemua revocqreemau revocqermaue revocqermaeu revocqermuae revocqermuea revocqermeua revocqermeau
revocqeramue revocqerameu revocqeraume revocqerauem revocqeraeum revocqeraemu revocqeruame revocqeruaem revocqerumae
revocqerumea revocqeruema revocqerueam revocqereaum revocqereamu revocqereuam revocqereuma revocqeremua revocqeremau
revocqemraue revocqemraeu revocqemruae revocqemruea revocqemreua revocqemreau revocqemarue revocqemareu revocqemaure
revocqemauer revocqemaeur revocqemaeru revocqemuare revocqemuaer revocqemurae revocqemurea revocqemuera revocqemuear
revocqemeaur revocqemearu revocqemeuar revocqemeura revocqemerua revocqemerau revocqeamrue revocqeamreu revocqeamure
revocqeamuer revocqeameur revocqeameru revocqearmue revocqearmeu revocqearume revocqearuem revocqeareum revocqearemu
revocqeaurme revocqeaurem revocqeaumre revocqeaumer revocqeauemr revocqeauerm revocqeaerum revocqeaermu revocqeaeurm
revocqeaeumr revocqeaemur revocqeaemru revocqeumare revocqeumaer revocqeumrae revocqeumrea revocqeumera revocqeumear
revocqeuamre revocqeuamer revocqeuarme revocqeuarem revocqeuaerm revocqeuaemr revocqeurame revocqeuraem revocqeurmae
revocqeurmea revocqeurema revocqeuream revocqeuearm revocqeueamr revocqeueram revocqeuerma revocqeuemra revocqeuemar
revocqeemaur revocqeemaru revocqeemuar revocqeemura revocqeemrua revocqeemrau revocqeeamur revocqeeamru revocqeeaumr
revocqeeaurm revocqeearum revocqeearmu revocqeeuamr revocqeeuarm revocqeeumar revocqeeumra revocqeeurma revocqeeuram
revocqeeraum revocqeeramu revocqeeruam revocqeeruma revocqeermua revocqeermau revocqmeraue revocqmeraeu revocqmeruae
revocqmeruea revocqmereua revocqmereau revocqmearue revocqmeareu revocqmeaure revocqmeauer revocqmeaeur revocqmeaeru
revocqmeuare revocqmeuaer revocqmeurae revocqmeurea revocqmeuera revocqmeuear revocqmeeaur revocqmeearu revocqmeeuar
revocqmeeura revocqmeerua revocqmeerau revocqmreaue revocqmreaeu revocqmreuae revocqmreuea revocqmreeua revocqmreeau
revocqmraeue revocqmraeeu revocqmrauee revocqmrauee revocqmraeue revocqmraeeu revocqmruaee revocqmruaee revocqmrueae
revocqmrueea revocqmrueea revocqmrueae revocqmreaue revocqmreaeu revocqmreuae revocqmreuea revocqmreeua revocqmreeau
revocqmareue revocqmareeu revocqmaruee revocqmaruee revocqmareue revocqmareeu revocqmaerue revocqmaereu revocqmaeure
revocqmaeuer revocqmaeeur revocqmaeeru revocqmauere revocqmaueer revocqmauree revocqmauree revocqmauere revocqmaueer
revocqmaeeur revocqmaeeru revocqmaeuer revocqmaeure revocqmaerue revocqmaereu revocqmuraee revocqmuraee revocqmureae
revocqmureea revocqmureea revocqmureae revocqmuaree revocqmuaree revocqmuaere revocqmuaeer revocqmuaeer revocqmuaere
revocqmueare revocqmueaer revocqmuerae revocqmuerea revocqmueera revocqmueear revocqmueaer revocqmueare revocqmueear
revocqmueera revocqmuerea revocqmuerae revocqmeraue revocqmeraeu revocqmeruae revocqmeruea revocqmereua revocqmereau
revocqmearue revocqmeareu revocqmeaure revocqmeauer revocqmeaeur revocqmeaeru revocqmeuare revocqmeuaer revocqmeurae
revocqmeurea revocqmeuera revocqmeuear revocqmeeaur revocqmeearu revocqmeeuar revocqmeeura revocqmeerua revocqmeerau
revocqaemrue revocqaemreu revocqaemure revocqaemuer revocqaemeur revocqaemeru revocqaermue revocqaermeu revocqaerume
revocqaeruem revocqaereum revocqaeremu revocqaeurme revocqaeurem revocqaeumre revocqaeumer revocqaeuemr revocqaeuerm
revocqaeerum revocqaeermu revocqaeeurm revocqaeeumr revocqaeemur revocqaeemru revocqamerue revocqamereu revocqameure
revocqameuer revocqameeur revocqameeru revocqamreue revocqamreeu revocqamruee revocqamruee revocqamreue revocqamreeu
revocqamuree revocqamuree revocqamuere revocqamueer revocqamueer revocqamuere revocqamerue revocqamereu revocqameure
revocqameuer revocqameeur revocqameeru revocqarmeue revocqarmeeu revocqarmuee revocqarmuee revocqarmeue revocqarmeeu
revocqaremue revocqaremeu revocqareume revocqareuem revocqareeum revocqareemu revocqarueme revocqarueem revocqarumee
revocqarumee revocqarueme revocqarueem revocqareeum revocqareemu revocqareuem revocqareume revocqaremue revocqaremeu
revocqaumree revocqaumree revocqaumere revocqaumeer revocqaumeer revocqaumere revocqaurmee revocqaurmee revocqaureme
revocqaureem revocqaureem revocqaureme revocqauerme revocqauerem revocqauemre revocqauemer revocqaueemr revocqaueerm
revocqauerem revocqauerme revocqaueerm revocqaueemr revocqauemer revocqauemre revocqaemrue revocqaemreu revocqaemure
revocqaemuer revocqaemeur revocqaemeru revocqaermue revocqaermeu revocqaerume revocqaeruem revocqaereum revocqaeremu
revocqaeurme revocqaeurem revocqaeumre revocqaeumer revocqaeuemr revocqaeuerm revocqaeerum revocqaeermu revocqaeeurm
revocqaeeumr revocqaeemur revocqaeemru revocquemare revocquemaer revocquemrae revocquemrea revocquemera revocquemear
revocqueamre revocqueamer revocquearme revocquearem revocqueaerm revocqueaemr revocquerame revocqueraem revocquermae
revocquermea revocquerema revocqueream revocqueearm revocqueeamr revocqueeram revocqueerma revocqueemra revocqueemar
revocqumeare revocqumeaer revocqumerae revocqumerea revocqumeera revocqumeear revocqumaere revocqumaeer revocqumaree
revocqumaree revocqumaere revocqumaeer revocqumraee revocqumraee revocqumreae revocqumreea revocqumreea revocqumreae
revocqumeare revocqumeaer revocqumerae revocqumerea revocqumeera revocqumeear revocquamere revocquameer revocquamree
revocquamree revocquamere revocquameer revocquaemre revocquaemer revocquaerme revocquaerem revocquaeerm revocquaeemr
revocquareme revocquareem revocquarmee revocquarmee revocquareme revocquareem revocquaeerm revocquaeemr revocquaerem
revocquaerme revocquaemre revocquaemer revocqurmaee revocqurmaee revocqurmeae revocqurmeea revocqurmeea revocqurmeae
revocquramee revocquramee revocquraeme revocquraeem revocquraeem revocquraeme revocqureame revocqureaem revocquremae
revocquremea revocqureema revocqureeam revocqureaem revocqureame revocqureeam revocqureema revocquremea revocquremae
revocquemare revocquemaer revocquemrae revocquemrea revocquemera revocquemear revocqueamre revocqueamer revocquearme
revocquearem revocqueaerm revocqueaemr revocquerame revocqueraem revocquermae revocquermea revocquerema revocqueream
revocqueearm revocqueeamr revocqueeram revocqueerma revocqueemra revocqueemar revocqeemaur revocqeemaru revocqeemuar
revocqeemura revocqeemrua revocqeemrau revocqeeamur revocqeeamru revocqeeaumr revocqeeaurm revocqeearum revocqeearmu
revocqeeuamr revocqeeuarm revocqeeumar revocqeeumra revocqeeurma revocqeeuram revocqeeraum revocqeeramu revocqeeruam
revocqeeruma revocqeermua revocqeermau revocqemeaur revocqemearu revocqemeuar revocqemeura revocqemerua revocqemerau
revocqemaeur revocqemaeru revocqemauer revocqemaure revocqemarue revocqemareu revocqemuaer revocqemuare revocqemuear
revocqemuera revocqemurea revocqemurae revocqemraue revocqemraeu revocqemruae revocqemruea revocqemreua revocqemreau
revocqeameur revocqeameru revocqeamuer revocqeamure revocqeamrue revocqeamreu revocqeaemur revocqeaemru revocqeaeumr
revocqeaeurm revocqeaerum revocqeaermu revocqeauemr revocqeauerm revocqeaumer revocqeaumre revocqeaurme revocqeaurem
revocqeareum revocqearemu revocqearuem revocqearume revocqearmue revocqearmeu revocqeumaer revocqeumare revocqeumear
revocqeumera revocqeumrea revocqeumrae revocqeuamer revocqeuamre revocqeuaemr revocqeuaerm revocqeuarem revocqeuarme
revocqeueamr revocqeuearm revocqeuemar revocqeuemra revocqeuerma revocqeueram revocqeuraem revocqeurame revocqeuream
revocqeurema revocqeurmea revocqeurmae revocqermaue revocqermaeu revocqermuae revocqermuea revocqermeua revocqermeau
revocqeramue revocqerameu revocqeraume revocqerauem revocqeraeum revocqeraemu revocqeruame revocqeruaem revocqerumae
revocqerumea revocqeruema revocqerueam revocqereaum revocqereamu revocqereuam revocqereuma revocqeremua revocqeremau
revocuremqae revocuremqea revocuremaqe revocuremaeq revocuremeaq revocuremeqa revocureqmae revocureqmea revocureqame
revocureqaem revocureqeam revocureqema revocureaqme revocureaqem revocureamqe revocureameq revocureaemq revocureaeqm
revocureeqam revocureeqma revocureeaqm revocureeamq revocureemaq revocureemqa revocurmeqae revocurmeqea revocurmeaqe
revocurmeaeq revocurmeeaq revocurmeeqa revocurmqeae revocurmqeea revocurmqaee revocurmqaee revocurmqeae revocurmqeea
revocurmaqee revocurmaqee revocurmaeqe revocurmaeeq revocurmaeeq revocurmaeqe revocurmeqae revocurmeqea revocurmeaqe
revocurmeaeq revocurmeeaq revocurmeeqa revocurqmeae revocurqmeea revocurqmaee revocurqmaee revocurqmeae revocurqmeea
revocurqemae revocurqemea revocurqeame revocurqeaem revocurqeeam revocurqeema revocurqaeme revocurqaeem revocurqamee
revocurqamee revocurqaeme revocurqaeem revocurqeeam revocurqeema revocurqeaem revocurqeame revocurqemae revocurqemea
revocuramqee revocuramqee revocurameqe revocurameeq revocurameeq revocurameqe revocuraqmee revocuraqmee revocuraqeme
revocuraqeem revocuraqeem revocuraqeme revocuraeqme revocuraeqem revocuraemqe revocuraemeq revocuraeemq revocuraeeqm
revocuraeqem revocuraeqme revocuraeeqm revocuraeemq revocuraemeq revocuraemqe revocuremqae revocuremqea revocuremaqe
revocuremaeq revocuremeaq revocuremeqa revocureqmae revocureqmea revocureqame revocureqaem revocureqeam revocureqema
revocureaqme revocureaqem revocureamqe revocureameq revocureaemq revocureaeqm revocureeqam revocureeqma revocureeaqm
revocureeamq revocureemaq revocureemqa revocuermqae revocuermqea revocuermaqe revocuermaeq revocuermeaq revocuermeqa
revocuerqmae revocuerqmea revocuerqame revocuerqaem revocuerqeam revocuerqema revocueraqme revocueraqem revocueramqe
revocuerameq revocueraemq revocueraeqm revocuereqam revocuereqma revocuereaqm revocuereamq revocueremaq revocueremqa
revocuemrqae revocuemrqea revocuemraqe revocuemraeq revocuemreaq revocuemreqa revocuemqrae revocuemqrea revocuemqare
revocuemqaer revocuemqear revocuemqera revocuemaqre revocuemaqer revocuemarqe revocuemareq revocuemaerq revocuemaeqr
revocuemeqar revocuemeqra revocuemeaqr revocuemearq revocuemeraq revocuemerqa revocueqmrae revocueqmrea revocueqmare
revocueqmaer revocueqmear revocueqmera revocueqrmae revocueqrmea revocueqrame revocueqraem revocueqream revocueqrema
revocueqarme revocueqarem revocueqamre revocueqamer revocueqaemr revocueqaerm revocueqeram revocueqerma revocueqearm
revocueqeamr revocueqemar revocueqemra revocueamqre revocueamqer revocueamrqe revocueamreq revocueamerq revocueameqr
revocueaqmre revocueaqmer revocueaqrme revocueaqrem revocueaqerm revocueaqemr revocuearqme revocuearqem revocuearmqe
revocuearmeq revocuearemq revocueareqm revocueaeqrm revocueaeqmr revocueaerqm revocueaermq revocueaemrq revocueaemqr
revocueemqar revocueemqra revocueemaqr revocueemarq revocueemraq revocueemrqa revocueeqmar revocueeqmra revocueeqamr
revocueeqarm revocueeqram revocueeqrma revocueeaqmr revocueeaqrm revocueeamqr revocueeamrq revocueearmq revocueearqm
revocueerqam revocueerqma revocueeraqm revocueeramq revocueermaq revocueermqa revocumerqae revocumerqea revocumeraqe
revocumeraeq revocumereaq revocumereqa revocumeqrae revocumeqrea revocumeqare revocumeqaer revocumeqear revocumeqera
revocumeaqre revocumeaqer revocumearqe revocumeareq revocumeaerq revocumeaeqr revocumeeqar revocumeeqra revocumeeaqr
revocumeearq revocumeeraq revocumeerqa revocumreqae revocumreqea revocumreaqe revocumreaeq revocumreeaq revocumreeqa
revocumrqeae revocumrqeea revocumrqaee revocumrqaee revocumrqeae revocumrqeea revocumraqee revocumraqee revocumraeqe
revocumraeeq revocumraeeq revocumraeqe revocumreqae revocumreqea revocumreaqe revocumreaeq revocumreeaq revocumreeqa
revocumqreae revocumqreea revocumqraee revocumqraee revocumqreae revocumqreea revocumqerae revocumqerea revocumqeare
revocumqeaer revocumqeear revocumqeera revocumqaere revocumqaeer revocumqaree revocumqaree revocumqaere revocumqaeer
revocumqeear revocumqeera revocumqeaer revocumqeare revocumqerae revocumqerea revocumarqee revocumarqee revocumareqe
revocumareeq revocumareeq revocumareqe revocumaqree revocumaqree revocumaqere revocumaqeer revocumaqeer revocumaqere
revocumaeqre revocumaeqer revocumaerqe revocumaereq revocumaeerq revocumaeeqr revocumaeqer revocumaeqre revocumaeeqr
revocumaeerq revocumaereq revocumaerqe revocumerqae revocumerqea revocumeraqe revocumeraeq revocumereaq revocumereqa
revocumeqrae revocumeqrea revocumeqare revocumeqaer revocumeqear revocumeqera revocumeaqre revocumeaqer revocumearqe
revocumeareq revocumeaerq revocumeaeqr revocumeeqar revocumeeqra revocumeeaqr revocumeearq revocumeeraq revocumeerqa
revocuqemrae revocuqemrea revocuqemare revocuqemaer revocuqemear revocuqemera revocuqermae revocuqermea revocuqerame
revocuqeraem revocuqeream revocuqerema revocuqearme revocuqearem revocuqeamre revocuqeamer revocuqeaemr revocuqeaerm
revocuqeeram revocuqeerma revocuqeearm revocuqeeamr revocuqeemar revocuqeemra revocuqmerae revocuqmerea revocuqmeare
revocuqmeaer revocuqmeear revocuqmeera revocuqmreae revocuqmreea revocuqmraee revocuqmraee revocuqmreae revocuqmreea
revocuqmaree revocuqmaree revocuqmaere revocuqmaeer revocuqmaeer revocuqmaere revocuqmerae revocuqmerea revocuqmeare
revocuqmeaer revocuqmeear revocuqmeera revocuqrmeae revocuqrmeea revocuqrmaee revocuqrmaee revocuqrmeae revocuqrmeea
revocuqremae revocuqremea revocuqreame revocuqreaem revocuqreeam revocuqreema revocuqraeme revocuqraeem revocuqramee
revocuqramee revocuqraeme revocuqraeem revocuqreeam revocuqreema revocuqreaem revocuqreame revocuqremae revocuqremea
revocuqamree revocuqamree revocuqamere revocuqameer revocuqameer revocuqamere revocuqarmee revocuqarmee revocuqareme
revocuqareem revocuqareem revocuqareme revocuqaerme revocuqaerem revocuqaemre revocuqaemer revocuqaeemr revocuqaeerm
revocuqaerem revocuqaerme revocuqaeerm revocuqaeemr revocuqaemer revocuqaemre revocuqemrae revocuqemrea revocuqemare
revocuqemaer revocuqemear revocuqemera revocuqermae revocuqermea revocuqerame revocuqeraem revocuqeream revocuqerema
revocuqearme revocuqearem revocuqeamre revocuqeamer revocuqeaemr revocuqeaerm revocuqeeram revocuqeerma revocuqeearm
revocuqeeamr revocuqeemar revocuqeemra revocuaemqre revocuaemqer revocuaemrqe revocuaemreq revocuaemerq revocuaemeqr
revocuaeqmre revocuaeqmer revocuaeqrme revocuaeqrem revocuaeqerm revocuaeqemr revocuaerqme revocuaerqem revocuaermqe
revocuaermeq revocuaeremq revocuaereqm revocuaeeqrm revocuaeeqmr revocuaeerqm revocuaeermq revocuaeemrq revocuaeemqr
revocuameqre revocuameqer revocuamerqe revocuamereq revocuameerq revocuameeqr revocuamqere revocuamqeer revocuamqree
revocuamqree revocuamqere revocuamqeer revocuamrqee revocuamrqee revocuamreqe revocuamreeq revocuamreeq revocuamreqe
revocuameqre revocuameqer revocuamerqe revocuamereq revocuameerq revocuameeqr revocuaqmere revocuaqmeer revocuaqmree
revocuaqmree revocuaqmere revocuaqmeer revocuaqemre revocuaqemer revocuaqerme revocuaqerem revocuaqeerm revocuaqeemr
revocuaqreme revocuaqreem revocuaqrmee revocuaqrmee revocuaqreme revocuaqreem revocuaqeerm revocuaqeemr revocuaqerem
revocuaqerme revocuaqemre revocuaqemer revocuarmqee revocuarmqee revocuarmeqe revocuarmeeq revocuarmeeq revocuarmeqe
revocuarqmee revocuarqmee revocuarqeme revocuarqeem revocuarqeem revocuarqeme revocuareqme revocuareqem revocuaremqe
revocuaremeq revocuareemq revocuareeqm revocuareqem revocuareqme revocuareeqm revocuareemq revocuaremeq revocuaremqe
revocuaemqre revocuaemqer revocuaemrqe revocuaemreq revocuaemerq revocuaemeqr revocuaeqmre revocuaeqmer revocuaeqrme
revocuaeqrem revocuaeqerm revocuaeqemr revocuaerqme revocuaerqem revocuaermqe revocuaermeq revocuaeremq revocuaereqm
revocuaeeqrm revocuaeeqmr revocuaeerqm revocuaeermq revocuaeemrq revocuaeemqr revocueemqar revocueemqra revocueemaqr
revocueemarq revocueemraq revocueemrqa revocueeqmar revocueeqmra revocueeqamr revocueeqarm revocueeqram revocueeqrma
revocueeaqmr revocueeaqrm revocueeamqr revocueeamrq revocueearmq revocueearqm revocueerqam revocueerqma revocueeraqm
revocueeramq revocueermaq revocueermqa revocuemeqar revocuemeqra revocuemeaqr revocuemearq revocuemeraq revocuemerqa
revocuemqear revocuemqera revocuemqaer revocuemqare revocuemqrae revocuemqrea revocuemaqer revocuemaqre revocuemaeqr
revocuemaerq revocuemareq revocuemarqe revocuemrqae revocuemrqea revocuemraqe revocuemraeq revocuemreaq revocuemreqa
revocueqmear revocueqmera revocueqmaer revocueqmare revocueqmrae revocueqmrea revocueqemar revocueqemra revocueqeamr
revocueqearm revocueqeram revocueqerma revocueqaemr revocueqaerm revocueqamer revocueqamre revocueqarme revocueqarem
revocueqream revocueqrema revocueqraem revocueqrame revocueqrmae revocueqrmea revocueamqer revocueamqre revocueameqr
revocueamerq revocueamreq revocueamrqe revocueaqmer revocueaqmre revocueaqemr revocueaqerm revocueaqrem revocueaqrme
revocueaeqmr revocueaeqrm revocueaemqr revocueaemrq revocueaermq revocueaerqm revocuearqem revocuearqme revocueareqm
revocuearemq revocuearmeq revocuearmqe revocuermqae revocuermqea revocuermaqe revocuermaeq revocuermeaq revocuermeqa
revocuerqmae revocuerqmea revocuerqame revocuerqaem revocuerqeam revocuerqema revocueraqme revocueraqem revocueramqe
revocuerameq revocueraemq revocueraeqm revocuereqam revocuereqma revocuereaqm revocuereamq revocueremaq revocueremqa
revoceremqua revoceremqau revoceremuqa revoceremuaq revoceremauq revoceremaqu revocereqmua revocereqmau revocerequma
revocerequam revocereqaum revocereqamu revocereuqma revocereuqam revocereumqa revocereumaq revocereuamq revocereuaqm
revocereaqum revocereaqmu revocereauqm revocereaumq revocereamuq revocereamqu revocermequa revocermeqau revocermeuqa
revocermeuaq revocermeauq revocermeaqu revocermqeua revocermqeau revocermquea revocermquae revocermqaue revocermqaeu
revocermuqea revocermuqae revocermueqa revocermueaq revocermuaeq revocermuaqe revocermaque revocermaqeu revocermauqe
revocermaueq revocermaeuq revocermaequ revocerqmeua revocerqmeau revocerqmuea revocerqmuae revocerqmaue revocerqmaeu
revocerqemua revocerqemau revocerqeuma revocerqeuam revocerqeaum revocerqeamu revocerquema revocerqueam revocerqumea
revocerqumae revocerquame revocerquaem revocerqaeum revocerqaemu revocerqauem revocerqaume revocerqamue revocerqameu
revocerumqea revocerumqae revocerumeqa revocerumeaq revocerumaeq revocerumaqe revoceruqmea revoceruqmae revoceruqema
revoceruqeam revoceruqaem revoceruqame revocerueqma revocerueqam revoceruemqa revoceruemaq revocerueamq revocerueaqm
revoceruaqem revoceruaqme revoceruaeqm revoceruaemq revoceruameq revoceruamqe revoceramque revoceramqeu revoceramuqe
revoceramueq revocerameuq revoceramequ revoceraqmue revoceraqmeu revoceraqume revoceraquem revoceraqeum revoceraqemu
revocerauqme revocerauqem revoceraumqe revoceraumeq revocerauemq revoceraueqm revoceraequm revoceraeqmu revoceraeuqm
revoceraeumq revoceraemuq revoceraemqu revoceermqua revoceermqau revoceermuqa revoceermuaq revoceermauq revoceermaqu
revoceerqmua revoceerqmau revoceerquma revoceerquam revoceerqaum revoceerqamu revoceeruqma revoceeruqam revoceerumqa
revoceerumaq revoceeruamq revoceeruaqm revoceeraqum revoceeraqmu revoceerauqm revoceeraumq revoceeramuq revoceeramqu
revoceemrqua revoceemrqau revoceemruqa revoceemruaq revoceemrauq revoceemraqu revoceemqrua revoceemqrau revoceemqura
revoceemquar revoceemqaur revoceemqaru revoceemuqra revoceemuqar revoceemurqa revoceemuraq revoceemuarq revoceemuaqr
revoceemaqur revoceemaqru revoceemauqr revoceemaurq revoceemaruq revoceemarqu revoceeqmrua revoceeqmrau revoceeqmura
revoceeqmuar revoceeqmaur revoceeqmaru revoceeqrmua revoceeqrmau revoceeqruma revoceeqruam revoceeqraum revoceeqramu
revoceequrma revoceequram revoceequmra revoceequmar revoceequamr revoceequarm revoceeqarum revoceeqarmu revoceeqaurm
revoceeqaumr revoceeqamur revoceeqamru revoceeumqra revoceeumqar revoceeumrqa revoceeumraq revoceeumarq revoceeumaqr
revoceeuqmra revoceeuqmar revoceeuqrma revoceeuqram revoceeuqarm revoceeuqamr revoceeurqma revoceeurqam revoceeurmqa
revoceeurmaq revoceeuramq revoceeuraqm revoceeuaqrm revoceeuaqmr revoceeuarqm revoceeuarmq revoceeuamrq revoceeuamqr
revoceeamqur revoceeamqru revoceeamuqr revoceeamurq revoceeamruq revoceeamrqu revoceeaqmur revoceeaqmru revoceeaqumr
revoceeaqurm revoceeaqrum revoceeaqrmu revoceeauqmr revoceeauqrm revoceeaumqr revoceeaumrq revoceeaurmq revoceeaurqm
revoceearqum revoceearqmu revoceearuqm revoceearumq revoceearmuq revoceearmqu revocemerqua revocemerqau revocemeruqa
revocemeruaq revocemerauq revocemeraqu revocemeqrua revocemeqrau revocemequra revocemequar revocemeqaur revocemeqaru
revocemeuqra revocemeuqar revocemeurqa revocemeuraq revocemeuarq revocemeuaqr revocemeaqur revocemeaqru revocemeauqr
revocemeaurq revocemearuq revocemearqu revocemrequa revocemreqau revocemreuqa revocemreuaq revocemreauq revocemreaqu
revocemrqeua revocemrqeau revocemrquea revocemrquae revocemrqaue revocemrqaeu revocemruqea revocemruqae revocemrueqa
revocemrueaq revocemruaeq revocemruaqe revocemraque revocemraqeu revocemrauqe revocemraueq revocemraeuq revocemraequ
revocemqreua revocemqreau revocemqruea revocemqruae revocemqraue revocemqraeu revocemqerua revocemqerau revocemqeura
revocemqeuar revocemqeaur revocemqearu revocemquera revocemquear revocemqurea revocemqurae revocemquare revocemquaer
revocemqaeur revocemqaeru revocemqauer revocemqaure revocemqarue revocemqareu revocemurqea revocemurqae revocemureqa
revocemureaq revocemuraeq revocemuraqe revocemuqrea revocemuqrae revocemuqera revocemuqear revocemuqaer revocemuqare
revocemueqra revocemueqar revocemuerqa revocemueraq revocemuearq revocemueaqr revocemuaqer revocemuaqre revocemuaeqr
revocemuaerq revocemuareq revocemuarqe revocemarque revocemarqeu revocemaruqe revocemarueq revocemareuq revocemarequ
revocemaqrue revocemaqreu revocemaqure revocemaquer revocemaqeur revocemaqeru revocemauqre revocemauqer revocemaurqe
revocemaureq revocemauerq revocemaueqr revocemaequr revocemaeqru revocemaeuqr revocemaeurq revocemaeruq revocemaerqu
revoceqemrua revoceqemrau revoceqemura revoceqemuar revoceqemaur revoceqemaru revoceqermua revoceqermau revoceqeruma
revoceqeruam revoceqeraum revoceqeramu revoceqeurma revoceqeuram revoceqeumra revoceqeumar revoceqeuamr revoceqeuarm
revoceqearum revoceqearmu revoceqeaurm revoceqeaumr revoceqeamur revoceqeamru revoceqmerua revoceqmerau revoceqmeura
revoceqmeuar revoceqmeaur revoceqmearu revoceqmreua revoceqmreau revoceqmruea revoceqmruae revoceqmraue revoceqmraeu
revoceqmurea revoceqmurae revoceqmuera revoceqmuear revoceqmuaer revoceqmuare revoceqmarue revoceqmareu revoceqmaure
revoceqmauer revoceqmaeur revoceqmaeru revoceqrmeua revoceqrmeau revoceqrmuea revoceqrmuae revoceqrmaue revoceqrmaeu
revoceqremua revoceqremau revoceqreuma revoceqreuam revoceqreaum revoceqreamu revoceqruema revoceqrueam revoceqrumea
revoceqrumae revoceqruame revoceqruaem revoceqraeum revoceqraemu revoceqrauem revoceqraume revoceqramue revoceqrameu
revocequmrea revocequmrae revocequmera revocequmear revocequmaer revocequmare revocequrmea revocequrmae revocequrema
revocequream revocequraem revocequrame revocequerma revocequeram revocequemra revocequemar revocequeamr revocequearm
revocequarem revocequarme revocequaerm revocequaemr revocequamer revocequamre revoceqamrue revoceqamreu revoceqamure
revoceqamuer revoceqameur revoceqameru revoceqarmue revoceqarmeu revoceqarume revoceqaruem revoceqareum revoceqaremu
revoceqaurme revoceqaurem revoceqaumre revoceqaumer revoceqauemr revoceqauerm revoceqaerum revoceqaermu revoceqaeurm
revoceqaeumr revoceqaemur revoceqaemru revoceuemqra revoceuemqar revoceuemrqa revoceuemraq revoceuemarq revoceuemaqr
revoceueqmra revoceueqmar revoceueqrma revoceueqram revoceueqarm revoceueqamr revoceuerqma revoceuerqam revoceuermqa
revoceuermaq revoceueramq revoceueraqm revoceueaqrm revoceueaqmr revoceuearqm revoceuearmq revoceueamrq revoceueamqr
revoceumeqra revoceumeqar revoceumerqa revoceumeraq revoceumearq revoceumeaqr revoceumqera revoceumqear revoceumqrea
revoceumqrae revoceumqare revoceumqaer revoceumrqea revoceumrqae revoceumreqa revoceumreaq revoceumraeq revoceumraqe
revoceumaqre revoceumaqer revoceumarqe revoceumareq revoceumaerq revoceumaeqr revoceuqmera revoceuqmear revoceuqmrea
revoceuqmrae revoceuqmare revoceuqmaer revoceuqemra revoceuqemar revoceuqerma revoceuqeram revoceuqearm revoceuqeamr
revoceuqrema revoceuqream revoceuqrmea revoceuqrmae revoceuqrame revoceuqraem revoceuqaerm revoceuqaemr revoceuqarem
revoceuqarme revoceuqamre revoceuqamer revoceurmqea revoceurmqae revoceurmeqa revoceurmeaq revoceurmaeq revoceurmaqe
revoceurqmea revoceurqmae revoceurqema revoceurqeam revoceurqaem revoceurqame revoceureqma revoceureqam revoceuremqa
revoceuremaq revoceureamq revoceureaqm revoceuraqem revoceuraqme revoceuraeqm revoceuraemq revoceurameq revoceuramqe
revoceuamqre revoceuamqer revoceuamrqe revoceuamreq revoceuamerq revoceuameqr revoceuaqmre revoceuaqmer revoceuaqrme
revoceuaqrem revoceuaqerm revoceuaqemr revoceuarqme revoceuarqem revoceuarmqe revoceuarmeq revoceuaremq revoceuareqm
revoceuaeqrm revoceuaeqmr revoceuaerqm revoceuaermq revoceuaemrq revoceuaemqr revoceaemqur revoceaemqru revoceaemuqr
revoceaemurq revoceaemruq revoceaemrqu revoceaeqmur revoceaeqmru revoceaequmr revoceaequrm revoceaeqrum revoceaeqrmu
revoceaeuqmr revoceaeuqrm revoceaeumqr revoceaeumrq revoceaeurmq revoceaeurqm revoceaerqum revoceaerqmu revoceaeruqm
revoceaerumq revoceaermuq revoceaermqu revoceamequr revoceameqru revoceameuqr revoceameurq revoceameruq revoceamerqu
revoceamqeur revoceamqeru revoceamquer revoceamqure revoceamqrue revoceamqreu revoceamuqer revoceamuqre revoceamueqr
revoceamuerq revoceamureq revoceamurqe revoceamrque revoceamrqeu revoceamruqe revoceamrueq revoceamreuq revoceamrequ
revoceaqmeur revoceaqmeru revoceaqmuer revoceaqmure revoceaqmrue revoceaqmreu revoceaqemur revoceaqemru revoceaqeumr
revoceaqeurm revoceaqerum revoceaqermu revoceaquemr revoceaquerm revoceaqumer revoceaqumre revoceaqurme revoceaqurem
revoceaqreum revoceaqremu revoceaqruem revoceaqrume revoceaqrmue revoceaqrmeu revoceaumqer revoceaumqre revoceaumeqr
revoceaumerq revoceaumreq revoceaumrqe revoceauqmer revoceauqmre revoceauqemr revoceauqerm revoceauqrem revoceauqrme
revoceaueqmr revoceaueqrm revoceauemqr revoceauemrq revoceauermq revoceauerqm revoceaurqem revoceaurqme revoceaureqm
revoceauremq revoceaurmeq revoceaurmqe revocearmque revocearmqeu revocearmuqe revocearmueq revocearmeuq revocearmequ
revocearqmue revocearqmeu revocearqume revocearquem revocearqeum revocearqemu revocearuqme revocearuqem revocearumqe
revocearumeq revocearuemq revocearueqm revocearequm revoceareqmu revoceareuqm revoceareumq revocearemuq revocearemqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us